ELF|484 (444  TTT$$@%@5@5jgww  hhhDDPtd;;QtdRtd@%@5@5ZZ/lib/ld-linux.so.2GNU GNU{.o8A2}nT %@bB @A( !0  HȾf@``@#! pXHFp 42D"4!V $P*1Pmو AJCBA@ &P0LqK`8[4J%@L܃4$*@$! yg ,+ed4 %QEb@$ ŀHP"MjBq4P @H&P40X%al , QBB1S !6" bPQ @(@(j I`$@$`&) ,@ `( $ $@ 4!D@FƂ !)MU $ @$@Z+P@C` 㛔@@0@"`@$!h8"p0!DF@e J.P@yD! 0@@@)Pq @( TP  @'$"`P "0 B@ ` "Vʃ @aD#$ *&A0O`U$JH!%""U02 ( @ 2ل@(*Ґ(N`LHbH FzibC0fA̩!A`# @%q@/@PD D $DnEE@ ̈EY %"hHRH0$BXJAD 0 $ iDX ԙ)]FH(@(N HA@ @    "%'+,./01245679?ABDFGIKLMNOPQRUVWXYZ\]^_`dgilmoqrtuvwx{|} !"#$%'()*+-12579:;<=@ACDHIJKLMOPQRTVXYZ[\^`cdeghjmpqstvxy   "#&(*,.012567;<=?@ABDFGIKLMPQRSTVWY]^bcdimoqrsvwy{|}~  !#%')*+./01367;<=@DEGIKLMNOQTUWY[\]^`abcdfgklmnpquwy|    ?~0uO{ZT23wl:œ!(Kόkl23P}6xD7p6j" qYf@4?$9T0IӃj|܄fErLLS98 5pH9W?}88B ڽa㙕X!>ruCnBT {FAj1醛5d ^ ྡo\Z|`I#\RvMdb9_?N5c!gjTϥОo gi9 _ L'<ˎSҗ|SY$T< pgcr1NY쐑CsHiwf)2c/2]6Ξw%-A/( . Y! }kU ZɊ)/.71]H>zn#艹!>.]B_ m䬁U垟)2mZ2FVcIYRu+4`Rn&gY6̇\o^psNϹTvpˤ<FW%tB)&ҧ_ZRKF؋(xM"z~ORn!>=+,_CGIT$/H[J;$D5Ao`0{OK >DTlN%ǗođD4~U0~ӳsK ,+#>^ٞ >Rig !6+0O뤸1-|=HktepYFsVa kn)=5FWUF|4VR0G,yZ( |&w_ZvI?G_h:mAP<7pc R?*b&"aT;?8/HMˤFnBqUE+K}inR{*3=0nMziEhϦBr-ԋqX ד}WIhbt{l7fg901.Nd7\Ɵ)$ßz,Kls} 1kO'9PR#46q JG'xπ=mU P)ۧ0ԗdKE 'hoåR\Zt2Rw#i'7[Z jBwJD̘ɂ|р/Ey{͔iE'j,]h݆]o {)η!T3bO ;X\(GP_>v-]j$z &8NO vؙo@vxwVK:!c ӗNQ=&7zQvuEً<~.na!J9_V4hQ=c2+;aocq*XBg=mT`|gyv`N^H"4#)IRš<>,rI8NcตՅ ?|E4~-QhzK^'t"xJ])eVrsm񲦪UsO$:+=Gf}|ng &-L7P`GE)w4@CuϺ; e=CqRN8~ A1HnnPJ' i9IΖ LaVYWj~:6{gD}5 tטhPwwTtc'ٞ) N>Tќ9=ƳAUDV %˃ kcvPd PϹc1B@vZjU t9Sm^Gf1"t[>qS|B8L w Hw%eOAS[}WV 0|52TҪ*eMa?Mٵ0\v|]>. j?-JFGa+p7IWR=7L+MiwLCn`R3FO76-C[| d1z؎&2^q"&^сLUkH@wTe+]iv3⻼D Z Eoe&V `Y*0y"6ŁgP%;ȧDD^I~hGI؋%܍ܦ MAǡQg(NaZ",=MեpB"h%#m49s#k-A9rwmVܘĒ3ëx? :H/ m 7jaf Ɉ#]|jkաBKLF8^N:qF^Be*[KlBW|˩ vPظpn/iHRɵY8-diVjKv#ʔMnnMAl[$TeF<ǹy jLܺrl{ AZI#CGSP ߪW= 8Dd; NS%x'\;)Opˡwcjڰ2T7\Ƅ% \㜴:Z,o9>9{=}/nA>$NeX2aBJ 4sDY6CFÉf\{ӮL,0//a *O4eP7'W<`B ^oc+']=똒Ta?0ЏOR#ݩaM4HW\-"2dԞ>v ?JŽz(# uY]+ h'A~|2HA<)k`9ڠ6 :z|\"#@4+,__['1z9ÉS auϩG9K+Ƈ`iI=4 ]ljԁ*  79 8kE@9N+=Y2{Za0 W$  * E k  5 UT > Gh&Ge Mb &S pgR\D c# 2E  k6 OF L"^qA7 rC{rz u p5P lxy $^ T$pZv9 t T_  FUh - /g B)lEM .  ,a<  e*:b  ; &P- >lWY(Q  ./ 5 _` 2  % R0 %/  {7TZ /B5_ ;`>  BPo ,09 bX`_ X@bW ,  F + 2:PW <7  F9 %*PZ r d!T `" " XN|4 [P 5  2"De G#g  &pR" J ZY  @AH ` 0 ?p  T h_ptC tUM r9  aSG ?"% '| ) M VT I G ` & [p" \p- <x >!m =P' 4CP"  64 L- ? fL`s .)g  L9c  S  B  Y` vC  X W z"p O ;0wk /И UPE1 }& 4  ~;P :'  L M1 Zi C  EP  VPh & Q`/ hGi  U 6 01 & A V Zp  SP+  -  +0C v v*  hD:  XE   Z0m H < 9  K  Wc 1# Y;  zf # * " [b C )p6  @G} J1Y *p Z 4  6p{ ;` #Q 32P  _pE ;,p _ P !` 2#e C .'p P X'L  2Ph I@  $  ,0  DT9  c  Fz SN~  2С  5d  D ?ZPV  BNS  O {  C[8q %/0 D\`@  a ` #. @ "Й  * # H !@f V#Y 4 DFq  zp3 J @ Lw .= $@t %d{ 1  :  N U[ A  d  L  H*T = @Y  N3 H>@M JC   D2@QJYM 14p Hb k po +9\ C4 * ;Dn F I]* /*z K@6 ag ' Bl i3Е/ Sp: X X :p 7%  ` (V c)2 Ap b b `@/ UU`  !  11 NH0i @  }J 2 Kz 9 )b' Q2  Dc] R H !C 7W M  G@ C %  E@ = z ) B: Cp HP>  .` 6Q z  ]/ <) RSP# qC0 [ Q2 U2  xF`9 ( V mO &] 0 Dpa c ib, T `- bi 3 a3 R  I$p{ /N >Kf ~ +  < 4p@< B'{ Y` I Iu 0 2p !0R  K" ,`= 5cx &* -9 9- 5f ;  bP6h 0R I  Y  :0U * "# B N 2 m1b I  OP?  @f C V*@  (| ?<pq2 wW( > > GI rN i; *  [K  *m ?p z /@`  /bx R pL > DVB P- yZ\ &0 ' kFp+ Y@*  ]~  \?[ A %P>R kA`w #1 r! !p'  [@ r$0?  M0b ;p j  ( _ W/ ( <'  HF  bP$ Opw, nQ L`     ~ ^z l _` !2`@  /<`>+ {`0>  R = X`  ` O4P ^ >CQ ,q L/ Q O= - D_ \ U ?E A`@ 4*p3  J )>  @pSH 4a 8N@ut U !  /  $ 1  I)J *6P_ q) G< $ F@ g ` s, )M 1 ^<0S8 /+ "h  6pf p= +3 Z N iPm BPi P О  B ]y  U= :6 Wh  ~>p  E v  ^" |?> E ) R * P  3p[ *9 9= 0)  DM' 5 MU ?@ ^2 8 N0 # Y   +@ X -Cc =? M T /4` ~@{  'Fi  UP F  ]!b -  )2 2`  Qp0 \ ""p `x 7\  x6f D *Z@ \7  +G > C] 3 ,h  L30 Z@  ,Z #ГF O  : ' T  m4@2  >JP? NJ 4 J.@  QV  +p : Kq` ;]0c k;! 2  TX P\ u%? 7+ B  SF :SPy  6)|  ]TY .  70! @t .  R9( \\ Y "3`  Q  5; }A@5  A l pR &^  *  d"= X Q  @  h+` c OZ  -P  1P ]K8 M0  iH & =P8l .-  ?P 0 't] KG`V } 9  X`% , , @m% 8 ( ^@   A?3 c O  GP 0@ 57  S@T  UW@, @,  G;  L C /`[  4P  4 V @`8 Q ^CP W6{y  T  [5@ ] i-`K @p  Q\@" 0p 7 " *@p  \K0  E` W` = ,v; :Tpo >  N| 4P5 c// (] o {5%~ H  :` SV ; 6  \c `  #( v %Pr %6W ;I@W  Od 0  ^#  1 r O>H ?QG 1  1w L0& sYp UP  W, UY0  Jx  ]17l O @FU  +PW ;  SR@  Y IK) =O02r _{ *  )=p \0@ "A. fB`A NG U [ h7! ]  26 _` { h5p F p? h  GW  "N1  B PY T J(pk L} ) M  "h  9` aܟ1Jpp NК  P~ W@( <0- HPL 3 B03 $0  *p ,O`  " ~205 ! ABP 4 <^=' ^ L p#}d 7 g # bU0b QQI c`> u  S@ E@B ; X5zz dJ V&p $4E W]@  c@ Q kc cW': af 6 g]D 7P <  i= %  ?`A C D6 & p & G0   #@ 'd  a` 'P! Y3 % 7 @#  +a(( R}d ? ap $VPB  [X g T(H 2Ppd  % M L7 H )N` P`} d:F h T P 2s T8 ." %9`w V A '  R /| 4@ } * a! C j^P p 4K0  ?P  `0j < =  VP' /@]i K@m KZ  >N 2m] vG<  ?M 0@  1Е  8Y  ;  5N bB[ 6 / 3X! 45c ?R UM f 6) g/ . Vu ja@  ;GI Qp G sI  OJ 4 [0x _@ R <@  iOQ 2  /??+ T  V  7y  d[  )g  `e 7  y<  '_@ ==  ^  6u| N  ;_@{# Bbs w c S   i( 3 W D a (P` 6 8 zR'L %S  S# }+g  mS 8 Y M c  6. Q w )  Q0! m<i $ J`O  P+ :@  ';  >? f B`P T - $c5  "{  $%p = 7 (Wp! wB % NRP  :=@f ]ZwD 'j 8 +E1   $ +  E`g 3@s f !8Й3 '@k ?p  ;L8  QЁ% (H@;  [ 9 nu  ^4 g ` I&  OP^ =`A L|  5 )! D_ '3P C 0@ b `O5  S`/ C8?( @Pw  0 # -8z  KP fV0  $`a ;  pZ * : Y@pO F  v,0$ a~ U0w9 \& < Hp: #  9  |0P 6 X>0 g -`  U9P 1A] Z#  Y{ P  'R@ \ TU U  S  _8 " ":B P0C Jw =pj G ,@` = 4`=  jRDEZ R ) h*p  0P  9 G R= > )#PR EE: A0 $P7 ) #  H^; - M b C  ~cP W qKpV[ AP  Q/- U  `h 3P3  8 7# | 9 o W)` ' ^A@ ^p  '0-R 5;=S CaF ^?b G{ ; IY̟sb l i0 ~^`|  E&`i &g  c` G 79%  V 4 \؟9Y L`  ;/`O  %; .0  bF0{  b0   > CL= Np> !RI {*0  :2$ MF@F Y 4X >  /0  8 K V^< 5>F  c%  CГ  b  S+4 8VP  X fT  GИ  Vc=  4 * `p: aП'p #/2 # 0 F ! E@ <x )0  *0 \ Cpl  QKP) WR d,бA <3P < 8 Pvf 0(i : ++  W8`4| X  FYԟ] "  .7X Vq  B-/ C1 [p  QL  UФ  \A s D1 \ 2L (!q2 6` F db  )^ Z a P.s -@5 $,\  \ J ca i R_ 9J e&@ (`Ew ` 5P  PB` &0  P! (Ш D0y b=  DKn r/ y -  \0=* Sb0 GZ  U%PY >0@ J 3# Zp/ I!Pm L c  3 Zе ^ %70  9@h  F8p 9@N( 4@  C5f 5P  =6 )  Y \a` 53 +  @O > Vp  :0Q  $ 7 _PF T9 DPi uM@/  ,PN TPЋ s   V:?  tDZ rV@U+ @- @ $ X? '" 62 7Pg $ 8P$  `P8 -p> &`  [! > h  1 j2h 6 9 yS J@= R CУ V/* =(f  FS W  S9 "`2 v(L #K  ${# $b &-k  R XP C    i'@m2 <#` $UR  V 4 \$ ;@ B+ D@v o&p  #} T< VPJ ,Y@P kE > :: ; C  ,`" ,$P H u  /!G J &p9 C%^< ) % (0 $I% I\< ]  ;pSF P #   Y?  A p 2R +b N4 {3E c% ?Tn 5H0 5 ] ^ /I.X #@y  s'P z_  3r  89  k@@At G0u  4U& 2   '  x. 5 #` 3 -0 : M"p sLP< nT` M= tN V Y < u0  !0@  b M )LP}#  ]-  (D OD  B0  eP >a  5 d *p /O GAP 5 XD  o:Q RO  s[ 1p  2 `t Qp %\Ь! < T"` h 6ж aQ  Y09 $&pV 7R" ]0h  ^J  d c >pTZ +` N3 9%$ Dp  _  -0>  RQ`/ N  s t g\` F ~E| $JPZ rp6 /} 3[5$p\ P,P  ^.pC W  wX; ( )g  PI@ DXt' ^03  t8 H"  3F9 b0 0 A@_< .W .`5 7 u- S1P; K %`= 2`u ]N02 n "? K6 8W0* XPh T libudev.so.1_ITM_deregisterTMCloneTable__gmon_start___Jv_RegisterClasses_ITM_registerTMCloneTableudev_device_unrefudev_enumerate_unrefudev_newudev_device_new_from_devnumudev_enumerate_scan_devicesudev_queue_newudev_list_entry_get_nextudev_device_get_devnodeudev_unrefudev_enumerate_add_match_subsystemudev_enumerate_newudev_queue_unrefudev_enumerate_get_list_entryudev_list_entry_get_nameudev_device_get_devlinks_list_entryudev_queue_get_udev_is_activeudev_device_new_from_syspathlibdl.so.2dlopendlsymdlclosedlerrorlibdevmapper-event.so.1.02.1dm_event_handler_createdm_event_unregister_handlerdm_event_handler_set_uuiddm_event_handler_set_dmeventd_pathdm_event_handler_set_event_maskdm_event_get_registered_devicedm_event_handler_destroydm_event_register_handlerdm_event_handler_set_dsodm_event_handler_set_timeoutdm_event_handler_get_event_masklibdevmapper.so.1.02.1dm_tree_children_use_uuiddm_get_suspended_counterdm_config_tree_find_str_allow_emptydm_config_tree_find_strdm_pool_allocdm_pool_freedm_create_dirdm_get_status_thindm_tree_createdm_get_status_cachedm_report_field_string_listdm_tree_node_add_snapshot_origin_targetdm_pool_unlockdm_config_createdm_config_clone_node_with_memdm_report_objectdm_hash_insertdm_task_get_uuiddm_tree_find_nodedm_task_set_uuiddm_config_get_uint32dm_list_movedm_unescape_colons_and_at_signsdm_build_dm_namedm_config_tree_find_nodedm_task_no_flushdm_udev_get_checkingdm_tree_node_add_cache_targetdm_escaped_lendm_pool_lockeddm_tree_add_new_dev_with_udev_flagsdm_tree_node_set_presuspend_nodedm_list_lastdm_malloc_auxdm_sysfs_dirdm_udev_get_sync_supportdm_mknodesdm_report_outputdm_udev_set_sync_supportdm_tree_add_new_devdm_report_field_percentdm_config_clone_nodedm_config_parent_namedm_hash_removedm_tree_freedm_pool_lockdm_tree_add_dev_with_udev_flagsdm_report_field_stringdm_tree_node_add_mirror_target_logdm_tree_suspend_childrendm_config_create_nodedm_tree_node_add_linear_targetdm_config_parsedm_hash_lookupdm_hash_wipedm_tree_node_add_snapshot_targetdm_config_get_listdm_report_field_uint64dm_make_percentdm_task_get_namedm_list_adddm_task_set_namedm_task_get_versionsdm_tree_use_no_flush_suspenddm_tree_node_get_infodm_config_maybe_sectiondm_pool_zallocdm_pool_strdupdm_regex_createdm_hash_get_datadm_units_to_factordm_task_no_open_countdm_tree_node_get_uuiddm_tree_deactivate_childrendm_tree_node_add_zero_targetdm_tree_activate_childrendm_task_set_messagedm_tree_skip_lockfsdm_hash_insert_binarydm_config_destroydm_config_from_stringdm_task_destroydm_log_is_non_defaultdm_set_dev_dirdm_config_find_intdm_report_field_set_valuedm_list_firstdm_is_dm_majordm_report_set_output_field_name_prefixdm_hash_lookup_binarydm_config_insert_cascaded_treedm_list_prevdm_escape_double_quotesdm_get_status_thin_pooldm_regex_matchdm_config_create_valuedm_device_has_mounted_fsdm_bitset_createdm_task_enable_checksdm_hash_get_firstdm_config_get_strdm_tree_node_add_error_targetdm_tree_node_add_target_areadm_hash_iterdm_udev_waitdm_config_get_uint64dm_get_next_targetdm_pool_abandon_objectdm_get_status_snapshotdm_task_set_minordm_tree_next_childdm_hash_destroydm_snprintfdm_tree_node_add_raid_target_with_paramsdm_config_set_customdm_pool_grow_objectdm_tree_node_get_namedm_hash_get_num_entriesdm_tree_set_optional_uuid_suffixesdm_logdm_config_find_strdm_log_with_errno_initdm_tree_node_set_read_aheaddm_lib_releasedm_tree_preload_childrendm_set_uuid_prefixdm_lib_exitdm_tree_node_set_thin_pool_discarddm_fclosedm_tree_find_node_by_uuiddm_config_get_customdm_tree_node_add_thin_targetdm_tree_node_add_striped_targetdm_pool_strndupdm_config_write_one_node_outdm_prepare_selinux_contextdm_driver_versiondm_list_emptydm_list_add_hdm_tree_add_devdm_list_sizedm_get_library_versiondm_set_sysfs_dirdm_hash_get_keydm_pool_begin_objectdm_list_nextdm_tree_set_cookiedm_config_value_is_booldm_pool_createdm_config_tree_find_int64dm_task_set_major_minordm_dirdm_report_freedm_split_wordsdm_task_createdm_tree_node_get_contextdm_config_write_nodedm_get_status_raiddm_tree_get_cookiedm_tree_node_add_mirror_targetdm_config_get_sectiondm_tree_node_add_thin_pool_messagedm_config_tree_find_floatdm_config_write_node_outdm_pool_emptydm_list_splicedm_percent_to_floatdm_report_field_string_list_unsorteddm_device_has_holdersdm_tree_node_add_thin_pool_targetdm_task_get_info_with_deferred_removedm_config_find_str_allow_emptydm_config_find_int64dm_asprintfdm_report_field_intdm_task_set_majordm_config_tree_find_booldm_tree_node_add_null_areadm_set_name_mangling_modedm_list_initdm_config_has_nodedm_config_tree_find_intdm_pool_end_objectdm_config_find_nodedm_tree_node_set_thin_external_origindm_report_init_with_selectiondm_list_deldm_log_with_errnodm_task_rundm_task_set_event_nrdm_task_get_read_aheaddm_tree_retry_removedm_daemon_is_runningdm_report_field_uint32dm_hash_createdm_hash_get_nextdm_report_field_int32dm_tree_node_add_snapshot_merge_targetdm_zalloc_auxdm_tree_node_set_callbackdm_build_dm_uuiddm_tree_node_size_changeddm_strncpydm_split_lvm_namedm_pool_destroylibreadline.so.5write_historyrl_readline_namehistory_lengthread_historyremove_historyreadlinerl_completion_matchesrl_line_bufferrl_attempted_completion_overstifle_historyrl_attempted_completion_functionadd_historylibc.so.6_IO_stdin_used__xpg_basenamefflushstrcpy__printf_chksetlocalestrncmpoptindstrrchrpipe__strdupperrormunlockmmap64closedirgetpriorityforksigprocmasksigfillsetunlinkputcharmkdirfsyncabortstdinstrtollgetpidstrftime__assert_failstrtodstrtolctime_rsymlinkalphasort64fgetsgetppidstrlenopenlogmemsetdirnamestrstrrmdir__errno_locationmemcmpmlockdup2unsetenvrand_r__fxstat64__fprintf_chksigaddsetctimestdoutfputcfputsmemcpy__vsnprintf_chkstrtoulmunlockallmallocumaskstrcasecmp__strncpy_chk__lxstat64opendir__xstat64__ctype_b_locgetenvsscanfoptargstderrsigdelsetioctlmunmapwait4__snprintf_chkgetuidreadlinkgetopt_longexecvpstrncasecmpstrtoullgethostnameusleepfwritesigactiongeteuid__memcpy_chksigismembersetlinebufmlockallwaitpidlocaltimelseek64strchrscandir64rindex__vfprintf_chkmalloptfdopenreaddir64qsort__vsyslog_chk__ctype_toupper_loc__strcpy_chk__ctype_tolower_loc__cxa_finalizesetvbufsetsidfcntlgetrlimit64__sprintf_chkmemmoveunamefopen64access_IO_getcstrcmpstrerror__libc_start_maindirfdferrorsetprioritycloselog__stack_chk_fail_edata__bss_start_endpv_createlog_command_namereplicator_dev_add_rimagelv_raid_image_in_syncbackup_read_vgtest_modelvmcache_fid_add_mdasset_lv_segment_area_lvvg_extent_countuuid_from_numlv_is_activeimport_lvs__libc_csu_finilv_add_mirror_areaslv_passes_auto_activation_filterinsert_layer_for_segments_on_pvprocess_each_lv_in_vgpv_pe_alloc_countalloc_policy_charattach_thin_external_originlv_deactivatelvdisplay_fullread_only_lvfs_del_lvlabel_register_handlerinit_msg_prefixlv_cache_createlv_is_active_locallylvmcache_pvid_from_devnamelv_change_tagrelease_flockslvconvertvgdisplayarchive_listvgckpv_dev_sizelv_metadata_sizerecalculate_pool_chunk_size_with_dev_hintslv_split_mirror_imagesid_read_formatlv_raid_splitlvs_using_lvload_pending_profileslvmcache_foreach_mdavgcreate_params_set_from_argsarg_percent_valuefin_syslogget_pool_discardsset_pe_alignimport_pool_pvcritical_sectionget_pool_paramsvg_visible_lvsbuffer_append_flv_remove_singleinit_lockinglvmcache_get_labellv_is_merging_thin_snapshotfind_config_tree_int64process_each_pvvalidate_vg_rename_paramsinit_mirror_in_synclvrenameset_sysfs_dir_pathdir_existslv_refreshget_free_pool_device_id_lvm1_opsvg_split_mdaslvmcache_update_vgname_and_idbackup_initbtree_get_dataarg_long_option_nameremove_mirror_imageslvmcache_fmtvg_seqnovg_read_errorstr_list_lists_equallv_cache_block_infodev_iter_destroyvg_name_duplvmcache_uncertain_ownershipvgdisplay_fulllv_mirror_image_in_syncdmeventd_monitor_modebuffer_linevg_remove_snapshotlv_fullname_dupdev_manager_mirror_percentinit_pv_min_sizedev_manager_thin_device_idbuild_parallel_areas_from_lvinit_lvm1_formatpv_labelinit_indentout_newlinedisplay_formatsfind_pvmove_lv_in_lvlist_lv_moduleslv_raid_sync_actionstored_errmsg_with_clearoverride_config_tree_from_stringlvmsaradd_areas_linelabel_exitload_shared_librarydev_fddev_close_allmajor_minor_validlvmcache_vginfo_holders_dec_and_test_for_zerocmirrord_is_runningvg_remove_pvsvg_max_name_lenpool_below_thresholdconfig_file_timestamplvmcache_get_pvidslvm_return_codestr_list_dellvreduceinit_pvmovelvnum_from_lvidfind_temporary_mirrormake_config_nodelvmetad_activeadd_linear_area_to_dtreefs_set_cookiefs_get_cookie_text_opsbackup_locallyinit_dev_disable_after_error_countalloc_fidlvmetad_initreport_devtypesfs_add_lvis_real_vgvg_extent_sizeget_pvmove_pvname_from_lvdev_get_block_sizeadd_seg_to_segs_using_this_lvlvs_in_vg_openedlvmetad_pvscan_singleimport_lvlvseg_startvgcreate_params_validatelvm_finbtree_insertid_format_and_copyload_profileinit_lvmlvmcache_update_basdev_discard_blocksget_alloc_from_stringfind_mirror_segimport_pvsdaemon_request_extend_vget_default_allocation_thin_pool_chunk_size_CFGlv_activation_filterid_validdev_open_quietlv_data_lv_dupcreate_toolcontextget_percent_stringdebug_leveldev_cache_add_dirbecome_daemonget_stripe_paramsadd_pvl_to_vgstext_vg_export_rawtext_vg_export_filefree_orphan_vgfind_config_tree_intmd_filter_createfind_pv_in_vgmda_get_devicevgname_from_mdapipe_closefree_pv_fidvg_has_unknown_segmentsdev_readlv_create_singlebackup_to_filevg_renameis_missing_pvexport_uuidsinit_mirrored_segtypelvmcache_vgname_from_infovg_commitvg_freeadd_mirrors_to_segmentsinit_raid_segtypeslvmcache_del_basalloc_vgvg_profile_dupdev_cache_getdev_is_swapget_format_by_namepv_analyzepool_has_messagelvmchangefor_each_sub_lvdev_flusharchive_display_filedev_minimum_io_sizedev_manager_cache_statusvalidate_new_vg_namediscard_pv_segmentpvscanlvmetad_release_tokenlvmcache_vginfo_from_vgnamevg_mda_countfs_rename_lvlvdisplaylv_cache_policy_infolog_suppressvg_missing_pv_countstr_list_addprint_logdev_manager_device_uses_vgpath_existslvmcache_verify_lock_orderlv_removevgmergelvmcache_fid_add_mdas_vgpvdisplay_fullgenerate_lv_namevg_sizelvmetad_set_socketdev_test_excllv_is_on_pvlv_origin_dupget_default_config_profile_dir_CFGlvmcache_get_vgnamescheck_lvm1_vg_inactivereport_initfs_unlocklvseg_sizepv_dev_namedev_manager_raid_statuslv_is_replicatoractivation_arglv_set_visibledev_manager_releaselv_active_duplvmetad_pv_lookupinit_cmd_nameinit_is_staticread_diskvg_change_tagdisplay_lvnameinit_cluster_lockingassign_peg_to_lvsegbackup_restoresize_kb_argfcntl_lock_filedetach_mirror_logfirst_segtarget_presentsilent_modelvmetad_pv_list_to_lvmcachereset_log_duplicatedcritical_section_incvg_statuspvcreate_params_set_defaultsbackup_restore_from_filepv_pe_sizefind_pv_in_vg_by_uuidpool_label_inclone_pv_listlv_info_by_lvidvgexportlvmcache_del_dasfixup_imported_mirrorsmajor_max_partitionslvmcache_make_validvgchange_activateconfig_file_readlvmetad_vg_updatearg_sign_valueattach_mirror_loglv_set_hiddenpvcreate_voltag_argdev_get_sizevg_free_countimport_extentslv_origin_sizestr_list_createvg_set_extent_sizevgimportlvmcache_smallest_mda_sizeinit_silentlvmdiskscanpoll_daemonpv_statusis_pvorigin_from_cowlv_modules_duppv_vgiddev_manager_deactivateinsert_layer_for_lvlv_raid_change_image_countvg_read_internallv_layerexport_lvsdaemon_send_simpledev_manager_suspendalloc_pool_metadatastr_list_add_no_dup_checkdaemon_reply_destroypv_ba_sizelv_add_virtual_segmentmonitor_dev_for_eventstext_vg_vsn1_initpvcreate_singlebackup_listexport_pv_actalloc_destroylvcreatevg_reducelv_is_slogbtree_lookupinit_pool_formatvg_set_pool_metadata_sparebtree_nextcreate_pv_mapsreadahead_arglv_parentupdate_thin_pool_paramsdev_appenddev_set_preferred_nameget_config_tree_by_sourcelv_is_cache_originpv_write_orphanlvid_from_lvnumexport_extentspv_format_typepv_mda_set_ignoredresume_lvscopy_percentget_pv_list_for_lvpv_mda_countlvmcache_add_orphan_vginfomove_pvinit_unknown_segtypeclear_snapshot_mergeimport_snapshotslv_emptyinit_ignore_lvm_mirrorsinit_detect_internal_vg_cache_corruptiondev_subsystem_namemake_text_nodelv_is_cowlv_kernel_minorlabel_get_handlertext_vgname_importdev_open_readonly_quietdevice_is_suspended_or_blockingarg_uint64_valueactivation_exitinit_zero_segtypebuffer_reallocdev_writeyes_no_arginit_snapshot_segget_pvs_internal_really_wipebuffer_writepv_mda_freedev_get_primary_devexport_numbersfind_config_tree_strvgmknodesvalidate_tagdev_name_confirmeddev_create_filefind_min_mda_sizepeg_dupadd_mirror_logdev_manager_destroyvg_set_max_pvsigint_caughtvgscanarg_int64_valuestored_errnoread_pool_labelextents_from_sizesysfs_filter_createvg_set_alloc_policydev_subsystem_part_majorsigint_restoreinit_debugmove_lv_segmentsupdate_cache_pool_paramsmemlock_inc_daemonremove_lvs_in_vgstr_list_duptext_vg_import_fdpv_tags_dupemit_to_bufferlv_add_mirrorsdev_manager_createcreate_temp_namelv_sizefind_vgname_from_pvidconfig_make_nodeslv_calculate_readaheadfind_config_tree_nodepvremove_singlelv_raid_healthytext_import_areasdestroy_toolcontextdev_cache_exitlv_suspend_if_activeprocess_each_lvrelease_pv_segmentconfig_file_open_and_readpv_sizediscards_arglv_check_transientlabel_readremote_lock_heldconfig_files_changedbackup_restore_vgdel_pvl_from_vgspv_idlvmcache_is_orphancreate_text_formatprocess_profilable_configlvmcache_seed_infos_from_lvmetadvg_fmt_dupvg_read_for_updatedev_close_immediatefind_lv_in_lv_listlvmcache_foreach_pvlvmetad_pv_foundfind_pvmove_pvs_used_by_lvprocess_each_segment_in_pvvg_uuid_dupid_write_formatlv_raid_remove_missingvgdisplay_shortbuffer_initdisplay_size_unitslv_is_active_exclusive_locallyread_tagslv_spawn_background_pollingdisplay_sizeattach_pool_data_lvvg_system_id_duppv_size_fieldmerge_pv_segmentsfind_pvmove_lvpv_is_in_vginit_snapshot_segtypeexport_vg_to_bufferlv_infodaemon_send_simple_vsplit_parent_segments_for_layerget_segtype_from_stringdev_is_mdget_default_activation_mirror_image_fault_policy_CFGreplicator_dev_add_slogvgrenamepv_change_metadataignorelv_remove_mirrorsreplicator_add_replicator_devvgcreate_params_set_defaultsdaemon_closepvdisplay_segmentscreate_poolarg_uint_valuevg_max_lvvgremove__data_startlv_time_duplv_thin_pool_transaction_idinit_md_filteringdev_is_lukspermission_arglv_raid_messageinit_log_directmpath_filter_createexport_vg_to_config_treepvdisplay_shortlv_name_dupthin_pool_feature_supportedfin_lockingpv_maps_sizecollapse_mirrored_lvmajor_is_scsi_devicelv_raid_reshapeout_hintread_vgdlvmcache_update_daspv_list_extents_freelv_mirror_percentfcntl_unlock_fileinit_file_lockinglvmcache_mda_countlvmcache_drop_metadatadev_manager_thin_pool_statuspv_uses_vgsync_dirlv_is_active_but_not_locallyconfig_make_nodes_vstring_arglvscanreplicator_remove_rlogfind_seg_by_lelv_raid_percentlvmsadcsigint_allowlvm_splitlv_profile_dupvg_mda_sizelvm_renamefind_pv_in_pv_listraw_read_mda_headerlvmcache_foreach_dalv_release_replicator_vgsinit_log_filealloc_pv_segment_whole_pvconfig_get_source_typedev_setvgextendlvdisplay_colonslvmcache_update_vgint_arglvmcache_label_scanreplicator_dev_remove_slogvg_set_mda_copieslv_renameprint_flagslv_kernel_majordev_md_stripe_widthconfig_def_checklv_is_merging_originrelease_lv_segment_arearemove_layers_for_segmentsbuffer_readget_free_vg_numberlv_thin_percentudev_init_library_contextdaemon_sendudev_get_library_contextvgchangedev_iter_createinit_security_levelvgreduceinit_snapshot_mergelv_is_active_exclusive_remotelypv_name_dupget_monitor_dso_pathget_only_segment_using_this_lvdev_manager_snapshot_percentcheck_lv_segmentsvg_pv_countcomposite_filter_createupdate_pool_paramsvgcreateget_pv_from_vg_by_idvg_add_snapshotmda_copybackup_exitunblock_signalsdisplay_name_errorreplicator_dev_remove_rimageinit_trust_cacheinit_abort_on_internal_errorslv_thin_device_idlv_activation_skiplvmetad_usedpv_uuid_duprlocn_is_ignoredlv_read_replicator_vgsmemlock_unlockpool_is_activelv_lock_holderlvextendpv_pe_startactivate_lv_exclvg_check_statusset_activationdev_cache_has_scanneddaemon_request_destroyarchive_initrlocn_set_ignoredcmd_vg_readalloc_lvrelease_and_discard_lv_segment_areareplicator_add_rloglvmcache_device_from_pviddev_cache_add_loopfilemake_int_nodelvs_in_vg_activatedvg_mda_used_countlv_mirror_log_dupsync_dev_namesdev_cache_get_by_devtpvdisplay_colonsdebug_class_is_loggedoverride_config_tree_from_profilelvm_register_commandsalloc_snapshot_seglvremovelvmetad_vg_list_to_lvmcachemerge_config_treecheck_pv_segmentslv_metadata_lv_dup_pool_opspvmove_pollinit_cache_segtypesdev_get_read_aheadinit_activation_checksvg_set_fidvgcfgbackupget_default_backup_backup_dir_CFGlvmcache_deviceget_shared_library_pathlvm_dm_prefix_checkfind_pool_seg__libc_csu_initdisplay_tagsprocess_each_labellv_resume_if_activelvresizelvm_getpagesizelv_path_dupyes_no_promptwrite_disksdev_open_flagsstr_list_match_listfind_replicator_vgslv_active_changelvmcache_delstr_list_match_itemlvseg_monitor_dupvgreduce_singledev_read_circularuuid_suffix_listpv_writeinit_dummy_lockinglv_has_target_typepercent_of_extentsregex_filter_createudev_fin_library_contextvalidate_namemirror_remove_missinglvmcache_vgs_lockeddev_manager_thin_percentlast_segfind_pv_by_namelv_convert_lv_dupvg_mda_freeactivate_lvsfind_pool_lvlvm1_labeller_createexec_cmdlvm1_presentlv_check_not_in_usevg_lock_newnameset_lv_segment_area_pvarchive_exitbuffer_appendvgdisplay_extentsdev_is_partitionedid_equalout_areaspvcreateverbose_levellvmcache_initlv_raid_replacelv_set_creationremove_mirrors_from_segmentsvg_mda_copiescow_has_min_chunksdev_manager_thin_pool_percentvg_attr_duplvmetad_set_activeget_default_allocation_cache_pool_chunk_size_CFGinit_sysloglv_is_cow_covering_originpv_fmt_duplv_is_origininit_log_fnmemlock_initprocess_each_segment_in_lvout_text_with_commentlv_activateget_config_tree_check_handleget_alloc_stringlv_thin_pool_percentget_pool_discards_name_fp_hwpvckdev_manager_mknodesvg_remove_checkdev_cache_scanlabel_initadd_profileimport_pool_segmentsget_default_backup_archive_dir_CFGconfig_file_read_fdmunge_pvdskip_dev_dirread_urandomlvmetad_pv_lookup_by_devlv_extendlv_activate_with_filterhandle_pool_metadata_sparemetadatacopies_arglvseg_chunksizelv_is_on_pvslabel_createcreate_dev_typessync_local_dev_nameslvmcache_fmt_from_vgnamepv_vg_namedev_manager_activateset_pe_align_offsetattach_pool_metadata_lvlv_add_segmented_mirror_imagefind_config_tree_floatlv_reduceis_global_vgfind_lv_in_vgdev_manager_infoimport_pvrelease_vggrouped_arg_is_setlocking_is_clusteredtarget_register_eventsalloc_printed_tagsvg_mark_partial_lvslv_from_lvidpvdatais_orphan_vgpoll_mirror_progressfind_pvmove_lv_from_pvnamelvmetad_pvscan_all_devspv_resize_singledev_open_readonlygrouped_arg_str_valueinit_striped_segtypevgcfgrestoremda_locns_matchfind_free_lvnumlvmetad_set_tokenconfig_def_create_treelvmcache_device_sizelvmcache_update_pvout_dec_indentwipe_lvget_default_devices_cache_CFGarchive_displaydaemon_request_extendlvmcache_vgname_from_pvidvg_check_pv_dev_block_sizesdev_manager_transientlvmcache_unlock_vgnameinit_lvmcache_orphansarchive_list_filelvid_createexport_pvlabel_verifyfind_lv_in_vg_by_lvidpvchangesigint_clearlvmcache_add_bavg_remove_mdasdev_closedev_manager_exitlvm2_mainfirst_replicator_devlv_layout_and_rolelv_is_rimagefind_lvlv_create_emptylvmcache_add_mdapv_ba_startvg_check_write_modepv_usedinit_free_segtypebtree_createignore_vglvmcache_foreach_babtree_firstclvmd_is_runninglv_kernel_read_aheadget_pool_uuidfree_cmd_vgsinit_error_segtypelvmetad_socket_presentfid_get_mda_indexedsegtype_arglv_is_visibleis_temporary_mirror_layerdev_cache_initlv_raid_dev_healthlvmcache_fid_add_mdas_pvget_default_region_sizeadd_mirror_imagesprocess_each_vgarg_from_list_is_setprocess_each_pv_in_vgread_flagslv_mknodesremove_seg_from_segs_using_this_lvinit_error_message_producedconfig_file_checklvmcache_check_formatsuspend_lvslv_is_replicator_devlvmcache_set_device_sizecalc_crcvgs_are_compatiblelvmcache_populate_pv_fieldspvcreate_params_validateinit_background_pollingupdate_pool_lvmda_is_ignoredvg_revertalloc_lv_segmentpv_split_segmentmodule_presentlvseg_segtype_duptext_vg_import_filelvchangearchive_vglabel_removeout_inc_indentinit_obtain_device_list_from_udevpvdisplaypvremovebuffer_destroyconfig_file_changedarg_valuetarget_versionout_config_nodelv_is_merging_cowfid_add_mdalvmcache_vgname_is_lockedpool_supports_external_originlvmcache_lock_vgnamedetach_pool_metadata_lvdev_open_readonly_bufferedpv_mda_sizelvmcache_info_from_pvidvg_writelv_resize_preparescan_vgs_for_pvsinit_no_lockinglvseg_seg_pe_rangesconfig_writelv_remove_with_dependencieslvmcache_del_mdasreplace_lv_with_error_segmentlv_resumedev_manager_raid_messagedisplay_segtypesimport_vg_from_config_treedaemon_request_makepv_set_fidlv_config_profilearg_count_incrementset_cmd_namepvmove_modelvmcache_vginfo_from_vgidinit_flockcmd_vg_lookupalloc_argimport_pool_lvsreplicator_remove_replicator_devinit_verboselv_merge_segmentslv_add_mirror_lvsinit_udev_checkingget_activation_monitoring_moderead_pvs_in_vglock_volattach_pool_messagelv_add_log_segmentudev_is_runningstored_errmsglvseg_tags_dupshift_mirror_imagesvg_validatelv_add_segmentrelease_log_memorypv_pe_counttarget_registered_with_dmeventdinit_retry_deactivationvg_set_max_lvlv_split_segmentsize_mb_arghelplvmetad_vg_removelv_change_activatelvmcache_addlv_is_active_replicator_devlv_cache_removeget_cache_moderead_pool_pdslabel_destroyconfig_def_get_pathcheck_replicator_segmentlv_raid_split_and_trackcreate_pv_listlvmcache_destroyfin_logdevice_is_usablefs_set_createlist_segment_moduleslvm_register_segtypeis_mirror_image_removableallocate_extentsint_arg_with_sign_and_percenttext_labeller_createcow_max_extentsinit_readonly_lockingsnapshot_countlvmetad_vg_lookupdev_reset_error_countpool_label_outremove_layers_for_segments_allbuffer_append_vfreinsert_changed_pv_arealvmcache_vgname_from_vgidpv_disks_foundinit_ignore_suspended_devicesvg_write_lock_heldadd_pv_to_vgis_empty_dirlabel_writecheck_current_backupadjusted_mirror_region_sizelv_move_pv_dupvalidate_name_detailedmemlock_resetlvmcache_commit_metadatamove_lv_segment_areaimport_pool_pvsbackup_removeactivation_releaseout_sizereset_lvm_errnodaemon_openapply_lvname_restrictionsdev_iter_getunlink_lv_from_vgpartial_raid_lv_supports_degraded_activationcritical_section_decpv_devdetach_thin_external_originpv_max_name_lenfind_config_tree_str_allow_emptyread_pool_disklvm_type_filter_createpersistent_filter_loaddev_discard_granularitylv_parent_dupdefault_vgnameget_pvmove_pvname_from_lv_mirrlvmcache_get_vgidsmax_lenpool_labeller_createdisplay_size_longinit_debug_classes_loggeddev_discard_max_bytesremove_config_tree_by_sourcelvm_even_randexport_vglv_raid_mismatch_countmdas_empty_or_ignoredlv_tags_dupcalculate_layoutcalculate_extent_countdev_cache_check_for_open_devicesvg_max_pvis_reserved_lvnamevgsplitlv_raid_image_countlvmetad_pv_gonestr_list_add_h_no_dup_checklv_rename_updatelvmetad_connect_or_warnlv_host_duppipe_openlvmcache_get_vgremove_layer_from_lvlv_resizecheck_dev_block_size_for_vgvg_extendattach_pool_lvinit_dmeventd_monitorlv_uuid_duplv_dmpath_duplv_snapshot_percentdev_manager_preloaddetach_pool_lvlv_ondiskcmd_vg_addlvm_shellconsume_pv_arealv_raid_mergearchive_enabledev_optimal_io_sizeinit_log_while_suspendedlvmcache_info_mda_freeinit_testrefresh_toolcontextdev_openbackup_enablewipe_known_signaturesint_arg_with_signpv_attr_duplvdisplay_segmentslv_is_raid_with_trackingarg_outside_list_is_setdisplay_stripestrip_dirvgdisplay_colonsmemlock_dec_daemonlvconvert_pollinit_external_lockingdev_alignment_offsetlv_set_activation_skiplvm_fcloselvmcache_pvid_is_lockedlv_mirror_countgrouped_arg_countlvmcache_vgid_is_cachedmetadatatype_arglvseg_devicestags_format_and_copyfirst_grouped_arg_int_valuepv_parts_foundrevert_lvsvg_tags_duppvresizefid_remove_mdapersistent_filter_createreset_lockingvg_remove_pool_metadata_sparelvid_in_restricted_rangeimport_pool_vgconfig_openlvmcache_add_dafs_del_lv_bynamelv_is_active_exclusiveget_default_devices_cache_dir_CFGfind_snapshotdumpconfiglvmetad_disconnectvg_set_clusteredarchivelv_has_unknown_segmentspv_mda_used_countlvm_run_commandlv_pool_lv_dupout_textlv_attr_dupinit_full_scan_donevgconvertlvmetad_pv_gone_by_devfs_has_non_delete_opsfind_config_tree_boolvg_createexport_vg_numberextract_vgnameremove_mirror_loglv_is_virtual_originvg_refresh_visiblepv_freepartitioned_filter_createimport_vginit_ignorelockingfailurevg_max_lv_reachedlvseg_discards_duplink_lv_to_vginit_thin_segtypeslv_is_thin_originset_flagrefresh_filtersfind_vgname_from_pvnameGLIBC_2.1GLIBC_2.0BaseLIBUDEV_183GLIBC_2.1.3GLIBC_2.4GLIBC_2.2GLIBC_2.3.4GLIBC_2.3                  0ii Mdii Wd  ad #fdXsi rdii ~dii dii Mdti dii Wdii duad@5D55555555555555555555666 6P6d6x666666677,7@7T7h7|77777778808D8X8l88888888 99999 9$9,9094989<9@999999999::<<(<<<<<<<<@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|===>>h>l>>>????@@D@@@@@HALAAAAAPBTBBBCCXC\CCCD D`DdDDDEEhElEEEFFpFtFFF G$GxG|GGG(H,HHHHH0I4IIIII8Jy?y@yAyByCyDyEyFyGyHyIyJyKyLyMyNyOyPyQyRzSzTzU zVzWzXzYzZ z\$z](z^,z_0z`4za8zb}?}A}B}C}D}E}F}G}H}I}J}K}L}M}N}O}P}Q}R}S}T}U}V}W}X}Y}Z}[~\~]~^ ~_~`~a~b~c ~d$~e(~g,~h0~i4~j8~k<~l@~mD~nH~pL~qP~rT~sX~t\~u`~vd~wh~xl~yp~zt~{x~||~}~~~~~~~~~~~~~~~~~S?ï;t [ hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhh h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h h h h h h h( $h0 (h8 p,h@ `0hH P4hP @8hX 0<h` @hh Dhp Hhx Lh Ph Th Xh \h `h dh hh plh `ph Pth @xh 0|h h h h h h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h UWVS'Ó# HLҋ)7|$ ts#uVh$VU肧uq vLN uFTu΃ 1V vL %r谩uVh$VUu#1 vL uFTuɃ 1Vt. vL %VPVU誦0uVhVU菦# vL] uFTu޸ [^_]UWVSd&0"HD$@LD$,t$EōY^PE pD$tORRjLt$,2u=PP@RPjhPj D$PPjNt$,2tPjjNt$,C9E$PPjLt$,p2D$(|$u6 D$pL͋ Pjh2PPD$ PD$@LpD$4|$$u PjhD$ l$,D$l$ p@D$($ Rt$8jjP D$6E@9~PPjLWP3tQjjLW6u' PjhPj薺 T$1|$$ЍHL$ L$RRPD$<@LpL$ T$5 Pjh늀| : QQRP$l$,1҃l$l$$;T$}|1ȋLBDD$$l$D$$D$l$(|$9|$$WWD$0D$pL>D$|$ u5VD$@LpXD$0xPjhPjl yl$(1;u0k ElЃ8T$QQ|$wpXT$t~D$D$|$1ȋL$Њ ujjVu趟 u$ Pjh+1Pj辦 ue35t8 e[^_]Å-UWVSK 2D$D$T$D$ |$;t$tD$x|/;,$tdPPuvC tJ u/t8Eu,L$)Al)AhRRUt$r^YueD$?뗋6{|$ tl +t$ vu PjhVj謥 5 t$kmtPPܩt$PjhVhu [^_]UWVSM 8t$LRzD$GD$ ~Lu7GQu1PPܴwHP+jhPh ]PGLvHwtpdD$(F|<$D$$6.D$,GPĀu]PPjvpt$$t$\t$0v\vXD$hHPWU0uD$ Pjh~8FF<:T$ 9T$Dpt Pjh! Wyt)T Pjh+Pj 1kD$ WL$uGR@tL$ PPwHPjh`Pt$Lt$WMuD$ PjhD$xXtu?PPj%W-L$ u* U)u ER@:D$@@<*PPhWuQQj%Wu D$@L$ HL?D$@@Pu D$@L$ HL&D$@uPL19T$ vD$ )ЋL$@AL@LD$@@LD$v(tRRjPjh'+Pj藝 |$uPuHt$Pjh.ˋL$ 9L$t$PPuHP+jh7PjE |$ D$vD$D$PPj#Wt&PPj#Wu |$uPPj$Wu RPj$WD$(YXt$ PnoPPt$ PQt:PPt$ P8D$t!PPt$ PjhSD$PPt$ P+jh`D$0Pj2hWtJEQtDD$@ PHT$(Uc%T$;PPt$@ Pjhht$0jۛ >EQ P:HPPuHPjhrA>D$ F?D$VjUWzm Pjhx+PjL  uLt Pjh\vD$D$ D$D$D$L$9L$ vTL$9L$sJD$@xtt@+ PjhWjPjhWj訚 L$9L$ uL$9L$u |$u/|$. UD$(<OHD$$D$P@<,$VESuHA ,WWVR+jhpRP i|$ t4 TQt$t$R+jh|RPƙ |$t4 R|t$t$R+jhRP苙 QQjqW>XZhW/D$YXj)W!t^Pj=shWFD$ jhW2D$XZVT$RYZD$VL$QD$|$tkD$uR|$D$.|$t PVVYRRhVAPPjV,PPjVVPPjUV UEPuM uu$uHPjhPj萊 vETujlV/uHPjh밍uHPjhf<uHPjhWjjaVƒ?̝D$ RjhWjԉ D$&jaVuETjaVUhV<hV#& U藱tjaVjAV1҅2 R XZhVi uL|- PjhPj輈 & UD U+0TuHPjh&hVhVPPhVPPjVPPjVVWWjUVsEP& U U۲$A&D$D$jlV-uVjVuDhVH uL`zu` PjhIv uL5z Pjht&jj:VT jhV2EL@@ @-t Av Ah 1҉d9 ljP0WQL$Pjh@Wh7 L$ E`9.K QuHPPjhHWj 1D$D$hV uLx Pjh&jhV%UP)E|ƀET]39 ETUPRRuHPjjEWj/ę uHPjjLWjuLHU hqb uLKET> USPPuHPjjQWj蠄uL!D$ uLD$?PjlV=8nu x҃RjV;EX EXP PuHPjhWjęuHPjhWjuLTt uLK Rjh"Wj蠃 1D$D$9 U贮Nj@xmPZPhD$XPɻbhV W,$D$\PWRP@ VuWhVuBjV uLt Pjh8 uLt Pjh0PPuHPjjWj; D$ɋUHRuRPPjj8D$L jD$D$jV uLs Pjh@ET %PPj>VLPPhV4u1D$D$D$ QjhV,$ ; U PPTuHPjhWjuL0P Ult4 uL%UPUViPuHELpXPjhW1juL uL P PuHPjhWj0 1 uL軀s uLUPET@uHPjj) jD$D$jLVqWWjNV\yQQjPVG3RRjRV2WWjVVuQQjUV  uLfq PjhZK1ɍE`9ġM`uHQPjhOWj}ęuHPjhQWj}uLMj uLMET URRuHPjhVWjE}uL1҉T$ uL~T$  uL=p PjhH"t Pjh8 Pjh*PPuHPjj#bUh$UV~f3Uh$UVafPPuHPjjqWjS| 1 uLno8 PjhQS aETUPPP8uHPjjIPPjVu }h PPhVl PjhWj{ D$ D$ RjhSWjw{ D$ oPPuHPjhw뤍 RjjNWj:{ D$PPjjD$8PjUVv |$( tWWuHPjj0vu bD$D$@PP|uHPjhESPjj>V',$;"t Uu U\ U_XhVD$ WWjVI PjhOEL D$UINj@ @ PPjPt$PPjRt$rXG,t ;G( uLID$ e uL%yETl UӜ uL $jhfPjy D$|$D$|$ Pjh5 uLkz|$u"D$ ؟QQuHPjj>V`RRuHPjhWjx d uL)ET UכVD$ d~UhUVa|$ KPPuHPjhH PjhOPjw D$ uLz%UPUV|a1 uLV?C UD$ t0 uL%UPUVaD$c UhUV`|$ u RT$jh]Wjv T$ Rjh^Wjv 1QQhVu }d|RRjjD$8PjUV P|$(ERudhVD$$ uhjVsD$,PELW@p VN PPjqVD$OqD$ PPuHPjhWju \b_Uh$UV_ USsD$b UhUVv_|$xD$T$MPMTEhUduHP(RPjhWjTu E\ x PPELjW0P 0E\R\WuHPjhWjtuL,Et uL< RjhWjt 1D$D$PPhV[h |$PPj"V;tؿ WWjJVtPjjJV'ZYPUΣPPjaV PjjaVEU  |$9|$ PjhUh$Ut$]y uLu%UPUVw] uLQ; UD$t0 uL%UPUV]D$_!UhUV\|$ u RT$jjXWjr T$ RjjYWjr D$? D$ RjhWjr D$ 5&RP$uHPjhWjqr |$ HUh$UV1\5QudhVBD$$ uhjV.D$,PELW@p V D$PT uL%UPUV[D$}PP`uHPjj\WjqU D$t0 uL6%UPUV8[D$]ugUhUV[|$D$PPuHPjj^Wj q D$sD Pjh5 uLuETy뇍 Pjh] uL^kET^i}HRR!WRjhgRPRp Pjhoj Pjhl uLqO uLETPPhVPPuHPn- RjhPj]i 1PjjV둍 Pjhkl uL%UPUVRPPhV PWU  UPWUV WjhVjhWjhtVjrh QQjViRRuHPjh*Wj/hUV PjhwWjh BPPUV;(WELjh0 PjUauwQPuHPjhWjguL7t uL6/u4 RjhWjFg 1D$D$뇃 uLhՃ U=$襑9 U!&PPj+VtVjPVjRVj"VjJVUUjNVQQjLV{tRRhVc\1jaVCFD$ jV)T$ ׉$D$ j+VL$ ωD$ j:VT$ ׉ Pjh]t&hVhVohVxVjVb@jVL*PPjUV7PPjVV"PPjWV PPhVv̦ Pjhkv'jAV" t& Pjhv'jVeuNhVPu9jV>tW|$4tPt Pjhv'hVuT Pjht&jlVtjVuej:VtjAVuWjAVu[Rj%Pt$Lt$LV_  Pjhا Pjhf tjjaVuh u4 PjhPh"`j J =H PjhPh_ K1ffffD$@P%ÍvWVS|$`t$ t$ .t%tPW'![^_É'1WVS8,t$@|$HeD$(1D$$V݉D$ PVtmD$O PÑك7$wvHP+jhSPj^0|$(vHPjhD+Pjn^ 1L$e3  [^_Ð P7كvH\$@Z7t$t$WVR+jhPRP^0Zv'ĨvHPjhG[&vHPjhJ;BX fVSct&ƃ V]u VPX1t R蘈[^ UWVS2(D$ 9E D$@ t|v'E0tY1 t&9u0vHvEl<8u pyub}lG@St6D$9u0w'm;l$ tTE @ u[^_]Ð?u p\$pElD8D$[D$D$[^_]Í&UWVS%(P@XPPD$ 1t& WL;p0sd W;@lv,<u̓ W@lZt(Ot W@lD(SD$뒍v'D$ [^_]Ít&D$ ^ D$ PD$ BvUWVS%$jp蒕D$ u|t$Ę}|9u`&?9tR wOtGtۃju.t+OHPt$?9uvD$ [^_]ÍX Pjh+PjmZ 1[^_]Í, Pjhҍ'UWVS%$t$8D$+ęvHPjhWjZU<*\FVh$Vt$CvHPjhWjYU14$*}ERVhVt$RC1Ʌ[^_]Ív vL ]FTP V|W vLխ%VPVt$B U eD$ U1&4$N|L$ .L$ EL$ t.L$ vLOL$ uFTt%v'L$ VhVt$GLL$jjjP+GL9T$T$t7 P9 wL>#GLD$D$@L$,qt$9px`_;Fx{Q'VSi5 L$q$VVqDVq@VVRqlPqh诮4[^É'UWVSlRLD$$T$ljD$ e$\1tPR~ |$ ?Pt$Rɉ/|$ Al QpQL$$iŋL$APQTĀt @9*FT L$ VpiŋL$FQFTt D$ PhB @'}L$ PvHUhD$xD$8P2u L$D$ PhB @ L$ PvHUh$D$ t$,j1V2 kD$"Pjh~ 2L$$ VW$UUP(P+jh ljD$jhj/Pt$4% g f1P+jh Pj(, =L$(Vh$Vt$$L$(3 VY^PPjhi {/ Pjh- t$,j+ PjhM t$,j+ Pjh t$,js+ Pjh Pjh0 t$,j9+ N qLL$8%L$(QPQL$4t$$ŋL$(eܰ Pjh ? V\ZYPPjh Pjh t$,j* Pjh3 t$,jv* qLL$8%L$(QPQL$4t$$ŋL$( Pjh t$,j1 *  Pjh t$,j) PjhO t$,j) VAZYP\Pb +Wjh4 D$ PjUD$qu WjhC t$ j Lu Vh$Vt$6 V@( 1 VhVt$f Vҍ$ = WjhL t$ jI )UhUt$c4X Rjh L$ +WjhD$ Pjt$ L$FhpA @Q4$PuHELpX\PjhKt$0j0$p|Wp,UwGEL4tSWWj(t$!zvQQj)t$ z^EL\OPPD$p|U뗍 PjhM F@ @,WuHvXPjh Wjh vLzW%VPVt$ys<$+GLGL vL-W%VPVt$,D$ Wjh t$ t$ Pjht$ j Wjh Pjht$ j PPD$$PU*t |$PP(uHPjh~n U Pjht$ j= N+ D$5QjhVbEPUT% qt$Pjht&hUj&j(Ujt0jhj8jqjuj@j)jj(PU m0~j$UkjZUkt0Ljhj8jqjZPUl ^D$4T$諥uj*Uij$UiuT$p Pjh~+ Vj Wjh Vj $e3[^_]Ív'j#Uj Pjhlyt&j(UiNjBUh8t&j@UhBjuUh,j.Uhnt$D$(|$rD$(hUehjt$D$DhD$Djj0UFl$D$8|$t$ 4zt& Wjhi+Vj %' Wjhuΐt&T$}j(UjgjBUTg Pjhvt$|$D$(D$8 hUfkD$D$DD$D$8 jj0Uj$ Pjh+ Vj WjhVj t&jj/Umjt$RP$jhjBj9j>PUh L$D t jj=jUi$ jj9Uff$^ jjZj%hj(hj*PU(d0}VU$_ T$LR$RT$tRT$LR$R$RPUsp Ujj;Ue$t&`jhj@juPUc  D$$D$$҉D$ D$DuD$(u $D$XhUg$b&hUaX PjhF1W+RPU@ZYPPjhVjPU$T@ @ VPhUdn)uPڃD$l$ډT$LvjqUE`D$2 t$O`lt& j6`MH v' j$PwLuO$  Pjh +Pj t$hu!jjt$dU^=v U&D$d t$l$߼t& P+jh Pj Pjh ) Wjh+ Pjh& U HD$p WjhX PjhcPPj$UUWWj#UU Pjh?I?Ot$P Pjh` Pjh Pjh$ PjhC4 Pjh WjhfPPQPjh[P|VQPjhU WjhF Pjh.WWPV@ V|k WjhLPWVPjh1iD PjhKPPPUi$ Wjhl WjhVjh 8 PjhoffffftlUWVSE@ (tRUu7 [^_]ÍVUPjj%Pj 1 [^_]Ðt&Ív'UWVSDo@ D$4D$D$8D$ jjBRlUʼnFDtDj/Pt2UW4@FHj/vDtFDjhW UFLtSj/PD$St=T$RW?FHij/vLtFLFt@ L$jD$0W"F@XZj/UDt9UWS?FH9>j/v@tF@FHD$4 D$<(FHPyhuuD$vHRjhRj D$[^_]Ðt&nL$FH PhtFLt* P hB vLgFDtI Pg vDg[~LtvDVW[^_]Í&nD9L$9jD$0W!XZj/UnDUnHW=‰rFHj/vDMOFDD& D$ RjjERj` D$[^_]Ð D$ Rjhˉ' PjjXPj 1[^_]Í&hWMt{Ft@ jD$0WXZj/Ws\ Pjh냐t& D$ Rjh1R'L$jD$0WcF@XZj/Ut9UW<FHj/v@tF@FHjW;FHFH Pjh&D$vLRjhv Pjjv[t&jW=;FH#FHT Pjjlv' D$ Rjj_'D$VWRjht&D$vDRjhvFH{ D$ Rjh6t&jWe:FH8 PjhO D$ Rjj} D$ Rjjh D$ RjhFH D$ Rjh D$ RjhuPPjW9‰t ~H Pjh D$ Rjh! UW/VSb=.9 e$1$$|$@$ D$,D$0 |$D$@D$0$4D$DD$HD$41󫍄$D$PDŽ$XZhUIujBUIthUsIhUZIhUAIRjUDM_XVU$ H hUHu $@ thUHhUH$@ uHD$D PjhPj $e35& [^_]ÍvjhUNj@UH j6@PUNg jj`U*wHtT$D=D$LtD$H$hUGL$LD$D$@ $tlPR,tb$PjU҃ $pu.$u$ Pjht$j( y1@ @T$PhUFw$1B @D$TjhUFtjjhU!N5 D$0PD$0PD$j{UGF D$Hu D$Dj{UFtAjj{UMM jj{UL$ jj{UMD$<j~UE$@ ;D$LujiD$Lt& Pjht$jl t&j{U>j~U=H Pjh^$@ Md Rjht$P$ Pjht$j t& Pjht$j t&$pPjht$jZ f Pjhzv'Pj$U@lj)D$ p Pjhv'D$` U/Q$P&8 Pjht$jd t&p0Pjht$j9 j{U;+PU$Y Vjh t$j $ Pjh PjhL$>D$` Pjh,QPjh j#U;j$U:$|$p$K@ pQQt$V$PPjPU:PPjRUq:f$$$$9 Pjh|VQPjh'd Pjh>r$pPjhpR$ PjhSPt$D$puPPUPjh4t$j ijj/U<$RP Vjht$j PPjvUn80DŽ$PjhU$$@ 2$f{RPjhID Pjh[ml$D$$D$D$$ƒA pT$jvt$X1T$$gx Pjht$j] qj~D$01$@  G@T PD$0$ wGC$@H$hjjU6D$l jhU6D$hZYhUV0D$Lt D$H t$ hUE48yx|$\u$Yr D$XOt$\PD$@p U 8 hU/8 hU/tL$pD$PtD$phUh/$^_jqUW/T$D$D$@ F$$ qD$<D$ |$|$,djD$ph$LD$DŽ$ WhQVP$Pjht$,jַ$0D$DtT$tI$t>$ L$ Rt$&;$t&$L$ 1qdut6$t+$1ȉt)D$D$ 9Hl D$L$@ t$HttL$D$ɋxp$D$$$$ WQt$VRP,Pjht$,j臶0t$t$/ fPjht$jD jD$cD$D&$Pt$>D$ J $t$ƋD$ PtjRT$ $VJT$$ƃ)L$<y $K jPkT$DuPPjhyt$j Y VjhajD$plL$ qdRP17$ VjhWt$j 뜋L$ qdRP17$m Vjh\t$j贴 V jt$HPD$$Pp$$ 8 Vjhet$je t&D$XP$P$P$P$P$$$t$4${$0D$ pd$$06$]$@ D$Lt$h$$t$3z$$H$QRPPjht$jG ?$t$Lu$T$D$L$HT$Lu |$D Pjh$$DŽ$$`1$$L$hU)hU(D$PDWPjh$B # Pjht$j l$ W{*_ZPPjh_t$j诱 jht$$bD$H\$r$ Pjht$jO 1L Pjht$j) + Vjht$j h Pjh} PjhKt$j˰ |$\u |$X Pjh&t$j蕰 jUB'uhU-'aT Pjh+t$jF H Pjh0t$j" Pjh$ Pjh  Pjhet$jׯ D$pX$PjhPD$0@$ Vjht$jP ]&( Pjh+$9L)‰$B` PjhFt$j x$Pjhtt$jĮ D$Xx'PPELp Pjht$h萮 EL@ D$X]QL$adRPL$1HD$$ L$$adRP1{HD$ R4 L$QT$RLRjht$P$  PjhPPhD$0$PPhD$0$RPPhD$0d$ Pjht$j} Vjht$jY DŽ$PjjU*$t Pjh&t$j  ]PD$pX$Pjh5t$jܬ Pjh t$j踬 L$pPjhU)L$pT$2Rt$VQjht$PNT$4)$ WWhU"$6$@ % Pjhjt$j RRPt$o4D$ c$!$P QQjhU["|$LRRj=U;"8 Pjht$jT d Pjhvl Pjht$j $@ 5|$H*聥 Pjht$jժ PjhMQD$pXL$Pjhot$j菪 G Pjh/t$jk @ Pjht$jG I Pjht$j# 1H Pjh;t$j Vjht$j٩ 1WRPUCZYPPjht$j誩PUZ$ Pjht$jl t Pjht$jH hPjjRU&$PjjPU&$Q,RRVPjh6 Pjht$jڨ +x Pjht$j趨 PP$Pjh(VV$pPjh PjhwVV$PjhWVSt$|$jbV u W_t4jjVu.t$WV(LXZhVu$[^_Ív W/J[^_Ív WZ[^_Ít&'VSyE  t$jkV4t-jjV" Pjj''&jVt. Pjj4Pj [^Ít&jVuhVuhVuPPjVzuPPhVfmPPjVQXQQjjV<tRRhV(u[PPPjjt$,t$,V 4hVt$t$V Pjj9fSæ  t$t$t$e[fffffSv PSjjPj蘥([fffffffVT$ 1JB B$1yu yuBB ^Ð&nuyuBB ^ÍvUWeVT$rB B$)ȉ$y)un@ V*tw[^_Ðt&VSÅt$ F v]41҅tF [^Í&SzFD$pt$1[Ít&UWVSB l$ |E40u5D$$ppPV?t8PV(tAt$,U [^_]É'D$$@ [^_]Ð&D$$@ [^_]Ð&WVSTheD$d1IPPjhWj`jPt$VuJjPVtVPjhWj T$\e3u(`[^_fVPjhWj l UWVSÁ$j/Pdtx,YD$ ~<(Y1f;l$ t$6W)u[^_]Ð&1[^_]Ít&UWVS74e $$1P Phjh|$8W jWYjVPT$ UT$ u.$e3 ,[^_]É'+ 04FT$ |$tMT$ PPQWPjhPj@0T$ vt&1ҍYev뫐& 0a4F|$t9 Px-PRWPjhPjȗ01; t&'UWVSOTD$h|$pD$eD$D1jVt2t< VuD$ v'G#& [^_]Ít&'D$T$B<@Ít&'WVSt$|$WVT$t V<‹P[^_ÍvVSÓ# Xvx: $ ZY1$$I$]XXXZVgvYXV zXFIZP hVYZPV%[fHF[^Ð&WVS|$t$ÙVWT$tT[^_Ð&WVS|$t$YVWpT$tT[^_Ð&UWVSW#|$0l$4w@G@D$ 9u>6;t$ t0~UW tt$jjlj`jajcjjj]PjP PjjVjTj,hhhjjtjsjmj hj)jj&jBhhjuj@jZj%hj'j(hhj=jj#jhj0j/j.jejPjPP jjVjTj,hhhjjtjsjmj hhhj7jjBhhjujvhj~hhhjSjQj=jj#jljhj/j`jajcjjPjPxPjjVjTj,hhhjjtjsjmj jjjhjj[hhhjjhjYjjkjjjbjPjPTPĄjjVjTj,hhhjjtjsjmj j)jhjujvj~hjPNLjjVjTj,hhhjjtjsjmj hjrPFjP]0PxDjjVjTj,hhhjjtjsjmj hj~hj8hj{jqjcPjPd8PdjjVjTj,hhhjjtjsjmj hj8jqjcPjPmPQ`jjVjTj,hhhjjtjsjmj hj8jcPvjPPHjjVjTj,hhhjjtjsjmj jhjujvj~jĈjjVjTj,hhhjjtjsjmj jjhjhhj[hhjjjYjjkjjjjdPXAjP P|AČjjVjTj,hhhjjtjsjmj hjbPBjPhP6DBHjjVjTj,hhhjjtjsjmj jj6j5jjjjhj hjqhjcPTCjPP|CjjVjTj,hhhjjtjsjmj hjqjbP DjPpP~LDPjjVjTj,hhhjjtjsjmj hj}jcPjP\P/ELjjVjTj,hhhjjtjsjmj jjPEjPPELjjVjTj,hhhjjtjsjmj hjj jqjcjbPFjPP G`jjVjTj,hhhjjtjsjmj hj8jqP jP$PAGPjjVjTj,hhhjjtjsjmj hjqjcP-jPCPHDjjVjTj,hhhjjtjsjmj j3jjj-hjhj4j[hhjjjj2jYjjjbjPJjPL(PxJĔjjVjTj,hhhjjtjsjmj hjjj.PPjPmP$dKXjjVjTj,hhhjjtjsjmj hhjhhjzjijcjP(MjPt,P|djjVjTj,hhhjjtjsjmj PdMjPPzX[Ðt&UWVSÓHD$dl$\D$(eD$81j/JD$,D$ D$dD$Y^hu)9 ~1D$t&jt$u/ D$ E40@PPjht$$j}a  Pjht$$jYa T$hUT$maX u MH d ON Pjht$$j` ]j UhU[DžDžhU+vhUAjmU jj8Ut Dž ^hi _hJ _h+ 7h `jaf KjJJ MjL. QjP SjR OjNdE4/|^EH tlO PjhBt$$jw^ D$0PUue PjhEt$$jC^ D$d Vjht$$j ^ Vjh8 t$4_Xu0PjhHt$$Vj]PjhKVj]jsUkujtUYE4TD$ Pjht$$j[] &M Pjht$$j &] xQWP4QPjh̍QWP4QPjh뱍4QWRPjh뜃 jYY j'O$jht$$h\ N Pjht$$ju\ jTU"jjVU* jPUw{xQKQv RT$Pjht$$j\Ed T$ijUEIt E4@j[U| ~jAUT PUVi@uu Pjhht$$jf[ D$jjUD$ `b PjhPt$$j[ >E4t$ t$\UP D$ RDjU؉,Ou0PjhWt$$jZ D$QWPcQPjhGxQWPcQPjh)QWPcQPjh j1 j O$jh_t$$jY U jmE4 D$ DT xQON Pjh\vT$1!Í&'UW1VSU!|$4t$0҈T$tmؚT$&tNDH u#t=ut&tDP tT$8E49t/q;l$jju8 jjuя8 jj̎8{D$&Q謼D$ ? P艊<$D$ %u(C&j jP@ V蛔uԃ V˖t YD$D$t#$`~$pz$E8jjOUhtu$Y|$t$`L$u$`w$`$_t$$hUD$|$$`D$4D$D$ H'PR虆D$D$W P׀'&H'P$P肀. P舀D$4Pj}x?|$,|$ft$WUT$ );t$,|; 6$P4FPPPjh2=$8 PjhPjYM D$ Pjh Pj*M rD$l$3l$D$nt$$PjhPjL D$Pl$D$nt$$Pjh‹l$GP PjhVjLQt$ PjhVjcL 7豁 P@PjχF ͅ 0胁$YP4FPPPjhPjK0B肅 08$P4FPWPjhPjK0 $fffffffUWVSuA t$(T$ L$$tLQRPʼn<$4$UP'0QPQjjCPj1K<[^_]É'묐&UWVSÿP褚4$蚚$BxT7DPtD$  [^_]ÍvE [^_]ÍUWVS致SDeD$41'l$X'' 'j|UQL$juP4W 1P<t/t& P觙$O9}ƃ W uփ Wݘ'0juPŗ PϣƍD$QD$,$WvD$ PV* VZYPQPjjt$j=I Wa$jjUVi"uj|t$ Ŀuà VDy D$PjjjV5  D$(PV|D$ T$$jRPD$X'@s4$軪6 VZYP RPjj[t$jNH t$ t$$t$$D$X'4v',$ W^_j|U誾'y|RPRPjht$jG ' y|RPS PjjQt&jD$@0t$<NjD$HT$H@rD$XZj/UzUt$<茨WPUnUWPjj(wt&X Pjj5_t&SUWPjj>Ev VuE PRjjVPj$B &\SUVPjjL VBt'Vt$mu'S PjjaSVPjj\TRWPjjeUjA jjWt$t t$e t$hVl$jVٞt jWjjVr jV語tX jWjjVC u? PjjbM&D$hVV;jV@t1 t$ ~Rt$ W4hVdYD$Yt$Pjht$(j'W_ t$#t t$D$pX[t$Pjht$(j& .'pZt$Pjj7dYPjp& 1L$le3 |[^_]à WGD$ W׭\t$PdYjjWPj%gtgx t&?PjV趠y)uP1D$?PhV{y)uP1D$ W WW$WW(W W,WW0WW4WW8WWt& Ut $jht$ j  D$D$;D$DD$HL$s5D$D|] PdYjhljD$ Pj Yjj$D$ PU tY PjhWj ]WPjht$ j v VjjVt$L6 ,$^r VWt$jht$ j3 :vt$D+t$ ty||$ y|  ]UVW|$$WRjht$0P09|$D,[^_]f t$LXt&,] Pjhf t$Lt&_t& U jUD$$ t$ XkD$9‰T$Y l$@D$D11D$&jjD$pt$L'D$$0D$x||D$ 9t&v wT$D$P:Ƌ?;|$ u݃ D$pjjD$pt$L/Xt$UpD$;D$D$Nl$DD$Dl$@t$ )ƃ t$$nuvjjt$ U t$oZt$(jht$ j 놐& t$LIt&1D$DD$ w Uy Pjht$ jd y|D$D1Wt1] UjUjPjht$0j0DfffffUWVSóD$4t$0|$8~l^1D$ ^D$ &4t$jj t$$jjj4Sjjj V蜙 RP4V[;l$4u[^_]ffUWVSG$|$$$D$e$1W蠟]Xj V֑thV6j V諑phV蒑tS$tIx^ Pjj/_Pj $e3mĬ[^_]ÍhV*OD$j V Pj VD$d PjV$PD$ŋL$ L$ p谡$$Xu蹡$$Xu¡$$Xu[$Xu軡L$$ $ljjVȗjjjV`D$,T$0ZYj VD$Wt$$V詗ƒj$1D$ t$t$Bt&jj4Q W4t$uD$ ;$Rt P_jjnPj} hV"wj V ajj'VCIP^ Pjj)cPhVےD$ZYPl$dU=l$x Vbsv'(^ Pjj"t&hVZ\_v'^ PjjSt&^t$\Pjj@D$ & QGj^ t$Xt$PjjFi fffUWVS|HD$`t$d|$\D$4D$$ŋD$hD$ eD$81VJ4$D$ 辟D$L$uk1 V蘟 V贞4$D$踞T$4$)‰T$&d$D$T$hW t$t$W] PX_t$P _jj=Pj  t" U\jjUW|$D$(|$,e3=M<[^_]Ív V_D$T$H& V? V{u|jjW)t V蹯Ht$VWRXZhW! VѰ' WW &t$t$WD$ L$ _҃Qt$P _jjGPR 6v' V距D$,螚 L$ |_҃Qt$P _jjCPRb v' t$$Tgdt& VPLjVPWD$8 D$(PjURY_u"t$t$$Bt>pBv t$$f $ _jj#PjD$H D$pX,_t$P _jj-PjD$H m VSY}%y t$jkVt-jjVg Pjja'&jVՉt. Pjjo _Pj [^Ít&jbV蕉ujV胉uhVnuPPhVZuPPjVIpPPhV1XPPjVCPPjjVtQQhVRRjjVވtPPhVʈ4Pjjjjt$,t$,Vm v'hV肈hVigt$t$VP_ Pjjtr` Pjjy_fffffffUWVS3{veD$ 1D$t*$x L$ e3 [^_]Í&9PW7F-tRE@,tHttT$ RjWЃ-u$ǃ$1n,tOtKD$tǃ$@&jjWЃ,t& P,`jj#Pj 1} UWVSyÏu D$ u RyPtRWUƅt [^_]Ðt& 1P,`jhPjo [^_]ft wL dtlWh$WUt 1W2uVt% wLcuGTRt&WhWU8vGTu띐t& wL}c%WPWUwt&UWVSuxAtҋt$0t,t$t$ jD t& uL\%UPUWD$xvUh$UWyv uL\}ETp{&ETET uL5\%UPUW7t&b Pjhat$ j, t& PjhVt$ j \t& uL[%UPUWt& PjhGt$ j t& uLM[%UPUWOct&auHPjhPt$ jA D$ y t$ t$ vWVSD$|$ oùk0WrtpPl:u ;p0wKv[;|^_Ív'@pHcPjh,`Pj 1[^_fTcVPjhӍt&bwHPjhfVSGokRZu1[^Ð&[^ÍUWVSnj(c,`|$@PjhxVjWD$@D$ Wt$Dt$< W`=D$@- PT$HD$@t$Dt$DT$D$@1[^_]Ít&3 D$DpLXD$8@T t$Dk'tD D$DpLX%t$8Pt$@t$<~vt W 1WjhNVjeR`PcPjhVjEt$D&t$8ht$@t$< 1WjhVj Rt$8h$t$@t$</v'c PjhzVj [^_]Ív' D$DpL1WDD$8@T3G&c PjhVj/t$Dt$DD$@ 1PjhVj & PjhJVjPcPjhVj W1' WGc PjhVjQ1t$Dt$DD$@ 1t$D$'t. D$DpLUuD$8@Tt#v't$8ht$@t$< PjhVj S2 d 1PjhVjpt$Dt$DD$@!&D$0 D$DpLT%t$8Pt$@t$< D$DpLT%t$8Pt$@t$< PjhVj _ UWVSgi3e |$ l$$jjUW{t: PiBrjjUW V [^_]Í&Y`1UP,`jh|Pj ȐShæd蜂u-v`P$Pjh t$(jt$,t$,[ ƒ[ UW1VSuhAd$$eD$|1p$u=1jeVv PUV=L$|e3  Č[^_]Í7v;>jD$tPU6D$|tjVtwD$pjjUVD$(hVLtAhV3xD$ Xt$$腆D$XZj/t$4jt$VJF8/u:/tj/RT$ Y4T$ T$ t$Z4 PT$D$$RT$t$<T$L$ 8/D$T$'jjPVt$(Md t$P,`jhD$$Pjt$$薹L|d PjjP,` D$$Pj Wjht$$jzt$$>e Pjht$$jE te Pjht$$j  l$$U۸,$#$[u0 t$$jjPVt$(KW V ZǍ Wjht$$j | j$Pjt$4vhD$X jjVuD$DD$$V jWt$8t$4RghD$H D$( D$(89l$ t$$9t$(tfƃ|$4tE x@t$$;~9tE9uà Uz(뵃 VXoDe PjhTl$ t$$ t$4l15 t$(uS Wjht$$j2 PPD$$|PRjD$8d PjjVPPP`t$$jjhjPnD$@ D$ HP`HTWWjv$1D$T t$PY4D$,‰D$<ωL$4L$t9a l$@|$$l$4t$<΍vO9L$ SD$tPqHL$4!L$$, qLL$4JL$$tAPATt$@QL$40L$$AP@V QL$4@ L$$@ u! QL$4~@ L$$@ L$$ V83 VL$,QALp VN/uOD$(9Ћ tC|$$ϋD$t9tt&t H9J9u9|$(t΋|$$&?;|$,D$l$@t$<9D$,D$$fD$<D$@D$HD$LD$Tl$X|$t$PD$@t$@V˔tlFTVHu u`T$xaUUVRjhl$Xt$P|$@u |$D$ xt t$(FD$ T$$|$H|$0ωtD$T$ w t$(VF t|$LtD$0PPj\V%hZYPt$@t$8jjjjjt$HV[E0PPt$(V$6Qt$4t$LVG|$0 Pt$Tt$4t$4V  Wjht$$j vHvLfUUVRjhj Pjht$$jk ^ Wjht$$jG 'Xd PjjKe Pjht$$j  Wjht$$j |$<PPD$$pXFaPjht$$j  Wjh t$$j } VuOFTv c` Vx@ @ 1FT`UUD$$pX@gPjhHe Pjh%2e Pjh4h Pjhl$$UjWjhUj h Pjhl$$UjWjhUjo t$< Wjh\t$$jG t$(Bt V/ t$(BD$ PtT$\Rt$HL$@1jh PVt$l T$\tjD$ @t9NP@NT)vHNLqXPt$`jht$$j vHs|fQQVRjhE t$P Wjhl$$UjAWjhUj. s V-.tSD$L D$<D$@D$HD$Lf Pjht$$j V+\$HWWD$$pXgPjh Wjjrt$$ju f@t$bL$4D$ 1D$ &rue;t$4jj4k#,$t$j4t$L薏 uh t$jj%Pj D$6rt Phjj)Pj [^_]ÍD$[^_]ffVSTUPt$(F v6t$,t$,t$,҄ tF[^Ít& Phjj$Pj< [^Í&'UWVSTO,t$D|$@eD$1l$HuBh Pjj1hPj L$e3 ,[^_]Ðt&jjWhjjjWgD$T$ D$$D$(PD$ PjhjUVWEl$D|$H0To)hWURhjjDRP Ev^ Pjj6 ffffUWVSRãNLL$l|$`eD$<1t$dT$hɰtL$hEYjj$EPW;9 WPBt RЃjjWt<$X\  k PjhsujjjWEE MDžXDž\DžhDžlDžp1Džd9Ή}/ V/uEpTV\8zUWgUuRuMf u }Pjhuj EhaG@O@M9ȉEM}?&fuVue E;EEjEuhpV[ EujV[ƒEuuuЉ0U MM ‹E ptpTtp@,#ptuuu" }Pjh#ujm EMEu ȋM ыU0 ЉUxEu M|pT|x|+x|uuu }Pjh Wk}WiVPjh% VeE4$*eehl }Pjh hjnWS(iuDikRPhjhdEPh }E}8Y;EYZjV!>tjV>jVt>ZY!D$ j2Va>t D$1j3VE>ZY!D$j4V2>tD$hV>1҅HRt$t$t$t$t$0WUD$tPt$Ht$HV0AT$TtT$T уL$TDtEl$u=xm PljhPjWe& uKuGуHHD$TuTRD$T T$uRa*{fjhV@hV<!D$&jhVD$4XZhVW<jhV|D$0jhV`D$4YXhV<4jhV4D$0&jhVD$4XZhV;jhVD$08&D$TL$lPWjjjt$dt$$VP 'jhVD$0t&jhV`D$0t&jhV@D$0t&jhV D$0tt&jhVD$0Tt&jhVD$04t& PljhPj t&D$TTPWjt$dt$$V4+ ƃ W&<$<[^_]ÐPWjt$dt$$V 뿍֐t&T$( t$,hT$8D$<$T$8TYZL$4DPvQT$(lRt$,PjjQL$@ &tD$TDtl 9@t`€t$ uu Wף fPljjPj  PWt$dt$$VmN tvm PljjPh dTm Pjh ut&UWVSW+#'t$(|$,l$0jV 8l$0ɉL$4[^_]W&D$T$L$ D$L$3vUWVS*ó&t$(|$,l$0jV7l$0ɉ L$4[^_]&D$T$L$ D$L$fSz*F&t$|[fffffffSJ*&t$|[fffffffS*%jjjjc[Í&UWVS)ó%t$4D$m|$0T$ Rt$tT$  [^_]Ð 1[^_]Ít&UWVSW(#$HD$ D$d|$\D$eD$81rT$DL$TT$t@ƋB@t8T$ P{GT$B9D$09t3BnH@;M@D$l$ F9H@d69ul$T$jt$ ƋT$T$BFBFB F BFjt$ T$AT$ PD$D$FXZVt$T$Bt& T$PCD$FD$T$ juh&<-<+.<:tD$$T$ 99)PRt$T$D$<:1Gw$<:D$ l$$DzTL$ D$,T$(PMt$L$ <:tD$ D$$<-&V ~DQ D$0T$(Ptp|$t&V DQ D$4T$(Pt0D$(|$D$ D$$fD$/&@oVPjhw Vj WjhVj 1L$,e3 <[^_]Ít&LnVPjhwPh轺 붍vP oRPjh|l& WjhwVjq TpnVPjh뇃Rjt$T$D$>y WjhJ롍nVPjh;n PjhwPj 1n PjhX &D$@4ÍUW#VS#^e$1|$$󫍃wDŽ$D$dov0Pjj/WjFjD$Pj$t7bT1~1$e3 lĬ[^_]f Vf{!zjD$PrjP jU~jUhh j7F88<$ P/NjL$ WQVu >:/|$ DW PD$WV^T$uCt EW8/u3f8/t'ƀ~/FtrEL$e3 5,[^_]Ít E:/u:/t D$$PD$$PD$$PRD$$T$(pE T$ t D$8t@oRT$PjhwPjm T$`&RT$ t$Zt$ tY_VD$pNjT$ tBD$v 8uT$Pa~Qt$ PVWU T$xCxT$ Pjh>D t&VSet$Vaƒ1t uL$t[^Ð&@t;]xt$PwjhPjHD$< [^Ë@It]xt$PwjhPj z&UWVSáDT$\L$`D$ -t$XD$(T$L$ T$hL$pT$L$weT$41UPjhCL$4Qj~|$0W1Yt$hVUWD$ p ƍD$ D$uPW&t$ vUt$D$ ЉD$0Zv_F@ WG:Wt$"u"t$D$`%PUv t$bUt$$JjFPt$(& W7T$0D$t9| T$,e3<[^_]Í&܍t& D$  PjhLt$4j 뗍& PjhGt$4jԱ 낍 PjhSt$4j讱 F1 UWVSS0t$HjjV]u,[^_]Ív'D$L t$XHŋD$H t$T#uljƌ1D$D$9us t$Tf9D$%(p PwjhPj躰 9fƌD$D$9ot$D$ D$|$@D$e'D$7 FHLAt$XPWT$ht D$Pf9L$ }L$ t&6;t$F@QutjaW&F PeD$FpHt$TA>D$tjFPt$X6;t$_vT$t$  t$T9D$(p PwjhPj D$jPt$XZƌ9D$-t&jbW]%D$FpHt$Tti vGD$$e4ZYL$Qwt$(jhQP. & veyjbW$^& v- v$_&FL$pHwcL$L$Pt$XwF@LHɋL$B8D$H t$T.v PwjhPj ~D$ D$fp Pwjh Pj輬 @6D$'UWVSwC\D$|l$p|$tt$xD$,D$$D$eD$L1D0rt$8 V5D$T$t'D$ D$P9t$ u+\&t$VWUD$$Ѓ;D$,~D$,69t$ t33tՍ D$, PwjhPj膫 D$t! PRucjjt$ U=|$uYD$,L$Le3 f\[^_]Ít$D$4PjUD$$Ѓ;D$,~D$,댍& UO돃 W뙃 1V3D$ V3jjD$0PU& ǍD$,Pjt$ Wu! V1ZYPW/t;pm W $wjhPjQD$L V0 t$VP\pPwjhPjVnQt UNjjt$ U͓<$c vUWVS~D$4l$<D$ 9u%\t&t$D$t PbuD$ (9t t$,|$D$0 VDXt$jht$@j m;l$ X&X$@juW^ƍD$@PjuV, u t$(t$(t$8VW ;D$0~D$0 uFjjuWo4$ejbt$ 1A t$ V jjV蜓njD$ pP>D$4L$@D$L$ & t$0,:%|$ 3 󫍄$P_$Py$|$ 9u #v9tP;j@u9uv't$Wjt$ D$,Ѓ9D$}D$ W)]I t$ 蕕x7Pjhc#] PwjhD$@Pjt$ V jjV8I9t$ l$t$4Vwjt$ Ճ;D$0~D$0 wl\?;|$ #tč t$ D$0 Pjht$@j\> PwjhPj1 D$ t$0*>9t w[?9uD$D$0{t$ >) W)5 PwjhPj貛 밍 t$,D$0 Pjht$@j耛 t$, t$0cjt$ *:D$ 1P0 t$ dy PwjhPj k t&'WVS|$À +yPOthjPWXZj/VuVwM[^_Í4qVPwjhPjP 1[^_Í&1UWVS|$4D$0Dj/W=h?/ U> PD$UWL$u,΀>/u v>/tj/Vu .t&8/u&8/tj/Pt.lqWPjhwPjN 1[^_]ÐVD$t$ t$Hjht$Dj ;t$Ht$H t$ t$Hjht$Djؓ čq Pjh>t$Dj跓$D$ Pc$O1~R|$ D$$&D$D$d4>@HD$hPVWa8/j/PD$vƋT$u t&>/tRWYQL$w Pt$wAL$ QL$%4$D$ZYT$DD$PwL$ \ VQt$8t$ PD$( :T$ Rt$wc;$ t$@6D$D$0V RT$ T$u"vxVPjhMt$Dj 뉃Rw Pt$ct$$t$@D$Vs;t$xt$t$4D$H,i9a D$0P!ND$h||D$ 9tt$,l$$UFP8uq6;t$ uߋt$,;t$xj& t$ |$W!L$Le3 4\[^_]É't$$jD$5i PjhP&D$ pXpUPjhwPjY 1m& PjhwPj) 1=&wt$,t$4jhPj 5` Pjhsq PwjhPj軌 x Pjh6( &UWVSwCl$(jU PD$48;|$$u6{vOHOHO H OHPV?;|$$tGjU<un PjhwPj 1 [^_]É' [^_]Íx Pjh 뿍vWVS|$t$\t@Gd FGtFGpF G(FW/%FF[^_Í&F FF FFF[^_fUWVSt$$l$,|$(juV u jzVg G uhVS GujVB GuhV.GXZjiVaVmPjiVYy)1GjhV0jjhVAjjzVxjhV\jVjVjhV贱G [^_]ÐP/t&?t&jjV#ZYP8rPjhVwPjT 1 [^_]Í&kGvjjV3G [^_]Í r PjhP뛐t&hr Pjh[냐t&r Pjh`hv'jj뎍&WVSt$`FP uN@@t4rvHPwjhPjdjVt$e[^_Í VtvPrPjhwPjjWt$FPot& VtPrPjhfFP;&FP"&UWVSc(t$@|$Vjj>VT$8$ZYPyPwjhPjx t&8 PjhwPjx 1[^_Ð&v Pjhΐt&v Pjh붐t&PhVHn)uPډЋT$,؉PyPwjhPj)x UWVS$t$8l$<|$@j@V j6@PVc EjjuVStjjjuVqjjjuVv-jh@VZYPwPjhyv'=w̉'EtxHnT$ T$ 9ЋwPtI1RPVBZYP zPjhwPjv 1[^_]Í[^_]É'wD$jhV覞 1RPVD$ZYL$y҃QPjht$ RevE Ptvv Pjh)v'+Dww RjhL$ QPuE &x&1wL$hjPtwPjht$ ju 1[^_]ÍUWVSwCl$0|$@u@E@D$9TD$<D$ t&6;t$4nWUtjWU4L$4t!1PUt$@iT$8t!1PUt$D&D$<iUt$D$H@D@p;D$ wt$H PwUPjhVjZt PjhVjAt L$[^_]ÃUt$賥6;t$t&[^_]ÍG PwjhPjs 1Ƀ[^_]ÉD$ PjhwPjs L$[^_]ÉD$ Pjhʐ&UWVSg3,D$L|$@l$HD$D$PD$eD$1|$Dw1$D$ 7t&tt$jh8wPjs $;t$DtRwPtt_jjT$ RPLtt$t$ WD$Ѓ9$}$t$L$e3 ,[^_]Í&xtPjh1PjwPVƍD$$tb VWt9jjt$PbKtۃt$t$ WD$Ѓ9};t V<y PwjhJPjq )l ffffUWVSwC$|$8t$@jpW.FXD$jpWD$M+zjUht$ t$ hPwD$<t"hWRT$߰T$@ RD$L8Vr0Pn{t$ Pjj&BNHNHN H NHNHNHNH9uɃ[^_Ðt&~ P|jhPjc 1[^_Ðt&~D$ wXR|jhRjc D$ [^_Ít&WVSX$t$ |$$jjhVXwPjhV;GdtxPW Wt{[^_Í&jjVZYPPjhu|Phb [^_f1RPV PLwXPjh}뺍t&|D$ wXR|jhRjbb D$ [^_Ít& D$ R|jhRj-b D$ [^_ Sjht$,qZYPt$0et[Ít& D$ R|jhjRja D$ [ÐSVjjyt$,ZYPt$0t[Í& D$ R|jh_Rj=a D$ [ÐUWVS\D$tL$pD$$$L$eD$L1|$xƒ|$xIH ˆT$ |$ Wc<$ mD$h$9pD$D$ D$ v69V~ W襌tGU uЃ W菈GQu WuuGPu W|}j|$uGPWT mht$ P$W@|$xnD$ D$ t$|Wt$D$D$D$ t& P|jj^PjT_ D$$l$PT$Le30\[^_]Ít&L$ t<|$$PXE|Rt$PP|jhPj^ 1L$9L$ !D$$l$Pr xXP ̀WVP|jhPRn^ / W臉$ Wk t$ 4D$$9D$(t&m9 u*tjjWjut$$ tƃWut$ut$D$pXP|jhPjs] 4vvO|Yt&||$wXPPjhVj!] D$[T$,RPD$D$uMRD$pX0t$,PjhVj\ N W{9 } WuL P|jhPjO\ D$D$ Wt$wuwHD$pX|t$$jhPj[ |V UWVSÓX|$tt$leD$H1l$pWptI[|UP|jhPj[ L$RjPt$Lt$LV̫ [^_]ÐjUV.?t& PjhY|PjT [^_]ÐhVRhV9hV hVpjiVZQQjVERRjV0&1jaVj+VD$ j:VwT$ ׉D$ jVUL$ ω PjhSt&jVkjUVUjVV?jWV''̦ Pjh^+v'jAVrut&jAVup Pjhqt&D Pjhkv' Pjhdv'NH(1&t&jcVW PjhwMt&hV Pu< PjjrWj4K ;G PjjcWjK  t$Bu6 PjjvWjJ Bhh t$t t$t UBjjt$Ue4Zt$t UBjjt$U:4l$,$KMXl$L$>Cv $QUVRjj~WPJt$ffffffUWVSdzÓ$e $1ɉD$ $D$,$D$$jhP"D$ @P D$@9@,D$D$D$$t<jj t$=jjj t$&$$ t$,)<D$ @@ @,L$QR,ƄD$ D$ L$dT$hD$8L$,\T$0x||D$ƄPjE frt$0Pjj&룉'jjt$jjjt$щD$(T$, jj|$W_D$4G@,t&D$@P,YD$ 9AƄD$D$ D$, 69~GQu W$/=~ڃjjD$PPjWt$$f t+D$@t#wHt$8jjit$$jzDD$0 됃 W PGL8PW&.nT$RJ,dT$ rpuBpT$ Rtu T$ Bt5t&t$@ Pjjst$$jC u Pjj,t&D$ 9u&?9V wK.uGpH@PjjZUvjht$EkD$(D$,f̅t$0Pjht$$jCt$,d<t$0Pjh|$$WjBPjhWjB vf V'Y^PPjh|$$WjBPjh밍& V^_PPjh|$$WjJBPjhmt&jh|$WjD$4G@,urt$ Fpl$0UPjh|$$WjAjt$(V:ugЇUPjhWjAPjhD$ @pht$0Pjht$$jeA ct$0Rjht$$P,At$,B; &'VSõt$u0҄ PjhƄPj@ [^Ívjj t$踽~tjPjh봍vjt$:D$@@,tjjt$D$@@-uj t$dPPjht$,Vt$,Ԗ ;t&jt$誶t1d Pjht& Pjhjt$du6jjt$蘼3 Pjh PjhyWVSt$|$jdV*t W|t\jjW[YXjjVuJhV謵uM WXZhV菵uH W@[^_Ív W[^_Ív W[^_Ív W jjjjWV迌P jj-PjC>jjWV _&VS գ t$jkVĴt-jjV貴' Pjj='&jV腴t. PjjG Pj= [^Ít&jVEuhV0uhVuPPjV uPPhVmPPjVXPPjjV̳|$tRRjdV谳PPZPjjt$,t$,V蚓 (fjdVuhV\t$t$V`{QQhV+_` PjjL PjjQfffffVSt$$Vvyt/Lt$PjjPj; [^Ð V/thV|N|N0N49tBHtHx9u V uG Pjj(Pj{; [^Ðt& Pjj ϐ& Vt V<vX?Z|YVRjj,RP ;  WVS|$Ԥàt$t6jbV英uL^Pjht$,WVx [^_ÐjbVUuʍ Pjj7ԉ Pjj<Pj\: [^_UWVS7$$e$1$uC Pjj3Pj9 $e3 ļ[^_]ÃjuW҂D$ZYjWtt Pjj=또t&FU T$D$t$4VVt$t$Wƒ mHOHt$PjjMD$(Pj49 jjt$WCD$$t1 t$ $jjQt$(j8  t$,up PjjUt$(j8 jW`] t$ 5jjt$WP"Xt$vmjW`h1D$D$D$l$|$l$ ,&x@D$HxPt;t$tSD$|WU*@PtHxuuXWPjjt$(h7 뤋D$|$@ t$t t$: Pjh W/{ UjjUW vuXWt$$jjt$(h6 {jj$PW  Pjjbt$(j6t$ t W.jjt$Wd Xt$芉~PPWPjj!t$(hQ6 T Pjj]t$(j+6 x Wj.0 PPjWìt% t$萌t|$Xu |$\Vt$ t$ t$U5uW Pjjs t$:7襻ZlYt$Rjht$(Po5 VVjWu],Vt$t$Pjht$(j45 PPD[t$Pԉ PjjCPjd2 [^_Ð&H PjjSPh12NH WffWVSЗHRPpjjPj1 jjVW;$Iu [^_Ít& Vτ1萍&UWVS藛c$$$D$e$1jD$0UizD$FD$,pD$ $D$ D$$vzD$T$D$t$t$Uݻ t$0jjYt$(j0  t$jjt$ UoZt$$蕃<$JjjWUGXt$m9t$ }t$ $$;D$GjD$T$tU8yXZWt$[̌WPjj@t$(j/ 됍v' t$#t t$$"N t$0jj^T$uD$`D$ t$t U'jjt$ U'Xt$$MXt$0jjT& Uo'& UW'b&D$ $e3Ĝ[^_]Ðt& PpjhPj. 볍& t$0jjPt$(j. #t& t$0jjI֍vjhD$pX03CL$t?T$t1Rt9PtrL$ QW t$t$UD$p||D$(9Ƌt\|$,|$l$ Չ'Vt$3XZVWYXvwXD$,pvkFL;L$(muË|$,l$ D$D$49‹D$T$0T$ xzΉ|$8l$Wj%Pjj?Wj%LPjj@Wh~% ( $)Al)AhUQXu UWVS'4t$Ljt$Lߛ8ʼn t=uQԐ PjhɐPj$ ,[^_]Ív' PjhŐt&j t$Lj… ЈD$~>jbt$L8Eԏ PjhW&jD$P0t$LDmD$ZYP-PɐjhD$(Pj $ hjt$t$L-$T W? W*t3 Wt"jt$LT' WD$|$D$D$ Wu Wg W l$|$ Vjjqt$(j VjhuHt$(jjit$(jw D$@D$ Wt Wxt$Pjht$(j |$D$@l$D$뒍 Pjht$(j PPt$Pjht$(j %QjUt$L l$|$ Vjjdt$(ji UX* l$|$ Vjj^t$(j, W|$RRt$fRjht$(P TPjD$P0t$LfD$ZYP-PɐjhD$(Pj WVSt$t@jjVu* Pjj PjN [^_f VrXZjqt$ty V蠻xWt$PQQjU)Qt$t$U,M t$E$1҃$D$6|$ l$$׋l$t&;|$ jjt? tt$ Uuˍ |$ l$$ PjhGv' Pjm tt$Pt$$U_tt$Xt$$e Pjh<렃 t$tt UTjjt$UXt$$Y $jh4 Pjh(>|$ l$$D$tt$t$ t$T$D$9L$1 |$D$ qFPVT%1  D$$T$,9t$0L$4Ɖ|$8l$(F01l$$ut&;~0Vl8u@PSRU薌uNjt$0|$l$(PPxvHPjjd Vj PjhPVjt {t&9|$ PjhARRt$Tt$$dPPt$\t$$TePPt$`t$$ePPt$dt$$P\D$|$;D$D$ D$L$$D$t$|$4l$8D$0&|$$9|$|$ D$$D$ @@TD$(t׃ t$4賍x0|$<t\hlxpR1D$1&Lt ;qLʋLt ;qLʃ ;D$uхtD$,9k t$,D$@B |$4l$8 PD$$jh Vj D$ PjhU PjhLL$|$4l$8;D$L$-uDPVm%[^_ÍdPVJ%ېt&UWVSaÓ]D$4 ǃDY1t$< /@YTYkD$ @D$@YD$3t&D$ DYht$ t5t$<Q7t*9|$̃1[^_]Ív'DY뇐& kt5o0[^_]Ít&UWVS`ó\PYoL$D$f9}kWFPY1Ƅtރ Rt$jjt$EVX8HYVt$E6LYPYTYo9|L$HYl$)L$ՉD$SB9PY(|t,L$ T$t$Wt$5T$L$ %|$)9|1|$,e3=4<[^_]Ë| ǃPYǃLYt$,HY6 0Dr uD$TYL$xD$|$ qh1El$:L$uMvT$D$D$2D$8tu< tV;|$ El$:L$tt$ϋoPY9yPYl W-|$LY V-vVS7^ZBP(PGPhV, x[^Ðt& PWjhPj 1[^Í&'VS]ÅYt$ e$ 1Su$ e3uD[^Í V7"tэ]VPWjhPjP WVS&]Xt$ e$ 1u$ e3ua[^_f V"u jjHW$ 뺍̘VPWjhPj &UW1VSu\AX<$P $TD$e$,1<{TYFD$ PD$f UGXt$}$8tۃ PRj@|$@WD$@PU` @D$(tt$,>lu~vu ~mcv|$T$T$t$8Wt$@t$Pt$$g[ PWjhPj ' j v* U1$,e3<[^_]ÃD$0PWjhPj )tQW t$(jhWjeQVPjhWjK v~uaD$(T$0T$ P/$WjhPj it$|$:ffffffUWVSYoU /jhWY_PV" uKt$(V#uwUV,u~t$,V !XZt$0V}* [^_]Í PjhPj V1 [^_]Ð& Pjh뾐t& Pjh릐t& PjhPj 1_&UWVSuXAT0iD$ t$HhWuHELpXWPjjzD$4Pj<D$p00~R|$T$9 t$Pjht$$j v u‹~tx<@j/W$* uHELYpXt$,hQL$4% L$WQt,[^_]Ív8t$Pjht$$j0v @f|$uHELpXМWPjht$$j 1,[^_]Ít&G<*uxurD$j0PW6 KjELPW '&ELpXW!yWPMWELP08`t$Pjht$$j &uHELpX#Pjht$$j vWVSUpQjjzP tHjzQ[^_Ð[1^_Ív'UWVSSUQ BWTOLD$GP PqX1u tlGL`t$0VWUF!(t UO D$F[^_]Ív PjhPj 뼍t& 1PjhPj [^_]fUWVSsT?P @LWTFGPOL PqX1 ta t$0t$0VWPN( t Ul  [^_]Í& Pjh;Pj 뿍t& Pjh8Pj 1 [^_]Ít&UWVSS_O jjxP t!HjxQ[^_]Ít&GLwH0pXPjhUj:V1#t[^_]Ðt&jPVuՋGLjPVkuWLD$ wHrX@RjhUj D$ >fWVSR`NBT Zu R`!QV7x[^_Ít&UWVSCRNHLVT@P PqX1lt[WVPx$t UV [^_]É' PjhPj 뽍t& PjhPj 1 [^_]ÍVSyQEMD$yD!PePhVx V][^Ðt& Pjj,Pj 1[^ÐUWVSPLt$4l$0Ƙ9u Tt&?9tJt$V:D$jt$$jP@L0z([Ðt&UWVSW>#:4t$H|$LeD$$1jjjjVFL0 uL$e3 ,[^_]ÐvHFLpXPjhED$ PjFLjpX0D$PVU&t?D$ D$ p(FLpdt UT$ Jt& U $jhNt$ jL 1f PjhH&UWVS=84t$Ll$HeD$$1FjjjjUEL0: u#L$e3 ,[^_]Ív'uHELpXDPjhaD$ PjELjpX0tyD$PUWt+D$ P@VW[D$ Wk $jhht$ j D$ !t& Pjhdt$ j 1Ut&UWVS;s74t$H|$LeD$$1jjjjVFL0 uT$e3,[^_]ÐvHFLpXpPjh}D$$Pj4FLjpX0bD$PVUvt?D$@,t4PFLpt U!Jt& U $jht$$j 1f Pjh&UWVSW:#68D$Pl$LD$eD$(1UY@ @ ET t- UY@l@@Tub UiY@t@TuMuHELpXPjhPj 1|$e3=,[^_]Í&uHELpXPjh뱍t&jjjjUEL0 ELjpX0D$VD$PUt$D$L$Q,Ot$^tt$ uct$Ut$D$ t$D$ v D$ RjhRj D$ t$RuHMLqXԢQjhQjS0vt$ QjhQj% Rt&uHMLqXXQjhɍt& PjhPj 1|t$ QjhCvUWVS7c3 1ɋt$e35k,[^_]ÍD$ U5L$hjjjjUEL0C XuHELpXDPjhYD$$PjELjpX0D$D$PUt$9l$t!D$ ptt$ #E*t D$@xD$ @xPt$ I ;T$Jx~a1t&T$9zx~L,B|4t$ EuӍ Pjhot$$j 1lt& t$N&$ PjhVPj^ $v$ t$ $jh`t$$j& $ PjheKt& Pjh\0 $ PjhLe PjhkFUWVS0c, t$ tw|$$FLNHPX tjQRPhPjhUj[FLjpX0t`t$(t$(VP!t( Wo [^_]f뎐& PjhUj f PjhUj 1UWVS/s+ t$ u [^_]É'vHFLpXPjhWjhFLjpX0t]t$(t$(VP~t U| [^_]Í& PjhWj ōv' PjhWj 1,'UWVS.s*,eD$1t$@|$Du!L$e3 ,[^_]Ð&vHFLpXPjhUjHFLjpX0vtmjD$PVQL${ƋL$ t&D$PW QG\t& PjhUj L$ ƍ PjhUj 1 (&UWVSw-C) t$ u [^_]É'vHFLpXPjhWj8FLjpX0ftMt$(VPt UM [^_]Í PjhWj f PjhWj 1<'UWVS,S( D$ 19uB'm9t2 utD$ Um9u΃D$$pXؤVPjhQPj [^_]ÍvUWVS+ã'LeD$<1l$`9$D$9t\ D$ t&69tF vtjjD$(Pjvu tRT$ 16$9uuX|$WPjhbt$j  L$ LD$`t$T$de=|$<1l$lD$1T$ D$hD$豿tUjVT$D$T$T$T$Pl$UBZYjjt$jVU T$t|$$!%v1<1D$l$|$t$vHFLpXPjhAUjY Pjhi PjhpUj* D$ Pjh%Uj T$L$ Pjh"Ujܞ 1]'WVSt$ptE1D$tDD$t wL~[^_Ðt&D$[^_ÍvvHFLpXPjhPj D$8 돐jt$t$t S1vUW VSÎLD$`t$l$tD$D$dD$ eD$<1D$hD$D$lD$4D$pD$8tPUjVT$D$D$u1 Rjh RjB D$'L$t"Ч Pjh> Pj) [ÍS[ftuPPtnVSØR FTFPt PFThvPj@hPj臚vX[^Ðt&VSW#PXu V4$F [^VSt$F, @@v$Cy4$;[^Ðt&SæD$ e L$ 1@8tjjT$Rp, sD$ e3u[/ UWVSrr> j t$8Vkt j t$8V G<WVot` w8u=t u,VWPPj@hiPjܘ [^_]Ít&D$ VRjhbRj褘 D$ [^_]Ðt&V!''UWVSU!e$1F t@t P7t*1$e3 ļ[^_]É'F hpl$7UF PT$P T$P$T$"P(T$&P,T$*P0T$.P4T$2P8T$6@<<$D$:F,@PD$PUv( U&SZ& t t[É' t$tǃ[Í PjjyPj 멍&UWVSã  PtfV9V P5t0V!u [^_]É' t$,t5t58Wt$(Pj#h\Pj  [^_]Ít& Wo5u t$,\5at$(WtyH& PjhQ1Pj菕 [^_]f1t$(PjhUPj[ [^_]Í PjhM떐t&VS1t$t0 V4{t*R{[^Ív'ҍUWVSqhD$ Y$D$9ʼnL$u_&E8m;,$tBu8 t$.9t7u3E8D$E8tE8m;,$uD$t[^_]ËE8ٍvD$ [^_]& uAtEVSèpƒt [^Í1Ðt&Ð&GWÍ&'WVSh40D$@eT$,1҅tDt@j P|$WD$8XZWV¾tAL$,e3 uH0[^_Í&| Pj@hPj 1뿍WPj@haUWVSà l$ |$$UP&u vvDt)Fj PWju [^_]É'@WUPj@hPj/ 1 [^_]à W볍ܪ Pj@hčUPj@h밍'SÖ jt$,t;Pdt4|pD$Rj@hRj蒑D$, @d[ UWVSU!jPtOuHdtxPPtE [^_];vHp9tbI8 9utEd [^_]Í PjhPjՐEd uvMu9u냉밍vUW VS^l$0{T$4tEYT$ PBT$ t[^_]Í&[^_]v'111 j?[^_]Ít&WVSt$ðVPft#<VPjhmPj诏 jVt<jVt Yt[^_ÍVPjhpPj8 럍v;tD$ D$(D$XD$ݨD$0h'T$L$ v, t$UL$QT$$Rt$0Pt$Hj@ht$Hj貄0;|$$lj*D$ F Ut$4FtLF P$t$@j jt$4\ D$ xKD$ `i t$<t)@Pt"n~9u 8m9t1E U8u1L$e3 ,[^_]Í&D$LFdtˋnXt Fh UJFD$ D$$D$D$(FY_P L$QPR,/FTWPPFXF\F`Fhp PuwF\VdF`~҉F\uPLWQPj@h.Pjjz Fd vP8FT0 PjhPj z r Pjh'Ѝ Pjh뽍 PjhPjy 1%8t&WVSt$PFXPv\pXPj@h;WjhyF\ P1҉V\uiF`v#PFXpXPj@hBWj.y 6t 1~`PFXpjt#FX@ FX[^_É' PjhHWjx fUWVSs$t$8jVZv虨%%D$ 9tN&D$4u uu#EPv PWv蚪tm;l$ u[^_]Íx PjhePjx 1[^_]Í- Pjh[ҐUWVSÓ$t$8jVZv蹧%%D$ 9tM&D$4u uu"uv8 PWv軩tm;l$ u[^_]Ðx Pj hPj!w 1[^_]Í Pj hvҐUWVSó(t$ jVWt8jVtV@ pwtd[^_Ív'̯VPjh~Pjt 1ˉ' PjhPjt 1뜍g Pj h멍&WVSxDeD$1|$,D$(pPWt9jjD$PV@M!T$ e3u5[^_Í&WPjhPjt 1nt&VSåt$F,x@tt@PR\V V$BRPQ4$נ[^ÐSzFT$ t#t_t$$Pj1R[fT$ WT$ u̍D$ RjhuRjs D$ 뼍v벉'UWVSót$4|$0t VL V8to tG P+ V t#G t pu G @h V|O(o tL$ VuڝL$ {Qt$Dt$Dt$DuX PjhVjq 1[^_]fg8{&G [^_]Ð&L$8o ttԋD$<3EtDD$<um w,VUPLPj@hXPj@qo 0T$@D$<҉EpmHt'Ut$LQ U=w  t$LKFHG pw,|t$PVPPj@hmPjp0fD$8 t$D{o vG pzt&G O PjhVjpG( p$t$8t&lt$HPjhhVjo fUWVSs$D$@t$ e$1o|G|O8D$L$ 9tO&j uV2YXjVt jw0t$ wXP< m;l$uu,$e3Ĝ[^_]Ð&G8 PdD$$PWyFPt ;~L#D$~LFP$Fdj@Fl$PUP[$u PİWUvPj@hPj7n0v' D$ RjhRjm D$ PjhPjm PjhPjm Pjh׋l$UP+ U觚gv'UWVS7(PjhZD$ Pjm ǃt PNǃt)RP觬]ǃt)$RPt_ǃt,t$8ǃ P貞ǃ% VFt_ VD$4u [^_]Ív t$bV,0v t$ԱD$,XZv,WYv,躱T$,$WPpt$(PjhPjaV,0 PjhPja 1\v'L$ URT$.T$L$ jD$@P t$@D$ hRT$(j<̢NjT$'D$ xG$W訞D$G,<$<$<$9 v,eXZv,W8Yt$L,$VPt$(PjhPjw`01/t& v, _t$VP@t$(PjhPj/`01t&U豏G,@@<$ PjhPj_ 1dZ PjhRj_t$>1g PjhfSzFD$t$4t$4t$4t$4t$4Pt$4Rjp(W,8[fS:t$(t$(t$(t$(D$(Pj*([Í'St$(t$(t$(t$(D$(Pj+([Í'D$L$@| A0D$ Q4A(Ív'UWVSST$0l$4B tM R*jj RPVj) tI[^_]Ít&9t'x p 9u퉵녍& D$ Rjh-Rj] D$ [^_]Ír Vd@UWVSwCT$0t$4B# tmBD$ |$ W) RP RPWj) [^_]É' z|$ u9tt$4px px  9u܉t$41& D$ Rjh@Rj]\ D$ [^_]Íz Wt&UWVSt$0l$4~9uZv'?9tJt$@WՃu鍓 D$ RjhLRj[ D$ [^_]Í&[^_]ÍvUWVSSt$0l$4~9uZv'?9tJt$@WՃu鍓 D$ RjhYRj6[ D$ [^_]Í&[^_]ÍvSD$Pt[ UWVSÓt$0l$4~9uZv'?9tJGt$@PՃu捓 D$ RjhkRjsZ D$ [^_]Ít&[^_]ÍvUWVS7t$0l$4~9uZv'?9tJGt$@PՃu捓 D$ RjhxRjY D$ [^_]Ít&[^_]ÍvD$@$Ð&D$`8Í&D$P4@0Ðt&D$T$L$ P0H4Í'D$@,Ð&SJD$P t r[Í&'VS վt[^Ð& t$dt݋@tփ PMƉ[^Ð&SfD$Pe[ S11f2L$t QY[ÐD$@(ffffUWVS#RԄ UnVW.9t"POVWP8jh7PjW WߘTt$(V‹D$8҉ [^_]Í& 0ьL$$4F9u PePRt$Vy$S jj=V$ jjJV$ jj:V jj9VKwt]QQWU[jj@Vwt WP]Pjj?V]$P jjAV8vhk81t$ D$pD$, Pjht$jS m tF}uԋut$V蔋_MPVym ut$ Ս$nxUPjh|$WjSvx$脁D$,XZt$*VD$(P_D$JoY]VPjhWjRX}~R$QD$D4'}jjVx vLa<D4ojjVxw|$,WU $jj$V_x$' jj%VJx$2 jjVoD$t$WvLajjVwtFXDuFXjjbVwuD$t FHjjVn p FTD$l$ D$$PjFP$e3 Ĭ[^_]Ít& vLM8D4b}Z jZvLm.D4go_Ķ P8jhbPjaK '0 Pjhk8Vj1K D$|$$t& PPu t$jhVjJ D$1 PPt&nPv P8jhPjJ WWfT8 PjhxVj_J D$)t& P8jhPj)J 떍t& Pjh8PjJ UU & 8 D$PjhVjI t& PjhdcfD$@Pt$j證*$ vh]9 jUt$P8jhPj,I t& PjhCt&UWVSñ(PvOQV@0T$ PR!4$$@0PW jjQVjx?sD$D$ Svt$P;p VЃh0Pt$o ? jt$ wV9u Pjh8PjG 1[^_]Ít&Ht$Pjh-8PjG 1[^_]à Vt@0Pt$躃 ~ jjPVJjD$n9l$tt$'fE tVP?t!m9l$[}VWuNjt$n[^_]Ðt&ܷ Pjh'fwP8jh PjFUv1v Uv $jhv'UWVSEL~D$l$$eD$<1$D$T$$Zt$D$8D$ T$(4jT$,T$0T$4%&@PW$Et* VЃu1L$M^]jW4MGd9ŋutJv'T$ u!LEGdZYT$RPwGd69ujWLt PKGht"D P8jhPj,A [^_]ÐjWuL'UWVSï$R08~ZYPPjhUj@0WP6st[^_]Ðt&D$ WRjhUjz@ D$ [^_]Ít&'UWVSCtjjjEtgo\G\D$ 9uMt&m;l$ t?juVWTu䍃 P8jhPj? 1[^_]É[^_]Í P8jhPj? 1UW1VS胩O)Rtt08 PjhUjS? u [^_]Ðt&0VPjhUh? [^_]Í&'UWVSñ D$jj&Pf$f<$莐{$ t$  jjt$`PhLD$%v} W\m f}$t͋U RT$uT$|/1Ƀu(~99ɉ8r8Rt$jh$Pj=j}$ W蚈>$uRjh,8Rjj= $[^_]Ít&1ɃHv $ R8jhRj&= $[^_]Ð&Sjjt$ShD$>&jjt$ _tqpuh vt`v tO>t⍃Ļ Pjh78Pj< 1[^_]Í Pjh̐t&.$vRjh=c P#u$ Rjh P8jh Pj; &UWVS赥ÁDjjDPg jjGVc jjFVc jjEVq^& UWPV- t]jjBVf jjCV-^PV1[^_]Ív'?D$ Rjh8Rj: D$ [^_]Í, P8jhPh:jWVt0$jjWV, [^_]fTD$ Rjh k Pjh8Pj!: 1Q& Pjh ΍'UWVSףã0D$jj P \@ D$ D$<uD$ @D$ D$ Pu8@ L$(QD$ @ D$T$jto2h t$uCEt$Ev udtGm u1t$r L$y|$sT$D$ D$ Rjh.8Rjp8 D$ S&1듍t&|t$Pjh8Vj58 Pjh)Vj8 1,[^_]Ãjht$$YctD$P tzD$ǀ<F D$ 8t&,[^_]Í~ PjhZD$\D$0R8jh#Rjt7 D$T D$ Rjh&'UWVS#:tAWPDPPDhD$(Pao j 6JqVjt$IEF\UPs?uEFh[^_]Ð&[^_]Ít& Pjh?8PjA6 1[^_]Ít&ļ PjhDΐt& P8jhIPj5 1_& D$ R8jhORj5 D$ )'VS藟cDu%jjj:FhtM[^f%u䍓 D$ R8jhdRj>5 D$ [^Ð P8jh]Pj5 1뒍v'UW0VSߞë09uZv'69tJVu썓 D$ R8jhqRj4 D$ [^_]Ív'[^_]ÍvVSY%t$jjKVRWjjRPj ‰tvjjLV_VH  ЈFHjhVb_VI ЈFIjjNVF_ jhVV8[^Ít& P8jh'Pj3 1[^Í&'UWVSe1e$1jjIUP[$rs9t$8RPĴPjhHVj3 DjjUUPPhV[k @ Vg_$cD!jjSUUPx|PhWk MD!8*D$|X PjjUVj_2 t$| V/n jjMU]^_jPN jhU]UH  ЈEHjj}UUXZPVj Dž2DžDžjjrU\$蠳 jjnU\$諳 jjtU\UH  ЈEHjjsUOT ,ƒ8Ɖ<$gjhUWSt@pt9v>uF8u8 WjhPj0 v uЃjj^U\UI  ЈEIjj(UYƉRP,$jj]U[$4$dE P  jjU_R@ P jjTUWjjbU2[$蚘 U,t& $ RjhT8Rj/ $$|e3 gČ[^_]É'PVpg Dž^jjpU{Z jjoUhZDt&jjbUCZt P8jhPh.j|t& PjhM8Pj. 1& $ Rjh& W'D!D$|WPDhD$P{fH'Pt$-`D$ $ĉL$bvt$ht$ [ttt$jjt$ kuˋ̉uĉ tt$[t8hV$Vgv t$[Ƚ P8jjpPj- t$|'=f8hWVP8jhPh, 1;L$ QPjlD$,%=`j8,PjhVhY,PjhVh=,D$ ,vT$ RPj8lu,,& Pjj[Vj+ t$|n Pjhsv'19e 0`D4Fu PPRt$$P8jjmPjN+0 PjhZv'WPjh`Vh+ƅD! zt&1'@8,PjhVh* Ed 0_ZYPPjhVh*Pjh!d 0_D4Fu PPRt$$P8jj`Pj*0t$|$&WVSòjj PCUu [^_RfjjV#UljuNt΍G8 PjhVj) Pjh@Vjr) 1[^_É'ttdt_t&'WVS|$w\\9u *f69t" v1t[^_Í&[1^_fUWVSǒÓl$0|$4uED$ 9u<^UWR`t4F tWP`t6;t$ t$nWU`u[^_]Í1[^_]Í&'WVS(|$ w9uW&69tJVv$vu獓 D$ R8jh7Rj' D$ [^_Í[^_ÍUWVS藑cD$0L$4@AD$00~q9tiUwSt'?9ut$GWD$88s>&t$(t$D_D$88=f|$ t$@BD$,0Pjh t$(M7D$ t$(57XZD$,0 PjhPj  1 PjhՃD$,0Pjh&UWVSusAol$0E@uP׋T$4ttD$48u1[^_]Ð&UtL uڍD% fL uƃL kTu[^_]Ít&D$4D$4P@O1G1 s'M 5. Pjh^PjQ 1&D$4@gكD$4@wP3E뽍M FUQ4D$t$0vWUD$(u v t^tZ9t͋t$ ЃD$t$Vr>D$*} t uiE7uEt$봃j6Uhj6U Pjh4Pj 1j6Ut&'UWVSpÁl$|$@T$wPA G twV atGnEGEUL$0F upD$4vu&[^_]Í U<FG Vo WW8FL$0F tD$0P FD$4tD$4p[^_]Ð&GnEG]뢍t&F땍&GVGBhv'jD$0W'd PjhBPj 1[^_]Ít&p '&jD$0WAv'jD$0WVM&C Pjhp0 Pjh$Z'UWVS1Cnj,D$D%D$ D$D$ƍD$F9D$HuE tFuרtFu͋EYuE d8uFuEf9FwD$~ tKVt$t$D$$aD$ ]D$,[^_]Í&Wt$t$D$$볍t&pVMf9NM D$DkD$LD$Pt$Lt$LD$$D$  PjhPj 1,[^_]Ív'Ef9FZ G t$(jhePh@ &UWVSlg 6u>uEuNL$ u L$ WL$u L$t `t3| UWVt$$t$$QRhP9L[^_]Ív'XŐ&VSGkgT$DD|$PP VPjhPR$[^Í&UWVSjßf;T$0D$@D$L$ v PR}T$ Wt$Tt$L 9 T$ D$@ PRWt$Tt$T8 Upp+L$@L Q҉Aj G ըv'EtxuG  !m uF tjW6FP[L [^_]à PG GuF <t$<RjhRPL 1[^_]Í&G NF Pw D$Dv'G V RPD$Dx늍vD$H0dPjhPj 1[^_]ÍV RPD$D*vD$@@F <t$<RjhRP.D$` @1[^_]ÍT$ US8T$F <ut$ PQRPjhPjG 01t$&wPjhPj UWVSga3]eD$x1$s+Ƌ~GT$RPjE7ID$%=wPjhUj wPjhUj qv' P,W4F:u P> PQRPjhVjg$PjhVjN 1L$le3 |[^_]Ã8DPjhPj  1뺍vD$\9F W3D$83T$< 닍k/G jwPjhUj VSi_5[t$tl V)uE@tF@t? P~Wu/ PjhPj vv V4[^ÍWVSD$^àZ|$phtv V(t98tvu[1^_Í&[^_fUWVS1^QZ D$ |$$hhu"vŃ U(t98tEu 1[^_]Í&MtT$ NrhE [^_]ËT$ Jh荶'UWVS]Yl$0U(tKx t [^_]Ív'8thu4F tT$ h~ 뿍v1븍8 Pjh`Pj} 딐&WVS|$T] Y whs'8t[ t$ ?%tvjpY4tzPVbXZwhVWGh[^_Ð&h PjhxPj 1[^_Ð& Pjh}ΐt& PjhPjVp21zUWVSW\#X(D$PT$T|$Dl$HD$ T$t$<]&tCPv;8 PjhPj 1[^_]Ð&t$L|D$4@,naRPUWY)ՉT$D$ t$@MAl$l$P WVPjjUj#,  4$D$ 1|$P||$@t$DVhϦT$` t$PWPT$`;D$TK 1t$@@ZYPPjhPj D$ ,$l$@U+t$ V -ƒv* 04F&&]t$@j@8u t$@P@<$RVPPjh Pjx01[^_]ÍvhRD$XD$LT$P7,ƋT$ 6Vt$Pt$ t$ t$PUWt$PXd uy1 UF[^_]É'D$PD$DPVt$<& f1PjhPj D$ $D$t&) 0$Xt$@ ?84FuT$ t$@><$1QT$ RPPjhPj 0 v PjhRj 1'UWSXÄT$D$$e$1W" ōD$ PD$ PWt\T$mEjjjjjt$djjPWU0DžtJL$|e3  [_]f D$ Rjh1Rj D$ 뺍t& u%PtNE뙍vjjjRt'Etr P`tBE@f\ PjhFPjq 뎍t& D$ Rjh>C Pjh;Pj) 1v'UWVSVRĀ$$eD$p1jVU;D$PVj,tV VPjhUjWƒL$le3 |[^_]Ðt&%u w̃ R!>4FtC P> PRVPjhPj 0 W~1vt&뵐&!VPjhUj 뺐 Pjh Pj 1"fSzUFQt$@[VSL$D$ QUQT$D$kL$ 3D%t$[^UWVSUP,D$DD$D$H(D$u(vu|$Dl$|$LED$t҃ut$([D$\m u>뿍vEt*uD$p '|$Lt5UPl$t|$LED$uu|$t맍&|$ ?|$8uIu 8u+ut&ыQ uPQ hv't$D}|$8tt$]tt&D$ @ @ED$ @ ht&D$D{@ED$Dh|$LDU 92|$RU 2|$)Ʌt֋BD$0|$)ȅD$@B량't$u 1|$@p0uv >uV<@ttRWHtrt&Bٍ& t$P<Zt$T0tt @9F}F,[^_]Ðt&D$ h Eft&T$D$D(Et&UWVSQcM,D$Hl$@t$L|$PD$$eD$1D$DɉD$ED$>Pt$ D$ ?t$PjhD$ Pj  D$D$ tg7u{T$R,RP[uč[t$Pjht$ j D$uD$t$t;t P!L$e3 &,[^_]Ít&7t$jh뇍D$z$D$P,PuID$U[t$Pjht$ j D$% 1Pjht$ j # 0 $4F9u 1PRPRt$PjhPj&0'UWVSNJ9D$ td%D$1v'tBuVt$UT$@D$FtυD$uǃŁuō&D$ ([^_]Í PjhPjS 1ҍUWVS'NI,|$Hl$@eD$1t$DG>j/V.u_EdT$ T$RW+PL$yA9T$e3,[^_]Ív<VPjhPjh 1뻐w8PPPjhōv Pjh믐t&84d4Pjh닐EdL$ t$WEL$ L$L$ju#D$(D$xVug T$B XZt$ EdPL$( PjhPjQ 1 L$ PjhPj$ L$r Pjh"Pj L$Gx&UWVSKÓG|$4uOtP[^_]É'w 1Pjh2Pj| [^_]Í& w D D$@pdPhU (t$4wUGghD$<07"D$0EGEGM Ejj t$<3 U  ЈE ,$7 D$XZUD$<0UD$ WD$<@dP{( PjhUjT Gw 8PjhMUj+wG^ Pjh;Pj 6't&UWVSIÃEt$4FFt.P PjhPj 1[^_]fD$0 xhWtFtA Wh8FL$0AhUvt [^_]Ít&o U$8vW< 뷍&D$0 xhWFT$0Bhx&Vt$< D$ RjhRje D$ ' Pjhv'o UD8 ` PjhuftDVSGïCztRQ [^Ðqd1t݃[^Ív1Ðt&UWVSGcCl$$eD$\1{D$@|$ jk$D%P0XZWvh5L$ DžtuVT$\e3ul[^_]'UWVSFóBl$$D%eT$\1҉D$ ‰D$@l$ jk$Q1L$L$y t#UPjhPji k$1V@u uIFPUwhyƋD$tD$pW||$\e3=ul[^_]ft$WV{t&'SEÖA t$jt$[Í'VSEeAt$j4t$txPVu [^Ít&PVpt؍ VPjhPj$ 1҃[^Í& Pjhˍ'UWVSDã@l$$D%e5t$\1D$ ‰D$@t$ jk$Q1L$L$y t#VPjhPjY k$DPti1@uk$DPVwh ƋD$tD$pWX|$\e3=ubl[^_]ÍLD$VRjhRjD$( Pct&k$t$WTb UWVSWC#? t$4|$8WjVWjV6 WjVxtqD$WjVu |$tT DP RPhWC Wv[^_]Ðu DPP PhW y PjhPj] 1띍1WjVD$넍5t& Pjh뢍'UWVSAó=l$$D%eT$\1҉D$ ‰D$@l$ jk$Q1L$L$y t#UPjhPji k$1V@u uIFPUwhi ƋD$tD$pW||$\e3=ul[^_]ft$WV{t&'UWVS@Ó<l$$D%eT$\1҉D$ ‰D$@|$ jk$Q1L$L$y t#WPjhPjI k$11if@u fŀuNARPWvhNjD$tD$pVZt$\e35u l[^_]Í&t$VQRfUWVS?s;l$$D%eT$\1҉D$ ‰D$@l$ jk$Q1L$L$y t#UPjhPj) k$F@u uXFv$Uwh'D$t\$D$pW8D$D$\e3ul[^_]Ít&t$WV1UWVS>S:l$$D%eT$\1҉D$ ‰`D$@l$ jk$Q1L$薿L$y t#4UPjhPj  k$1V@u uIFPUwh ƋD$tD$pW|$\e3=ul[^_]ft$WVt&'UWVSg=39$e$1W t G G 9u7VpG WG 2ʉՅtpt&FtqG <6UjhYRP 1ɋvu…u%g 1$e3 Ĭ[^_]G G Љ $ D$(D$Vj@L$pL$QQP[ 1ɅtD$!ʁ t€ $TҋT$t$ +D$Ή$$ $!ʁ t€t$ u$Һ@$L$ )‹ $ v RT$PRQT$( L$ !jj 7ƒ5 j@bFp`%t$<$('WVEppPtP;<$tq@jW7MuƋE pp&E@p Pjh6Pj xt Pjh+ːUWVSR:6 |$ Wd9Ћ(u 0̓PWLM҉!֋Wd9uփ [^_]ffVS9õ5 jt$U t P [^Ð& Pj jPj 1ύ'VSy9E5t$t8j t$ tSpPt$ [^Ðt& Pjj&Pj$ 1[^É' Pjj)VS8õ4t$t8j t$J tSpPt$ S [^Ðt& Pjj&Pj 1[^É' Pjj)UWVSW8#4 D$ l$$09>u9t&9|$ t+ǃvUu V9|$ uՃ [^_]Ít&'UWVS7ó3 |$ l$$79u.69t"vUvu [^_]f 1[^_]ÍWVSt$7P3|$t6VW|uVWt$[^_Í& PjjAPj4 1[^_É'UWVS72(l$@t$69t2vUFtD$(t!FT$( [^_]Ð1 [^_]ø UWVS5ó1|$,l$0W`Ɖ,$V9t 1[^_]Ðt&79u(&69tvUuƐt& [^_]fUWVSe511(l$@T$U PU|$PDt$$PVjhPj0f뜉'%=1|'D$1P&j/RPu1Ut#&j/RPu99tht$$D$P7Ƅ$ hU$D$ P$Ƅ$ $$t!:$t t&:u uD$,D$$D$j/V!ZYj/WD$tt$t$jrYt$t$jSD$<%=$m%=MUt$Ѓ'4PVD$8PVD$vrPjD$RIZ 0P>PDt$,PVjh Pj0D$/H/|&'UWVS70, t$$|$(~ t$,G F F$FF(FVF8$|$,҃V,WV  [^_]ÍvD$,VjNUjhQ@jRUj 7 t$,G F F$FF(FVF8$?t&jhd(j d t$(dG F F$FF(FVBF8$7i PjjmVPjN 1 PjjOUj. 1i Pjj_븍 PVjjcPjVd1$ PjjSUjV1i PjjhGi PjjXUjV<$1fUWVSU-!)T$4|$0 u.Uh[^_]Í&T$WlMƋT$Udj dD$_.9um9WuIu⍃WPVjhAPjr v'T$jhd|ƋT$T$I FF F$FF(VF8$T$~V D$VWlL/UdD$VWhXD$ RVjhRji D$[^_]Ív'DHDPlljHLUdQ&P PVjh~Pj 1&D$ xVHʉL$ CL$ PQWPjhLhjjjU D$] PVjhrPj( 1WPjhOVPj t$VH9PQWPVjhLPj軿t$V>$D$ RVjhwRj}VdD$3 V Pjh<VjCtPjhVj* 1V Pjj}Vj PjhtVj 1UWVS(Ñ$eD$|1$J@`tIVPjhvVPji |$|e3=Č[^_]Ðt&r$r uÍ D$ Rjh{VRj D$ 뜐t&z j$T$ YPT$ T$ UWjbVPT$ T$ PmT$ D$ PVjPD$,%=!$+ D$ Rjhs%' V PjhWj VPjhbWj 1v'|$ WVj^ 0P> PDVPjh[VPj菼01$t& 0P>PDVPjhi뻐&VPjhnĶt&UWVS&!D$||D$L$(9t& t$,D$t,PQ\V Pjh(VjUt$YEPt$4jh;Vj, m;l$tPt$luu݃VVPjh?Vj m;l$uv'> l$uǍVt$$t$0jhPj f ǃxj7t&{ 01PDt$$WPVjhPj诶0*& WW t$ D$$l$, t$y5V vt$$PVjhPj- 딐&4t$$PVjhPj u`HD$ D$ t$RfSvpt[fD$p PVjhPjzt$>XZt$t$ [Í&ixÍ&'D$iu ǁxfUWVSóĀ$eD$p1D$PWjD$%=@tI1WPjhEVPh艴 T$le3|[^_]Ív WY] Pd~tU@WPX|ZUP뙍& 0i P WPjh?RO PVjhJPjѳ CTt&UWVSsĀ$eD$p1D$PWjD$%=tIHWPjh_VPhI T$le3|[^_]Ív WY] Pd>tU@WPXZUPD뙍&s 0) P WPjhYRl PVjhdPj葲 Ct&WVD$ T$$|$(D$T$ t PDt$$PVjhD$8PjEU 0 0A|$ 4F?u P> PRt$$PVjhD$8Pj虨EU 0Ɖ % RD$$D$(D$$T$(Pt$t$8jht$(h? &EU t&|$t$ VPjhWj 1$e3=uĬ[^_]Í UUt&UWVSs $$e$1VhE,D$ D$PVjw\L$@D$<3M 3E tCVhc+PjT$2XZVhtE,tM UY^PPVjhPjŦ T$|e3Č[^_]Ít&UWu1΍D$ D$PVjA' 0P> PDVPVjhPj,01bf1Vh16Vhydt&WVSt$À 7t& P1X61Vt!G,uWRu u[^_Ív WZYPPVjhPjP [^_fffUWVS% p>uwF8 FF F$P4$ZYPPjhNWjդ F,t  pX64$ [^_]Ít&; 04F4$18t9 V ,$RWPPjhHWjH0)뿐&UWVS 80D$@WG w=v+RPPjjQPjʣ 1,[^_]jwwU!Ѓ_W $҉u3t&+D$PVUy2 tuQG T$@t΃+D$PVUx[$W Ƌ $9wˉL$ 19T$ ,[^_]Ít&4$ t$PZWŋGOT$$D$ D$@W ux-T$L$ 7qZYUt$ t$ T$,L$0QR1ɋT$QRVP|PjjiPh膢W @V6&¸m,[^_]à 7ZYPPPjjFj 0WŋGT$D$Y7,$t$t$PPjjXPj01'D$ $W D$ VS ÃPh PvPjhPh蒡$[^ÍSj 6PZYPPjh]PjL(1[Ðt&UWVS' $$e L$|1Ʌ)@, PXZjWLVhrPzV  VUv6WPjh9Rj{ L$|e3 :Č[^_]Í& P ǍD$ PWjUt^ 0?4Fu P> PRWPjhPj01e&T$LD$H VRPWPjhPj蝟 + 0?4Fu PRPRWPjh*]t& 0?4Fu P5PRWD$(Pjh/RT$4j$U  64?4FT$u PPQWt$(jh1Rj蜞01f+ 0?4FtC PPRWPjh7RT$4jF0T$v'賘vVS t$F,u&jhavx [^Í& vEy[^ÍvVSut$FxMV~҉Vt[^É'F@ P2uى&[^Ív[^VS)t$FxUF~Fu[^f VZYP PjhkPj؜ 뿍v[^Dt&UWVSs$$eD$|1D$D$Fxg|$F,FJ|$? VY_PTPjhWjF V/?$V7$F,t@u F, t@uhUQL$FL$ $V,ЃF|$F,h‰F,|$V,@@F8P9P|F,c HPT$L$ VL$T$ $RUPmPjhWj跚0|$|e3=Č[^_]Ív|$tkFV,#L$D$ PvjL$xT$@D$<3V 3F QPjhWjV1Nt&V,t&$F,@hUQL$FL$ f,ߍVQL$PjhWj肙 L$ vV,@t&Sqt&PXfH2ҍv' VYZPPjhWj $L$uY| 02L$4F9u PRPRQPjhWj藘01t&# 0PRPL$DQPjhWjV01t&jjjvF0V4t& PjhWj 1V萒t&Sæjjjt$[Í'Svjjjt$[Í'UWVSwCu_ Pjj3t$,j6|$0 t&9uD$$e3=Ĝ[^_]ÍVPh$D$,PBH'Pt$,D$(pT$<1D$$t&t$jPRT$]|$< T$?1퐃<* t*T$j jPD$=T$vOj RT$bT$td$D$PRT$t$0jjTt$,h T$L$u1|,T$ DH |$%uT$ L,BT$ DH |$,uT$ L,@T$ DH D|$1uT$ L,DT$ DH |$:uT$ PL,BT$ DH |$A uT$ L,IT$ DH ~|$Ou(T$ L,>T$ DH t D$|$LT$, 1t${T$,D$ ՉD$f!%tꩀu);L$ Qt$V|$L$D|$DD$(p>T$v~ Wķv n N;D$ whPt$W*uSD$|$T$ly'>D$(XI'v >L Pjht$,jt$$ t$转1dWPjht$,jVt$$読t޸ 0蔴4F$u PPRt$8Pjht$ PRWPjh1Pj(x0軱tN Pk4F$u P> PRWPjhPjw0FV |$Wt& Pjh1Pjw &H'PW訩Pj@$V(D$(PD$(PPV/D$$L$( D$(t$ T$ 0 ƉD$ t$ T$ t$V U'!W 0 4F$u PPRWPjhPjkv0v 0豫4F$u PPRWPjh PjhkWPjhThVW1PjhPju [ 04F$u PPRWPjh@ 0ɪ4F$u 1PPRWPjhPj%u0Mo&UW1VS,D$Dt$@e=|$1D$ @D$|$NjF Չ11 tKN11 t;N11 t+N11 tN11 t+1 &t$e35uS,[^_]ÍD$Pt$Vt|$1ҁ11 n&'UWVSße$1$,D$ >t8uH PjhPjys 1$e3T[^_]Ðt&ʍ$D$u uVL$L$L$D$0D$ Pt$j&蕬D$ L$: P9P> PDt$PjhPjr013& Pjhv' Pjhv'H'Pt$ 荤Pj@$D$P D$ P-Pt$t$t$PjhVhq W$D$ 9t&L$D$$PUWL$t$(t$(VD$Bt$ t$jrD$  P莦P> PDt$PjhP&T$ T$UT$RVPPjhVjp0t&c 0PPDt$PjhVjp0* 0ڥPPDt$PjhVjXp0 0补PPDt$Pjhc Pjhj&UWVSót$4|$@l$DUWjVD$D u 1[^_]Í& H2UWj VD$D t˃ AUWjVD$D  [^_]ÍT$D$#T$P>&'T$D$q#T$a&'T$D$A#T$w&'T$D$#oT$&'T$D$"?T$~fffffffWVSHt$,|$0eD$1Vt G |$WjjjVe tNjPW輜ǃ VtMT$ e3[^_Ív Pujj#Pjm 뫍v' Pujj)Pjdm 뒍& PujjPj7m bgfffffUWVStM U9HhpeU1/>@H% 1ǖ ‹~@9 uۋE9E9E9 11tvE PPjjW训 Ue3e[^_]Ð1Nj8X uf1Nj@h8 u戕裕‹ & H(DžDž1ɿu9Dž1t&vBSt vE P߭ݝ݅߭rݝ݅$WPjjjW01v'DždDž 1ɿv1(r9Ћ1RP`9r'vDžf9sۃvԐ  #뎉'؃<t&؃<At&[ PjhPjQh 1 t/ 뮾sbvVS1ÓL$ 9 tu-[^Í[D^Í'VS1wCL$ 9 tu0[^Ð[D^ÍUWVS- l$ 8u [^_]Ít&1UW讒tWu䍳 8t4UPjjUPjf 1뎍v'uD$CTÉ'VSY% t$VFLp>t[^ÐFH[^Í&T$L$ D$D$ T$L$ T$L$ D$D$ T$L$ T$L$ D$D$ T$L$ UWVSS|$eD$l1j@|$0WVR|$(u T$()ЋVxD$ FtL$T$D$F|T$ D$V4$D$(sZYWT$(1Rt$Ut$T$$L$(WՃUQRt$@t$@L$LQPXPjhPjdPD$le3u1|[^_]Ðt& PjhPjid ^ UWVS7|$0D$L$ 9uit&JQLqHrXDRt$jh-VjcUJBȉƒRQRjh0Vjc m;l$tYM UʃRQWjh'VjycU s Rjh2VjRc m;l$u Pjh5Vj'c [^_]Ít& Pjh#Vjb &UWVSã$$D$ eD$|1j@D$@D$,PUOuP4PjhKVj`bU_ZPNPjhLVj8b Etu U uULgWRPjhOVjaD$0D$8E|T$4T$<D$(D$0T$,T$4D$0T$4 9T$ E1D$+D$T$ T$D$(T$,t$t$t$,T$NjD$ t$0t$0t$,r PWPjh]Vj'a +t Et PjhjVj` D$ xH1RPt$,ZYPPjhqVj` PjhuVj`WPjhvVjs`5PjhwVjT` D$$|$8uPNPjhxVj&`PjhyVj ` D$|e3Č[^_]Í PjhGPj_ 뺍t&PPjhsVj_ WPjh_Vjv_ JD$9D$T$+T$L$L$ D$T$(T$L$,D$T$ t&u)PPjhhVj^ YUWVSã\t$xeD$L1j@|$WVK VZYPlPjhUj^ |$uNWPjhUjY^ FtugPPjhUj*^+RPPjhUj^PjhUj] 1L$Le3 u2\[^_]Í PjhPj] /X UWVSwCteD$d1$jjD$HPjVFL0~ t D$8F`~XVpD$FtT$,D$$FlD$(GD$ NP1D$D$1D$T$ 11ҋ~LoXt$t$ t$t$,t$4t$@t$@RQ D$,L$0QPUvHUDPPjhPj\PD$\e3l[^_]Í&D$H~XD$D$DD$F`D$tRFtVpD$ D$$FlT$,D$(FP1T$@%|$L|$l$ ЃFtVpD$ D$$FlT$,D$(eVD$ &UWVSs$$D$e$1j@F l$pUPHjjD$TD$XZVD$p͒ UP_PjhWj2ZVih PjhWjZL$8 9hD$$T$  t$|$|$(l$$A퍃PFDpHPjht$,jY FH9D$ptaD$ 4t퍋tD$ @LQNDqHpXDPt$D$D$NE<ptPjh?Wj/Xvpvlt$MZYPPjhCWjXvtPjhDWjW D$$E81RPt$ZYP.PjhKWjW FQ PZYPbPjhUWjxWvX]ZP|Pjh[WjTWF`  Pjh_Wj$W D$ MD$d9F`tPPjhdWjV FPt-FdfPPt&vhPjhiWjV t$Xt$XPjhnWjV PjhpWjV &|$DFQZD$ D$vD$ [^_Í& PjjeWj> 1fffffWVD$|$pu(&tWPu^_Ív^_Ðt&VD$pt &Pt P҃u^Ív'WVS|$GuGwt PPuw V)k<$!k[^_Ív'PPjj#Pj= 뗍&'WVS舧TD$ |$$pt$P tWP҃tu[^_Í D$ Rjj3Rj(= D$ [^_Ív'UWVSâ D$$D$ jHU4VxFPt$,WGj D7jPUjb~[ F~\F\F [FPjj]UjR< [^_]Ðt& PjjFPj$< 1Аt& PjjIUj< 1뮍v PjjQUj;Wi1fWVS|$败ÀGwt#P<P jh=Pj; vmX6hF$P4$h<$h[^_Í&'VS9D$pP jj4Pj ;v%y$م[^ÍvUWVSó(D$ujvD$pjrjv荎v uŋt$ vni6PjhW1j 6 t&o 0Qk P) 6 PjjqVj5 PjjrVj5 ft& 6PjjfWj56f*o Pj4F:u P" PQRPjjhWj.50 1P jjyPj5 t$s?vvPjjTWj4 m& jXZ6PjhWj4 T$taD$3 P jjvPjd4 H6W PjjCWj=4 .'UWVSљEDž eE1$n xwZlZ~Jh7P jhPj{3$ zv'Pjf,EP7jTsM|3M3E u($3M3E  V胰jj7蒭u Pjhj2 &f7Pjh Pj2 Ue3Qe[^_]ÍDžЍt&<7Pjh릍v P jhPj!2 됍t&k 0ig4F: P= PQRPjhj10Dž VG  P<'k 0f4F:t1 P> PQRPjhg@t&ǐ&M t#G 9tt P I REh#)čD$ RC PjjQrPbj1jPcJ jjPbG me jjPbXZĮt0 Pjhj/ Dž-7fDžci 0ePh 7Pjhj/0(i tuDž Pd4F?u PPRPjhK)UWVSӔ$ $D$ $D$e$1hNVjpoD$ EWhEyD$ EEt P` hZEhaVjpOD$ Puj]nuD$lE D_ Got^G^G$fG PjhqVj- T$|e3Č[^_]Ð& Pjj+Vj- Pjh]Vj- uZEt P_ UZ1vv' PjhOVj7- 1It& PjhVVj- y&T PjhbVj, Qj'fffffVS蹖ÅD$p@t#P P6 jhPj, 6V[^ UWVSW#D$0xD$4091D$ &vw*[xOTu,69t$4D$ uu>[^_]Í|$ uD$ t$1'8@ uЉT$Pt$eD$(t$$|$7F]GL$iVD$  arD$ !Lz<[<{M<(u)Rt$gi PD$LaT$ D8D$v SVD$ @D$ aOD$ Lz<[Z]at& Pjj+6 WjN) vPjhWj/) t$`S UjhWj ) t$ ;S1,[^_]Í PjjPst&} Pjji6 Wj( j 6 UjjIWjt( !t$ t$ t$6&XF- t$|RXZjt$ _im FtmFD$F P6 jhPj' ,[^_]Í Pjjr 6 UjjbWj' 1D$ Pjjx Pjh6 Pj_' P P6 jhPj8' 18 Pjh뮍 6 UjhWj& ffVSِåD$p@t#P P jhPj& 6P[^ UWVSuA D$$e$ 1RgǍ~RD$ W>ex. D$PUt$h$Vw^ VPh$D$PN^;D$0Pt$jen$ H'Pt$WD$t$j@$VNSD$(PD$(P PV,bL$$t$(1҃ ȁ%D$( D$4 ȋL$( Ɖt$ щL$ t$NSD$T$3D$j L$$1ƃ?._lL$T$4NPL$HFJP=.RxH Whc*t& WeuQ$ e3  [^_]Í, Ut$Pjh Pj# t&] 0AY}4FtZ PPRVP jhPj#0[t&, Ut$Pjhst&랍P PjhVjQ# t$Q\ 0X$ PP4FPt$ PjhVj"0v $ PD$(7Z\ 0X>4Fu PPRVP jhPjs"01(\ 0W4F$u PPRt$ P jhPj"0[ 0^W$te PP4FPt$ P jhPj!0 t$PjhVj! > PP뙃 PP]&'UWVS7 D$ hE tt1 [^_]ÍU uxtyE D$$P @׉1ƃ?Ltvyq11 t u t$0hpZYP P jhPj  1 [^_]Ít&E [^_]Í&UWVSW#e$|1K8$ l$|1D$ Ǎ}D$D$D$ Wt$t$hUpX xt$ Uj `tc$u1$|e3 Č[^_]Í&x P jh,Pj 1봍v'L$ ht P[hPv`$8UW\T$BtnrB jW9`Ƌ$x FVTsF P jhEPj t&+ P jh9Pj WH P jh4Pj^ 1~ P jh>Pj5 fffffVS Ճt$Ft P P~jj0Pj VK[^ÍS躇Æ蜡u[Íjt$ :t:yփ t$ 2mZYPPPjj&~Pjf 1[Ít& t$ lZYP,Pjj ȍWVS~j9Wj^tFt| F$|FD$FPjjCWj [^_Ð& Pjj:Wj 1fVS艆Ut$Ft#PPjhPje VI[^ÍvUWVS30D$e$01GND$1҃ȋN T$VD$D$0 N ʉT$4t$Wdu-1틼$0e3=0[^_]Ív'D$4PVt$ Y V k_]T$<ƋD$8 1҉D$8 W|$<Pt$(Ph$ WS ih$UWLƄj/UWdPPVPjhPj  Wt$(Ph$WR D$@PWjZD$L%=@WPjhPj* Wft$0t$0Pjh1Pj $& ViZYj/PVhxxv' Pjh놐t& WZ$Ƅ$D$D$& VGXtHx.N$hhPt$(RD$ VWu V/ZDD$ $Pt$(Ph$ W Q  H'PWJ;PD$j@$VSFT$ RFbD$,PD$,PPVUVPjji Vj  WjhVj !t&P.xyt& VXD$t&;Q 0L4F$u PPRWPjhPjO0c PjhVj( S Pjj$Vj PjhP 0?L$ F PP4FPWPjjWPj0J PjjaiD$@ ;D$(#Rt$4P25O 0K4F$u PPRWPjjwPj 07O 0SK4F$ u PPRWPjj9Vj0k Pjj4Vj G PP( Pjj?č Pjj=N 0J4F$ u PPRWPjjMVj0 WjjfVj T$wN D$0)JT$$ T$ PPQWQL$4jjRVj$T$$RBL$fL$ D$0IL$$ t8 PP4FPWQjjWVj!04F` PPƍS}æyD$T$@t[à t$ dcZYP8PjhPj 1҃[É'WVSh}4y>8thhWjUtyT F}FD$F*PjhWj [^_Ð&\ PjhPj 1[^_Ð& PjhWj 1VS|ext$Ft PDPPjj=Pjx V?[^ÍUWVSG|x8eD$(1t$PD$LhVa4$规D$PVpuWWPjj"P1Pj VtƒL$e3 ,[^_]Ít&蛘;T$rw{;D$wuVU>tf1WPPjj-Pjg z&mD$ WRjjPRj7 D$ ^vWPjj't& l$ Rjj5 &WVSzävPjFWjRtF FFD$F0PjjPWj [^_Ð& PjjGWjj 1fVSIzvt$Ft PPjj%Pj( V\=[^ÍUW1VSyut$0D$,hV_VVlt [^_]Ít&WVPPjjPj [^_] WVShy4uj.WjQtF4 FFD$F4Pjj8Wj! [^_Ð& Pjj/Wj 1fUWVSxßtR4FY_x WV8ItbT$ Qt) UPPWVG x [^_]Ðt&Zύ Pjj]{Pjd 1ȍb PjjWۍ'VS)xst$$t/ pW;$@@@ [^Í'D$T$$ UWVSwsst$,VdXZj6Nlj$tj@D$$8u [^_]Ív t$0FGtZ$L$(HL$4H t$8VQ [^_]Ít& 1P{jj/Pj  눐t& f1P{jj9Pj  \UWVSv~rt$,vX-uFF0N4u<$:t>Rt7BuL $pyMujf [^_]ÍN4F0 [^_]Ð&$ N0N4P{jhPj  럍&j$pFuvE8mT{vvXPjhUj P0@jt4 $r rPrV贫 t+N0N4 PjjiUjE  vXPjhUj&  &'UWVStpt$$|$(W$pV膰 W(pV1[!^_]Ít&'Stfpt$t$$[ VSit5pt$(t! p7(@[^Ít&'D$T$( UWVSsot$,VtXZj6Klj(tZ@D$$8u [^_]Ív t$0 CGtRt$0Ve [^_]Ð& 1P{jhPj_  땍v' f1P{jhPj.  aWVSsne$1$0$0(p~RPht$(V@A xy V9u$$ e3u{[^_Ð&+B 0=P" PDVP{jhPj\0룍& 1P{jhPj/ sfWVSrm D$0T$8|$4D$e L$1ɉT$P0@ D$T$T$T$L$ P QPR,tt@V9tVPjPWVRt|$e3=uq [^_Ð& P{jh4Pja F @ VP01먍 P{jh.Pj% 1'UWVSpl4D$Ht$LL$D$D$ D$eD$$1FXD$BP QPR,+PV_]PvhDF\~|F|D$9ndv?;|$ndtuFFd@ H VwPQ uӉD$nd w豌ZYPxP{jhePj L$T$e3@,[^_]à V'D$Hu| Vt 벐t&D$ Pjhy{Pj L$끍t&4 PjhP{Pji 1T&nwjvXt$*tY P$ytA W$X8D$ PjhlOX PjhZe P{jhsPj CvUWVSncjt$$t$,t$,Vl9tB@Tt|t&JATuo9u UآtAP(uXPjh{1Pj U W [^_]ÍvjUVԐt&D$,u uXPjh랍v'uXP{jhPh UC낍 P{jhPjc 1N'UWVS7mi($<$@e$1W(p~RPhl$(Un; x7$8UWV8$ e3u;[^_]Ív'h P{jhPj 1%t&UWVSwlCh@D$TT$X|$\D$(e5t$01D$$T$,7wPP{jhD$Pj/D$@D$4D$8F L$P QPR, @ D$ P;n9,$ D$ &t&MItUWVуtm9,$t?EUWVPủD$ t$jht$jw mD$9,$uV $ R VR0$|$,e3=<[^_]É'D$ t$jh뚍t& Pjht$jF @ VP01떐& Pjht$j 1h1K>&'UWVSjQf(e$1P0@j{ vX(p~RPhl$(U8 x0VWU$ e3 uh[^_]Í&  P{jhPj 1븍v' P{jhPj 15t&WVS|$iPe( thBta4u& (pk@ut[^_Í P{jhPj$ [^_Ív\ P{jhPh [^_Ð&j(p9u^88atJwXP{jhPjv &'VSIhdt$vXĝt[^à VRu Vvƒ[^É'jhvX6uɍ P{jhPj 륍t&UWVSgsc$0e$ 1(@ V/R vX(p~RPh|$(W5  j( WvX6_@9F U<$ WO V Vu5 Pjh  Pjh{Pj $ e3[^_]Í&$ Pjh붐t& P{jh Pj! V' P{jhPj 'G8PF8P U<$N. U&fffSzeFaD$pj C8[É'VSGeaHPjjgPj5$[^É'UWVSe`8D$Tt$L|$Pl$XD$eD$(1v(1҅VL$v' 9uDvQD;Ut$ jvu& tEVЉh&vj 07~vW:vj 7|$e3=u,[^_]Ðt&1ҍL$X&WVScô_ V)uǃ[^_Íc3 01/ZYPPjjRPja1 ǃf7[^_ÍUWVSSc_PxPj j{Uj<R7-t& [^_]Ít& Pjj~Uj 1׍vVSbå^t$ FP;V w)V FPVVD[^ÍV F-t FÍt& D$ RjhRjm D$ 밍t&D$@P~PÍ&D$PJ҉HtÐt&D$PPÐVSa] t$Ft$$t$$jjV )RFP^2 x FP;V vuD$,hPU} PWUT X D$ Rjhm& D$ RjhaPPU'a D$ Rjhf D$ Rjhc D$ RjhC Wjhv' Wjhv' Wjhv'PPU D$ Rjhyt& WjhAv' D$ Rjhkc D$ RjhuCыUEr҉uQUv D$ Rjhr D$ Rjh Wjhi D$ Rjh Wjh 9EJ D$ RjhXL$ "L$  WjhTvWVS4LH Pt.wHPVktD[^_x& PjhSPj 1[^_Ð& PjhT΍'UWVS}K\G8UjeE1<$EPIPPV WPVjPVz_ V+ u!)čD$uԃP P+PV!& VRPPR~R=-RPRPV  WP>uPV . ERjhPRj&Eԃ Me3 e[^_]Ð& ERjhO붍v' ERjhR떍v' ERjhQs& ERjhYS& ERjh]3& ERjhZ& ERjh^fUWVSIDdD$xT$ D$$eD$T1WhPSE h ED$x||D$9de1L$L$, $~t&t$uIj@uj@PD$t$qtjVT$Rui?;|$D$OL$HL$Pt$j t$ `] Wjhf WjhVj WjhVj1 Et PEEt PE|$Le3=\[^_]Í&E$tT$~D$pXPU_EE~T$Eu1 Pjh1Pj "& UT$/ Pjh뤍t& Pjh덐t& Wjhf Wjhkv' Pjh:v' Wjh+v' PjhPj W Ut^D$ TVtjUEJ҉M<WU1U$z Pjhd Wjh^jPU]RE~|$E9ut&?9tR wtWfuڍ WjhVj WjhD$9uY?9tS wuWuڍ Wjh PjhGEPUtpTWUJh Wjh8T$s Pjh WjhE2t&'SjC6? Ĥt$Pt$ [Ð&UWVS7C?x$$eD$h1$U|VPUK@E~EW0Nl$1D$ WqHpHPt$  D$ Rjh>v@@j@L$ QL$P.sL$QD$poU0J96> QMlL9q Pt$ t$ U09l$EPUkPU6.t& D$ RjhRj- D$t$\e35Zl[^_]Ðt&1ލt&J9> Qp@pHt$ t$ % 1 D$ Rjh1u D$ Rjh[t&  WjhVja Wjh&VjK 1Ft& D$ RjhGE< Pjh8Pj 1 D$ Rjh*F Gt&WVS?T;txhWj(2D$ Ft$ T$ F$F$FF u# VZ[^_Ð 끉' vÍ PjhWj 1[^_Í&'WVS>d:h1Wj(>@ h5WhGF4 Ft$ T$ FTF$Ft8FVxD$ V8[^_Í&J v  $jhAW1j 뭍\ Pjh6W1j 뇐& Pjh2Wjg 1[^_Í&'S:=9 t$Pt$}[Ð&WVS=8|$(D$eD$1D$PWtE t$tx t$T$ e3[^_Í&wXPjhWVj~ PjhXVje 1럍wXPjh\Vj6t$j $jh^fS;7t?t,t! PjjjPj 1[ÍvD[Í'UWVS;S7,D$Hl$@|$DmmPD$XD$ PD$XD$ P_7N  D$l$ D$t&NV D$ !! tߋD$H!!T$ ;FuɋtËT$u$Pt$ t$ _Pt$ t$ t$ ^NVD$ r&l$ Pt$ t$ ^t> t7D$ RjhRh D$ ,[^_]1,[^_]Í PjjyPj 1,[^_]Í'UWVS9Ã5D$4l$8$2ED$D$T$4T$ ulv'$@u<$v'GtfVPuO T$ L$|$4tlm Et PjhPj 1[^_]f|$4t!D$ t.uPjh뾍vu&m L$|D$0L$ L$ H[^_]Í PjhPjU 1fffffffD$@ P@fD$@ P@  Ít&'VL$ D$|P 9t!2P9r@u&P9r@t9u1^Í^É'WVD$ H D$P 1:99t^_Ðt&qy3r3z uq A3r 3B ҍv'D$@ ÍD$P@Ðt&S:73D$0[ÐUWVS72D$4l$0p  UsǍjjPV T$ L$$t]tYjjPVD$T$ jPV Pt$ t$ t$t$WUm [^_]Ív1[^_]ÍUWVSW6#2D$$e $1ɍJ($L$ tJL JHudB(R,D$T$T$D$ u|$ G G*>D$ ua$e356ļ[^_]Ív'jDJ,z@1l$L$J(|$1|$ tB@D$ |t& D$4PhŋL$,D$$T$(AQRP1>  V PVU= u L<(DH u{{tv VPj h)Pj jD$$@PwJt jjRRPW 1 Pjh롐t&D$ *v'VSy4E0D$$p v@t vo 6@u 6B[^Ív 6.t 0h4F:u P" PQRPjhFt&k 0!V4F:u P" PQRPjh)Pj01[^ÍUWVSW3#/ D$(l$$p MtX )uuXPjhWj#v( vA [^_]ÃPuuX)Pj hUjl6vPj hUj6vt4 0Ph 6vPjhUjn0 [^_]ÐCvPj hWjD  0V4F:u P" PQRPjhW1j0 [^_]É'UWVS1Ó-0$L$He $ 1ɋx PV$L,t9/u(fՃ W<$9UuD$0p4nFD$ 9ŋ}u .&σ UU,$9|$ uD$0p4 V t$<,[^_]É'VS)  t$j4t$tZVPVPV P VPVPVPVPV P V$P$V(P(V,P,V0P0[^Ð& P)jhPj衦 1̍v'SzF D$PdJt!X& P)jjOPjR 1[Ð&UWVS% 8D$2qt t$huuuZ uI u& ) WjhGUj輥 ,[^_]Í& u D$ p8hVhϦ 99L$ Q, Q(A(tv'P u;)D$ x8D$ MUxL$T$1ω|$3x|$  uZYT$ L$$QRPD$ pp<'Pjhi)Pj謤0)& PjhB)Pj聤 ,[^_]Ít& PjhKΐt& ) WjhFUj9 bu} uWVPx&PjhR)1Pj0xhEU D$T$ uw_t$ t$ PD$$p&Pjhbvu} u?WVP&Pjh[k'UWVSW # <$P$T$Xw D$e$,1tD$,u-$,e3 <[^_]É'VF NT$V D$FL$ T$VD$$T$(W}jLjt$ t$ R tt$4t$4R`t$Ht$HR1RPmPjUt$PPOfUWVSE t$8D$0T$4~F LVMD$T$ G2 x[G5A%rG 0N*>FF, F(VFV(t B uhWhϦ 4$ht$ t$ U t[^_]Í& D$ R)jhRj荡 D$[^_]Í&'UWVSW #4 e$$ 1$P $L p Vj/RT$ŋT$[)=hPR$(RT$+nƄ,,T$ (PD$(Phl$4UR ;Pt$$D${UwXP)j hD$ Pjrt$vWW t$$‹T$  4FPvNT$ 9+T$ PPWQWjht$0jٟ$t$-T$  2V4F:u PPQRWjhvD$' P)jhPj] T$$ e3 , [^_]Ðt&' P)jhPj 1봍v'D$ 'UPjht$ jߞt$3T$ u1kT$W 0 4FT$|$uT$ PPQUPjht$0ji0T$t&vt$vD$vUlvUPj h|$ Wj 0KPh vUPjhWjН0T$nt&.$f$&; 04F|$ PhP)RUWjhD$0PjN$t$$bo 64F|$u PPRUWjht$0j01t&bt&t& Pjht$ j謜 1L-'VSyEt$v[^Ív'F t P v[^É'VSt$$>t[^Ít&FL8PVȇuډD$ vHVLrX(R)jh'Rjś D$ [^Ð&D$@Ðt&T$D$u `Í&HÍvUWVSb.e$ 1|$$0$4 } WG T$8D$4UbZYPD$Pj [^_ÍWVSD$Ð x 7tZt$ jWT$$D$ X7t [^_Ít& P)jh1Pji [^_Í 1P)jh,Pj? [^_ÍUWVST|$leD$D1Wt$l2D$jvAD$F$[G D$GD$(hF :D$F @48D$9~RD$ <D$y&jvD$T$0L$l$0D$4AFD$8L$ A AjjjQVN ?9|$W t$RT$t$ hU@ T$at$ RPjhg) Wj藂 vɬ,$jh Wjw 1TjvD<EFW E EF jjjUVAM t$ D$ D$$D$(Pt$$r3 UL'jP <$| t&E<.}t&Wt$P)jhJPj} VGu@D$9D$D$l$,e3 <[^_]Ð&[ 0L$4Fyu PPRt$(Pjh_)Pjl|0d P)jhSPjE| -ص 0莱L$4Fyt PPRt$(Pjh8끍~v&'UWVSÓ $ $,$0$8$$D$(L$$($4t$ |$e5$1D$L$,t!P@ $T$ WU,E($ 6 $VhL$AQRP1k 5T$x҈$K苼$81vDO u{tt uDx V E(U,M Ɖ$E0׉T$U4;}$1ҋL$ qyt$8t$0t$$u8Rt$D|$H)WVPD$PD$0T$TT$4RP1t$d D$@@ t$ ^ j@D$@D$0Pt$gD$U0M4p xT$L$t$p|$ xU(M, T$,L$00Ot$8t$t$$t$$WVt$eD$ Pz.P6貟L$D$ $eXZT$RUե D$P.P6D$(|$D$e3u,[^_]VbUWVSsHD$`L$p|$dD$,D$0hL$D$e L$81Ud*g7U,FH  VPj1.QL$WL$ VD$$PQWGD$ P.PW觥FX.T$RT$PW|T$ RPW\tTvHD$'.pX1t$Pj hBRT$(jWfjt$D$0F\T$ cF`P.PW-D$F`D$PPW讥tt$PU#xVvHt$}Vt$+%T$$D$ tRPt$$V苛H V跑D$~HPWeD$WpX,2Pjho'.Pje T$1t&D$0vHPjh"'.Pjd T$L$,e3 <[^_]ÉD$ .PW|T$ (1T$vHPjh3듍vF`YF`MD$0vHPjh)SvD$ Pjhd'.Pj d T$6 Pjh'.Pjc 1 & t$ tFXT$ X1vHt$P'.jh;Phc FXT$ . P'.jhPjQc 1|&kD$0vHPjh.3vl2WP'.j hsPjbD$$NP NTvHD$pX1t$PjhFRjb 1F`t& Pjhv'D$ Pjhg;D$vHD$ pX1Pjh_t&D$ Pjhj\'UWVSñ0D$,qPyT t |$0mEu΋E D$8‰D$ALҋ@D$(dL$D$DPt$$t$ 蒄L$+L$D$HPK0Pt$ gL$L$D$LD$LP4RPt$ L$]t$PALL$$0u‹L$#@@t)L$,T$L$@Qt$ ЃT$L$,D$DjjjjPt$PjjjjjPt$tQL$hR\D$X@L$,T$B @@t!L$,t$$t$RЃL$,;L$,D$@PPt$ L$,T$9t3T$R9Pql$(t$9PT9ul$(T$L$(BAtRt$ L$(D$@ P APD$ATD$D$t$ qPljATtD$ ƋD$qPljATD$ct&D$pH8uPjhU'. VjM WjhVjM WjhVjL 1|$Le3=\[^_]Í&D$LP}0Pt$D$9D$HtqD$pH9Pjh'. VjoL g&D$x8D$pHRjh'.Rj6L D$Bjt$  t$5D|$ D$$@dGhgtGPGlWpFD$ @dv',9 Pjhbsx9 Pjhv'D$pH8uPjh[3. Pjh'.PjAK 1O'0 PjhOD$pH9PjhL$t$@D$ dPt$4L$D$pH@LpXL9Pjh| Wjh'.VjJ D$hP4Pt$D$ xP@d|$D$dPPt$@eD$pHT:P'.jhPjI 7T86Pjh tL$D$APD$ATD$t$|$R̀D$ATD$(D$D$APl$(L$t$ PօL$ WjhD$ :D$pHRjh Wjhk'.VjI Wjhv׃ QL$$L@lL$8tT$$ BrR dt& v vRPUtV u8 P9 1A8fUWVS'h$|$|eD$X1Ew @@D$6PVt$x@( T$PZYPW <$zT$ tg~n 6OUW9u %&ǃ VMd4$`9u [^_]fSJt$,t$,t$,t$,t$,t$,([ S ֘t$X[ÍvUWVSó,D$PT$Tt$DD$D$XT$ T$\D$D$@T$x4jV m3j4VmMWt$1ɋ|$ E EUT$Lpxt$|$@P@@ px@)ƒ9rt$hU!XZUt$Ten,[^_]Ðt&9<hVjmD$hVj4mT$h#T$ PjhVj1T$R^1y= Pjh 9u /&ǃ v ^4$a4$]9u؃ [^_]Ð&VS艚U9t$|$ D$D$D$(?D$0D$t$Pjht$Tj-0m;l$rt&D$D$D$T$ t$$Le3=D$0E\[^_]Ðt&L$u} T$ D$11  t$(|]Zt$t$WVP>P/>jhPj%-0Mt&l$T$4GzD$0E))ƁD$8?|$l$ D$8ht& t$(T|t$t$P>P/>jhPj,0&EhPhϦz;Et2 t$({ZYP/>t$HjhPj*, RfD$Dd&/>jD$(@P耫t* Ph$4$$jUp$V t$(a{ZYPF>PjhWj+ D$ t$('{^_/>P>PjjrWj[+ D$0I%S*-Ph[Ít&'UWVSÐ --97t3v' P[G$R<$X69u׃ Unh [^_]ÍvUWVS臔SD$,/>@hUa j0WPYft8D$ UFF P ^X-ZVPf [^_]Ðt&l? Pjj1Wj* PjjSWj) 1t&UWVSדã --l$ 9u0&69t"F UP]UuF [^_]Ív 1[^_]Í&'UWVSb.L $` |$8 |$0D$ e$H 1Rx]ZP?P/>jhD$0Pj)WI |$ Wϊ^$DD$(PhjjW3 =>D$D$ D$(D$ ?D$,l$|$  l$urt$|$ U E11 D$|$T$ l$  u t$ 聊t$(R$< e3 `L [^_]Ð--9u떍69tFt$ t$ UPt t$ V}w|$l$UWPt$Hjht$@j'$ t$0hRPV譜  t$ &wt$t$P?Pjht$@jT'0D$(t& Pjht$0j$' t& t$ vZYP>Pjht$0j& D$( Pjht$0j& G!&UWVS藐c4$H$P$T$Lw@D$T$e$$1jVD$tb WuZYP\>P/>jh Pj*&T$R]E$e3 R,[^_]Ð W7upD$ P/>jhPj%jVBƋT$t PLx$4$A$jWp$V~ T$`ft$t$t$D$Pt|UVWPRttEtL$xT$EPH WR t$ P/>jh#Pj$ T$ 1P/>jhPj$ 5t&UWVS臎S,$D$@VD$ e$1h:~n <$l$ vP@@jt$t$Pjh6/>Pj$ 1$e3 ,[^_]ÍwD$l$D$1|$D$ LABED$$LONEl$,D$4 |$(t$VPhD$4PhϦ薊D$8_t$訋V F |$8T$D$ l$Ur<$t$/>t$Ph@PjhKWj#FV $t$h RPU ty t$ƒ t$ RjhRWj" D$t& D$ RjhA/>Rj}" D$d f1t$rZYPv>PjhMWjH" W D$ RjhG랉'@ Pjh0t&UWVSó($<e$1W@jWDt* PRh$<$G$jUp$W脮 Pjhf/>Pjb! $ e3 uy[^_]fl$ jjD$ PtHR tt$t$UP҃ƃ W8u Pjhpkv1_ VS詊u t$FVPR4$M[^Ít&UWVSwC/>|$$hUj'btxVWP [^_]Ít&> PjhUj' 1uLWVSŅYt*-t;-tu ǃ-[^_Ív'ǃ-t&-tҐUWVS腉Q(D$t$<Ϫ|$4u -0G}uZA Pjh@1Pj9 |$4u --u胫[^_]É' UwD$0.D$0D$ uD$@It$8t$4Ut$-0D$0D$ tPUv t$mT$@<|$  UUt&@Pt$t&YCA Pjht&T$0& U&AUPjhP'@Pt$MSt& P@jhPjQ D$0 |$  U PRVP@jhPj101v'$|e3 u{Ā[^_Ð랐&BWP@jhPj 1뮉'8BD$ VR@jhRj D$ ut&'VSi5--ǃ-ǃ-tЅt -t W[^Ð蛧F[^UWVSӀxBt$,|$0POtD$(SjjUW6F-E␍&C@ PjhUj-t$,WP-u{t5@D PjhUjT-t$,WP [^_]Í-t$,WP C$@jhPj [^_]Íu@B@RPjhUj-t$,WPu|$( C RjhUPx 蛟@jjVWD|$(8C RjhUP  jjWWpDD$(tD PjhUjDPjhUj-t$,WP C RjhUP -t$,WPB$@jj{PhN  [^_]Í@A PjhUj-t$,WPu|$(C RjhUP P D P@jhPj 1 [^_]Ít&jjTW?'@@ PjhUjQ-t$,WPmn2t&`C PjhUj &tD PjhUhDPjhUh-jWPt&S芀V|-[ÍUWVSg3|(T$@l$ Pjh@Pj [^_]É'FTu 1V0 t vLaVhVt$,q VM V0t7 vLa%VPVt$, Pjhv vLUa%VPVt$,Tv'FT"0 vL`%VPVt$,fUWVSuqD$4l$089u-vwU?;|$4sT$8uӃ wpLuGPh$PUjtSG P/D$GPhPU'D$i&GpH\AP@jhPj [^_]ÍG pL_GD@TN2'G pLr_GO@TR=G pLB_%WRPRUAD$t&[^_]ÐGpH\AP@jhD$Pj  9|$4D$tt$ CvGPh$PU t$jht$j 9|$4tj#tG pLa^Gu@Tu 1P-uku:GPhPUBz9|$4ut$ [^_]ËG뮍vG pL]Gu@Tt륍t&G pL]%WRPRU\&)n-É'WVSrdneD$ 1|$ t$$D$t6-tpT$RWЃt.D$t 1҃‰L$ e3 u>[^_Í P@jhPj Í&t&VSqåmt$VFrAjh@PV$[^ÍVSqemt$VrAjhPVb$[^ffffffÍ&'Í&'S:qmPI6DK .D, Ƅ$+ VhPqǃ$.v'.*a$\.*D$,=tX,$dD$ D$$P0~=t$RPD$4Fu PPRVPJFjjl uLDUETH UpT Pjh ;&# uL`DET 1U t uLD9UhUEL0 t&%UPUt$(c Pjht$$j Pjht$$jv  Pjh%t$$jM Pjh#t$$j) Pjh't$$j d Pjh*t$$j @'UW VSR~N l$ IT$$tUI u  [^_]Ít&HUPHjh6Pj` 1 [^_]Ív  [^_]UWVS'RMl$,W"t1 [^_]É' Wwwڃ UTt̋PBVtË@l;hfffUWVSQqMTe L$D1ɉD$T$ hP,v0-tI1D$ L$H9t!jRt$FD$@09\JjPt$ t$A&a2'&xJ Pjj:KIPj 1L$t$VFuWFTt) V@bttPp@l[^Ív V11҅tFlVp[^Í Vo‹FL@db[^Ít&'SZB&>D$@T u 11[Ív Pat@tPp@l[Ív'UWVSB= t$$FL@X8t VFtFT t!Pt$, [^_]ÍvnL EDPZuX YvHl/ZYUt$,t3FLvHpXDPPUW x3 [^_]ÍI PjhKIPj1 1TI PjhՍt&UWVS@< T$$t$ BL@X8tsjrHPVt~ P(ʼn<$ZlYUVtx WP~RPUV xl [^_]Í&PV8 [^_]Ðt&I PjhKIPj9 1fI Pjh֍I PjhÍv'S?ö;D$P R@Lp^[É'S?Æ;D$R@Lp;[ÍD$Pp@lÐt&UWVSw?C;8l$LeD$(1U^tiuP}TuW PvtG jT$(RjpEL0& tO1|$L$e3 ua,[^_]Ðt&K PKIjhPj 1f D$ RKIjhRj D$ / UWVSw>C:8t$LeD$(1VFT V] p@@ @ D$Puj|$1E0t-Ul;r1& ;r9u퍃KvHPjh&88t$LeD$(1VFT% V[Dž_G @ D$ PwFTW0ŃщT$ 1҅t0vt ROl;qt>t ROp;qt,;T$ uӍKvHPjhbv';T$ t׋D$<Dōv'|$e3=,[^_]Ðt& VZtp p=vKvHf1PKIjh<Pj 뎍jDt$$*h&dKvHPjhFKI1Pj 4t&vHGpHKPjhLȍt& PKIjhQPja t&UWVS7:6TeD$D1|$lj t$lSWH:GP pGP F- wXhňFGP@t)FWPmFFXFXGT0u .FC &FtGT F-F-GSWTteFpGTtIF kL$ 1VA&t vLRFVhVt$ VLJw;Jl' V냃 V9&.t&'T$B\tÍvBL@,ffffT$L$R9QrÐD$ T$9BÍv'UWVl$t$Ř9t>t&A0t,Al1 f 9Q0v8ux >9Q0w 9u^_]Í&'VSY&%"ptH HF XtBTtt@1Ʌt[^Ív1ɉ[^Í RwEZkE1Ƀ뾉'UWVS%ã!D$4t$0H(L$  VED$ D$9G01u p9w0vhWlv8u@PRT$UVT$uE@tċR@tH@ 3J3B uD$ [^_]Í?;|$y[^_]Í P8Mjh4Pjغ 1[^_]Ít&'UWVS$s ,D$DfMt$(@D$D$@D$9t&A01uv'9q0_t9TUWP8MjhPj踸 1҃[^_]É'D$ t$lj4$ZYLQD$9PQU D$PTD$0D$ D$F4Pt$U: t$0@ pƒ8m t$/@ pƒ8 Pt$UxD$PTD$PVUtPVUs Wjhz8MVj٥ WjhVjå D$t PU\D$ 1t RUCL$,e3  <[^_]Ðt&@T&4PVU$RPVUD$D$PTt& Pjh8MPj )'W Pjh8MPj ' t$ D$0`D$9N4X1l$D$ΉT$B&rHBLT$pX8Mt$$jhPj T$?9G @ t0܍t&PVUGtPVU/ Wjh48MVj蕣 WjhVj &PVUtPVU| Wjhu?D$4NPD$ 0UY'D$vPVU/tPVU Wjh9 Wjh8MVja WjhVjK vL$l$T$rPD$0Ut PjhvNPD$ 0U Pjh'X Pjhv'PVU WjhPWUtDNPWUD WjhF[PVUW(D$D$PT&PVUhD$@TD$&NPVU&D$xxNPVU Wjh& Wjh8MVj WjhVj #v Pjhv'9PVU&C'PD$0UI PjhbPD$0U Pjh*'Pt$U WjhL$PWUKL$9PQU+D$PTD$Tt&4PVUtPVU< Wjh?D$PVUtQPVU{@ Wjhv'QPVU?mNPVU3pD$x|hNPVU  Wjh`&9PVU\D$PTЁt$WU Wjh})PWUotPWUW8 Wjh9PWUtRPWU Wjh8MVjm WjhVjW &PWUPWUD$vPWU_D$@Te&9L$VWU+L$L$PWUD$L$@QPTVQU Wjhv Wjh]f Wjh v' WjhVWv' Wjh_v'D$0Pt$?t[QPVUPNPVU|$(vKNPVU2 t$#GP<[PVUt[NPVU WjhRN Wjh_v'{NPVU/D$PTЁt$WU Wjh Wjh t$"@ pMƒ8uEPt$U Wjh Wjh t$;"@ pMljt$(8Pt$Ut$M 8t$N 8NPPVt$$VVNVt$$QVt$Ux Wjh& WjhJ' Wjh t$!@ p#Nljt$(8FT  VfP|@xW|GxjjVW $D$Ltt$TW 2[^_]Ð&t$ UGpWU; $jh V]P|@xW|Gx4$jVW(  VZYW' PjhI&\ZvHPjh8M1Pj̎ t& Pjh8M1Pj蟎 [^_]f Pjhΐt& Pjh붐t&(Z Pjhnv' Pjh{WU $jh\t&'WVSôD$,|$(T$0t$4D$T$PGL0膴t_Otjjjj)Qjjjjt$4t$4QVWPe@t\PPOPOT[^_Ðt&Z Pjh8MPjA 1΍v'Z Pjh΍'VSD$T$ Hl4R4RPp4t$4t$4ƒ FҸt[^Í P8MjhPj行 1[^ÍUWVSwC$D$H|$88Mt$@T$ v $觻ZD$(v  L$ QPW uYI Pjh D$@ @(D$ ,8MD$@@D$$|$ x D$ ,tNL$1ҋA,ljqL$(1҉|$D1҉σ D1҉D$9sD$H(8MD$@*l$$E,}$E,E(jj/t$$膮E8uD$p(@<D$ ,8MD$@l$$E,} E,E(jj1t$$-E8D$ ,8MD$@ V舽D$pYI Pjht$Xj耂W' VjhV t$XjX t$ɵ$t)t$VVV 9s~t F8$l$`$t|$`XG0$$hj t$HP$PD$@0N$D$PD$d^D$||$PuD$xD] t$\ZYP$jh| t$XjL D$p uQH+$ŋpx1M1҉Ɖm<1҅uW$ 4t$09$D$DŽ$t$Dt$Px$t$`$$H@D$;F0YD$P1D$;|$Dp4…t|$Pu $|$_t $$$D$H_D$h|_D$lCOD$p'OD$xL$+D$DD$t$D$V< V@+~(9v|$+D$DW(ЉD$1ҍ$WVD$EfD$0_$t$,t$TPjh t$Xjt L$ 9hgD$ L$LL$D$t0L$9L$r $tD$@tl$,=D$,|$9|$D$x8T$T$9T$($L$(9t$$YD$D$$D$!|$9|$LOD$($9+D$D1-t&EU L$@L$ T$t$1D$$|$G%WoB0D$~$$D$xD$Xt.PH|$_uORPdaPjh ͋t$+D$D1ҋL$XFvtwIH|$_uO Pat$TQRPjh t$hjk$t$8F$0tJD$Xt+@HPbPjh 넋$ɍЋ$W $踘D$ t$`t3$$D$D$D$hD$H@D$$D$De VjhS t$Xjj jl] Pjh; t$Xhj D$e]VQPjhC t$Xj j \ Pjh98MD$XPjsj Pjh \ Pjh48MD$@\\ Pjh*렋$ЉD$11dD$ 8MD$pD$@@ p[Pjh Vji \Pjh Vji 1H1҉`[ Pjh 8MPj}i 1x[ Pjh Ս] Pjh] t$XVjCi<^Pjh^ V j$i hjPWtn WzPƍ]uuPjht$hjh(VW~m9l$ d/I Pjht$Xjh !YI PjhD$@d^ Pjhk $D$DD$@LP^V Pjh|$XWjhVjh Wj h m$3p` Pjh~|$XWjgVjh Wjg $` Pjhpt$Xhg$ %1p11gD$LD$v'UWVSG,T$\D$X|$@T$T$PD$D$P@ QD$%D$DT D T$9‰D$D$LxtD$ jT$XD$` t$ D$Fjjt$ljPt$`jjt$xt$ Y D$ R8MjhD RjOd D$,[^_]Í`b Pjh( lD$P@ &'UWVSt$0|$4l$8PFL0衊$UWjPVjT$HD$LBPt$L]<[^_]Ðt&UWVSc(t$ t$J@ @ 39u* |$W$@ @0<$$^_P,g8MPjhWD$8PPhPjhOE<OT$'UWVS7,D$@L$H|$DL$ e L$1ɉD$9D$l$ t&6;t$t0UWFpHzuD$9D$}֋6;t$D$ufD$PWt$T|$Wv!L$e3 u ,[^_]18WVSt$d0~pu[1^_Ð V9w鍃lvXvpP8Mjh(Pj+= [^_ VSŢ ht$"~taǀ Pz$z$tz$fz$Xz[^Ðt&m P8Mjh2Pji< 1fUWVSG8l$LELD$UD$XZjvvD$, t$(yD$HD$11D$hNL$1Ƀ Vt$ jjjt$(QPWD$<0D$~~@ Pt D$@0D$)ЋUt9tt|$umEtT$D~)҉FvWU|D$F D$D$H\Q0A L$$jKL$FyQ0t&jD$p/|tt@ PxYXVt$(>wY P8MjhPj: 1,[^_]Ít&L$HD$tFV,[^_]Í Pjh8MPjc: 1,[^_]ÍWWuHPjh΍4m Pjh뻍WVSt$|$ ɟVu:j v{tNxwLƌPV0v[^_Ít& P8MjhPj9 뢍t& P8MjhPjy9 1[^_UWVSW#$$8M$$D$$T$ D$e$1ED$$Ut$PW dthD$0PWUTWU<QPWPjh[t$ j8uyD$Wu>vT$,BH$t$|$BXErPt$ zTBdBhBlBpBtB`t RT$UT$ jjjRT$mT$ L$A @ @ tRT$QЃT$ EH A-tURdP\$e3 *ļ[^_]ÐmuXWPjhWt$ j@7 1빉' PjhNt$ j7 t& Pjhot$ j6 T$ Rum1O& Pjhr뾐t& Pjhu릐t& Pjh^t$ j|6 1Xm PjhS T$ PjhaK0'SD$pHpL蒽t Pf[Ðt& P8MjhPj5 1[Í&UWVS觟s8D$(T$ P``D$l$D$9D$D$ nD$D$ 9FF@t3pHFpH8Mt$j hPj#5v@cFXt P%sFtt P oT$@t F @ t V VseFD$F N0@ uu1ɋ|$u~;n0spWUVeu捻 8M WjhVj?4 WjhVj)4 1,[^_]Ít&D$11ɉuD$)~4)Fv)D$ t ;t$|$WtwL+L$T$ȉOtfdGlWp|$@t-oVB @ @ tt$$RЃ3,[^_]Í&D$ D$v3 Fl pBM D$ Rjh \|$ wHW] V@pHmP8Mj hPj2W`$ D$ Rjh8MRj2 D$,[^_]Í D$ Rjh̍ D$ Rjh뵍 D$ Rjh&랃 |$(WtwLu D$ Rjh#hD$PtD$,WVSțÔt$ ~tfPfTPFL0\XZYjPWjjVl t[^_É' D$ RjhK8MRjM1 D$ [^_Í& V/i D$ Rjh;벍'D$T$D$+t&'SʚÖ D$(ptPt [Ív D$ R8Mjh_Rj0 D$ [ÐUWVS4Rd0Hl)T$ QjPBTD$l$@@ o E @D$D$079G4urqrHGt$8MwpHnPjhART$4j/(WGlt0茛ŋT$kwlFFt&[^_]Ðt$8Rsuڍ Pjh8MPjK/ [^_]ÍT$4t!t$8qOlt$8qpD$09G4VGl0Gf9G4xn8M 1Pjh'Vj. Pjh(Vj. t&G PohOlQBTD$8 Pjhf Pjhv' R'G49D$0]GpD0ptP=PPGpD0pHnPjh68MPj-  w2tl p; PjhGlD0pHnPjh,덍 PjhDRj'- Pjh'D$T$L$ D$L$cvD$T$L$ D$L$CvUWVS觖sT$8D$ Rj# $N P8Mjh2 Pj# 1%vUWVS臍S`t$xD$t~LD$ eD$P1jhW VKF|HFPVTWlD$ @jj)t$=NFU t%D$xuqvHPp PjhdA D$pL2p&D$@T t$>PPD$pH,sPjht$,j t$>D$e D$pLouzD$@Tum|$PPD$pHPPjht$,j . vLIo%VPVt$HD$(D$PhPt$(wD$Ph$Pt$  1P8Mjh^Pj ~ t$r^_PPPjht$,j X t$BY^PPPjh Pjh\ D$pL7n%T$RPRt$2 ) D$pLm%T$RPRt$D$,lUWVSǂÓ~Xt$p|$leD$H1VAt% VCD$l%t& V@l$hT$lL$9ȋ(twt$ v;l$Mt]Vt$lpWEuލ D$ Rjh,8MRj D$|$D$PT$hof V@ pHtvHPQ Pjh밍vt$t$t$0t$0rqHPjht$Tj 01<[^_]Ël$R4D$֋U4T$‰VRPqHt$uD$lpHvPjh묉ƋD$l$|$ʍ D$ Rjht$Djf D$<[^_]ÍTQ Pjh UWVS'up|$4D$8T$P >)čD$ uWEȍ}PRQ-? vLjjhju) E VG4$EEr0Puz1FLpXwuP8MjhPjE$Pu,ZYjPvtjjuz 9ỦE9Ǎut&?9}}EЃwVp 8u܍x Pjhuj 1Me3 e[^_]Ít&8ME}̍QvHwHPjhuj;jjjjVW >Pu+yM̃QtjjjjRjjjjuuRjVPs@XjjjujP&x +W=P@E̋VLuЋ@tFtbdFlVpG}ĉEԃVW0;uuEv'u vLrQ vLEtZuuDž9}ẺuȉǐvWT569uuuSfẼ pLUXumE@Tua u1't&Ẽ pLXuE@TCEPhPu)EPh$PuuFLpXxuPjhU& Pjhuj 17vuЃFHủE܋FHEEP$PV! Pjh랋}̃ wLW%WPWuFLpXxPjhujvLi1{Pw Pjh8MPj 1RFLpX P7ZYD1uLjD$pTpPjVD$H t$djhjD$@PU  PEL0&D$(D$ @L9D$D$l$t$`t$豈D$ }L$AjjjjPjjjjjh Pqt$`t$Tn@*D$1x D$ @u!'D$ 9h7wUVquڍ D$ Rjh 8MRj D$*@y Pjh 8MPj 1L$,e3 <[^_]ÍvyuHPjh fWWuHPjh 뢉'VD$4P:D$ P4D$8T$hPtD$$D$$;D$sl$ELMPMTPB @ @ tURЃ2 D$ Rjh oD$t$\uHR8Mjh Rj D$xyuHPjh Pjh 8MPjH 1 Pjh Ս Pjh  Pjh 믋l$Wt$\uHPjh - D$ Rjh Ut&UWVSfsbujMG @ tEOP1Pp@l9rw9r& UjrTrPuuRuu u草0UEċ@ @ t_E@tuUEċ@pt0Mă jE vTvPjuVjA0Pu20 VEEE 'Eč P8Mjh Pj>Mă e[^_]Ë} wL` wLڷl{1EEEċH0&Eċ@p|0sE)t% wLjDuGTt%'Wh$WGL0_ WEt wLDu GTtt&WhWGL0UkwHGLpX8MujhPjEM1Dr EuEuuuuujWME` It wLACu GTtWh$WGL0? WEt wLBu GTtt&WhWGL0Ep WMăEE9A0v'EċEpH{rHPjh 8MPj MR wL?B%WPWGL0=E wLB%WPWGL0E P8Mjh Pj 1R P8Mjh Pj 1EċEpH9RvHPjh wHGLMpXD{MPjhwHGLMpXiRMPjh*ujW MwHGLpXTRPjh$uj( 1&'UWVSUQ`E M$u}(eU1҉MЍ8MvHEp{Pjh\MQjEԃ @ ƒ -Ntju0u,Wu uRuuuVvLb0EJEЋ@EċEԋ@ E%t MЋQQ()Uċ}ԋW HVt uuuuV]  u_ue35e[^_]H8%+UU'ttE}EGEFt5~He1Ѝx.)č}eȃ EPQ$Eԋ@ ?~TFPEEFP~TR}jjujjujjuRPjjVuX@E;EZR1Ef;}?}RWuvHPuu!  vLvXjhju uujPWu\ E@ qR WvHPuu! (vLvXjhju胯 &jjjPWuE\  Pjh uj t&eRvHPjhuj1 ut&uuu jjVB] bv'}uuj)NjEWxE@ FR EV$(vHFLpX|PjhujvHFLpX|P}t uL/u ETtUhUt$D$ Vjht$$j &ETz} Pjh=t$$hFL ~H`wt&(~vPjht$$j S VjhBt$$j: fV< )ljT$,t$yc T$$Rt$0t$$jWpPvv vv|$)č|SL$VPRQM ME 1WjRPjQ jjjjujjjjuP;0tt W{t< Wt, W}e3=e[^_]Í Pjh88MPj 1f Pjh4֐t& Pjh*8MPj 1y& Pjh#ΐt& Pjh0st&VS9<8L$t$u$FLVP@H@FTu3VPFT[^Ít&D$t8NPNT[^Í&tɃ VC[P<uщ'VPFT륐&WV1St$;n7FUt!T$|$ƒ|$!8r[^_ÐvHFLpX@P8MjhiPjX [^_ÍUWVS#;6\t$pD$ tt$xWX W{G@ P,uEt@ <Hwt vwd9uXuTvG@ @-M|1҉EEtP D$@ L$MDQWX@Q@U|;Pt^P7EtD$ N u E|"HtGde|T$|$D$E\1ut  uGlU|9s"uT 9v uEt@ LutEt@  D$$P uG@ @, W$YEt@  EDPWGV p u E4ttjv.pD$ o@TeuDt( t$,WZYVpH6D$ @HD$$EtcvEt@ t` 9wd1RVt$V+hD$0EX 1RPVhS L$$QVR8MjhRPGd EX  EtD$P @L$ )urE@APWUD$0D$ @Q@#D$ ut@t5f}Xtjht$ gZYPSPjhv'D$$@ t$p T$pWPt$$t$$jR @`9t+S P8MjhPjY F`Et@ u?Ex8UFhNPNTVdPRP8MjhPj t$ PM|D$(L$ D$8D$pHt$~D$XpH@PjhPj蹭 d E@ P_dE @ t$Q t$D$XpHPjh1PjPFD$( dr E @ tUDt ;U<_ E0)H1D$UlD$ЋG~pt$ 9t$PL$PIL9NLL$Tt"t$L$ AR+D$Dt$D$ L$ 9C1Ґ19h 9u(vEt$D$TpHD$pHPjhPj%D$( dpt$D$TtE @ %9}0}m|$;l$ #D$P|$PǨ|$(9D$]0t$PD$,D$h E0 U 1ɉl$ z |$}lT$|$$<@1D$ T$$' 9t;:u19rl$ l$tۋD$ hp19t  l$ 9uŋD$ l$ D$tg|$ 9t@l$Ս&WO9ut&9r t 9t9ru9u?9uыl$1;t$ D$t 1919uX9ut! 9 D$t9u< 9 |$W9tKMPEȃPEQpHRvHt$HjhPjD$8x|$80d}9tL$I 9u Z&9tO9uEU vHƒRPwHPjhPj|D$8x|$80dD$;D$(D$D$P|$t$@t9t+PWD$XpHPjhPj 1<[^_]Ít&Wt$D$XpHPjhXPjبD$( dpD$TtAUlD$ЋHɉL$ t$Wt$D$XpHPjhGNElT$Dt$D$ &@t 9hYWt$D$XpHPjhOD$ PHD$X@HPRRt$(Pt$4jhzPjD$80dp1<[^_]Ít&D$El8@U4@t9 RPWD$hpHPjhPj莧D$80dpht$fpt$0t P9Wt$D$XpHPjhcPjFD$( d@ElT$DD$ l9x|$|$@T|$PD$ǘ|$ .@x t$\/t Pt |$P9xtD$XpHPjj~PjKD$( a}0u El8/t$rD$XpHPjhPjD$( dx Et P;/t P9HE t$pD$XpH@PjhwPj营 dq} O tE8Pw@E8P Pt$$wD$h~pHPjhPj0d-E @  qD$P@V!I~t$D$XpHPjh+Pj谤 dE |$@ ^pHt$D$XpHLPjhPjkD$( dxrEXuU |$B c@R|$ uX-t PC90t$D$XpHPjhPjޣGD$( dt$k URD$dx|$t Ut U@ @ t$D$XpHPjhPj;D$( dxF|$TpHt$D$XpHPjhPjD$( dxD$P D$,PID$XpHPjj\Pj蚢D$p @TD$  t$,D$XpHPjjhPjED$pD$( @T@ t$\+t Pt x0bD$XpH\PjjvPjޡD$pD$( @T$~t$D$XpHPjh&Pj蝡 dwv't$@EU~HHHEWQPRQWPjhCt$t$D$XpH\PjhPjD$( dx U |$B H@t$D$XpH,PjhPj诠D$( dxD$P|$@TPt$~D$XpH܎PjhPja dL;t$D$XpHPjh~Pj d&~t$D$XpH(PjhPjӟ d~t$D$XpHPjhPj蓟 dD$P@TApH~D$XpHPjhPjM dL'v'E@pHD$XpHPjhE @ D$1E t$pD$XpH Pjh7|$ t$\#(@ @ D$PD$@T@l8|$P9xGT t$\'@ @ D$P@TrHt$D$XpHDPjh;PjD$( dx&E |$@ pR't P 9E t$pD$XpHЌPjhD$XpH(PjjlFD$XpHPjj`D$t$D$XpHlPjh%|$Y&UWVS'$t$Pj趙 1t&L Pjh WjhVjs f Wjh"ffffD$@St D$ÍD$PPt$ R<Ðt&UWVS t$ 1uuI [^_]Í&E1u䍃uXPQjh*Pj蕘 tt& U?u4uX PQjh0PjS zv UTeuXPQjh$Pj 't& PE@Iu5uX@PQjhPj讗 uX@PQjhPjy UWVSS Wu%twX,$ r[ VPܛPjhC'VSe T$$D$ t(9tt&Q bPbT9u jt[^Ív' D$ RQjhRjq D$ [^WVS t$ |$$eD$ 1D$~`tMt/ t$ vHPQj hPjpD$( D$ e3[^_fFL pBt{FLjp˱ #D$P;YXjVQXFLZjpJ PjhlQPjp # #D$PXZjV' PjhfHj&UWVS^ $e$1ҋpXD$VЦ}(D$ D$<D$@D$D D$pxHD$T D$ 9t`D$'m9tD uuu1D$pXQt$jh@ Pjnm 9uD$ p||D$9D$D$t&T$ D$D$;BxnEp;D$ t:@XQ1PD$pXPjhN Uj2nn D$pXuLʙwj Ut$P谞t[Qj@|$PWv[6D$ PXT$v@T$ RPdW1Pjh` Ujm0F9tvD$&Fm9tS u uދ} v WPQt$j1hg Pj(mFm 9uPj Pt$P訩6;t$i t$%D$ D$9 D$ D$D$ D$D$,D$$D$(v'nD$ UHRT$ ȣD$$T$EL8PUDY v~Y\$,vm]Z\$$jvnFxX pH6F9tl(D$t&Fm9tL uMuރuF1pHQt$jh PjokFm 9u@P@R6;t$T$L$ t$,l$91D$pXXVQRUPQjh Pjj0D$@t P8D$&D$WPQjhPj,Z T$[^_]ÍvD$ WPjht$ jY T$ [^_]Í UJ Pjht$ jY &&D$ pWPjh놐&UWVSg3 $t$<|$8FLD$G@$FtFxdžFLF|Pv@tijVWt[^_]Ðt& Vw t$PPjhQPjX [^_]Í V7ZYP0PjhÍt&D$t8#Í1Ðt&UWVSg3 ,|$@{jj$D$P74B WAD$D$9ōQD$ D$vm;l$u VOuOX L$VH L$QPt$(jh[t$$jWG@ @$ftfxFLVZYN|QP@ VZYP0Pjh`t$$jPW mD$;l$M& W'wX7MD$wXXVRjhvt$$PV t$ "jjt$7@t$,[^_]fjV7SOX L$V L$QPPjhit& PQjhJPj)V ,[^_]Ít&wXPjhxt$$jU (wXPQjhOPjUt$ "t 7Njjt$7?,[^_]f 7M Pjhst$$j\U Pt& Pjhpt$$j4U UWVSӺ 4eD$$1t$LD$H|$Pl$TpPV)UWT$ RP!.tjD$ Pp pVPQjhPjTD$H$pV? PPVL$e3 u`,[^_]ÐأD$ VRQjhRj 뜐D$$xt&wt$PjhVj= 밍 Q UXZUt$gt&M PQjhE Pj=UP1D$,PUt$$螴D$(D$ Qt$PjhVj= v'j UD$ @(pW]Y_D$ @(pUk.v`Qt$ PjhVj< & Q WjhVjy< jt$(D$ QPP8t$PjhVj!< ' WjhQVj; '·Qt$ PjhVj; Wjh'6&UWVSwC D$ t$$9ptD$ h|x|9t&Vum9uD$ 9tVum9uD$ @tP R PR0D$ p [^_]WVSt$ĤÐ F tgAWt$(T$(D$$tWv )f[^_f PjhQPjq: 1[^_Ð& Pjh΍'UWVS' t$4|$8uu[^_]ÐtXt$@t$@Wt$<t9tuˍ1Vt$LT$Lt)VD$

D$(D$HD$ (D$XD$0P_D$G0% PWD$(.t$L;t$$l$$tF @HP R PR069u W G1 6D$ t&T Pjh Q1Pj/! Pjh| QPj! 1F,#$D$ G| D$0PUTXt$@IT93w|9t$$LF@@l$0|$8l$4L$<v69t$$F@@@PUaRuҋFj@@@P֟ P W tt$W訵 Qt$8t$Hj h Pj D$HFD$LP$ePW)L$ *L$tD$ tXL$ w|D$$9p|$$l$0|$4t&m9) u貨uE@@@PW(Quɋl$0|$$UPQj h PjWrD$( D$XD$0P\ L$A @ QP0D$@Iu  jt$V蘟jt$,UV{  $t P,!T$ L$l$XD$\L$dP t$PR,D$ & L$qPQ9ΉL$ D$,D$D$(1l$D$0t&FjVt$t$P G8PE8P uD$D$(WE9tJL$AID$( D$@UT$4gG9END$,9t UJp6;t$D$ 7FVt$t$P 6D$(뿍RPQt$t$VPQjhPj 1UPjhQPj UujjUWX4$a1P WՍ԰UPjh렍 PjhQPj% 덍 Pjh f PjhfUWVSwás TD$hT$,D$@D$$D$lD$eD$D1jW謎XZjW責D$0~莑 D$8j芍D$0L$$9t$(0D$p D$8Vj|$  !ƍD$DPt$4VUW5D$8 D$8jt$6D$p|h|9$l$l$$fRpǂwPUI6;t$t.GVL$ PuBpč&D$ j wFpL$HPt$HD$;D$ D$ t$85D$=7&u PQjh-Pj t$$^1|$ PHXZUVAuVw@1릍&뛍u PQjhrPj 1rvUWVSsÓo (t$(9tyD$ & R?m9tU9z@umT$ 9u|$ ut$t$ Pjh!t$ j t$ Pjh+t$ j W RT$jhZa U薊UtL$ U薊,$D$jƒҋL$ t Qt$Pt$PQjhD$0Ph!0D$ 2 jXZwPt$9Y$D$ـT$D$ CX R RT$jht$ jjW臁T$SvUWVSWj#f 4D$T|$Hl$PD$ D$eD$$1jjgT$DD$$D$ F' uU9xjjP8jjV7 u,D$D$tjPV7t$Wr@T$F|T$u{ $ PjhQUjY $ RwXVPjhUj*Va,1L$e3 ",[^_]Ívt$RT$ VWT$tU V,D$D$;D$D렍t&ܲQVPjhUj I $ Pjh&uPQjhPjN 1(t& PQjhPj! 1& Q PjhUj tt&D$T$D$D$vUWVSgsc l$(|$,WU?$u [^_]Ít&jW}tY P赤tЃjUstWU뭍L 1PQjh}Pj 뇍 1PQjhqPj ^VSfÕb t$t$V2tPV[^Ð&1UWVSwfCb .D$ 9tF} W' PWt$<'tp9ut[jt$t$<'tRm9u!jPt$<'tn t$:t D$pLw=D$PhPUzt? t$觷fD$Ph$PU?l PjhPj5 1[^_]Ð& PjhPj 1[^_]Ít& D$ RjhRj D$[^_]Í D$ Rjh̋D$@T |$wLB<%WPWUDv'UWVS3QL \D$t$eD$L1BPRTD$T$jD$sT$pD$L$u V& D$ VD$(9t$vm;,$uVwuލxt$ Pjh@Pj[ T$ thD$xu`t vL:Vh$VW PjhPj T$Le3D$ \[^_]Ív3S vLp:<FT/ V t vL/:[VhVW6 Vz$D$ lL Pjh4D$ Pj D$ D$T$FP$VT(9t1t$,$|$אt&vW\69u|$t$L$x VƳT Pjht$ j D$&Vh$VW;vй Pjh!Pj) D$1't$ vLA vL軫 vLu<$86 vLr8FT 1VXt vL/8u FTtVhVW1$(9t4t$,$|$א&vW69u|$t$n1҅tYD0rFlVpD$0D$4D$T$8؉D$vHFLpXDPPhU TvHPjhD$ PjjU4:v PD$(IT$ Pjh`t$ j Y vLV6BFT5 1Vi vL6vFTi% Pjhtt$ j "v' Pjh'Pj ' vLt. vL胨t vLAA' Pjht$ jt t&FT3 1Vt vL4t3VhVW)t&FTFTu҃ vL4%VPVW7 vLo4%VPVWqBVh$VWZ PjhND$ PjL ; D$,PjjjRT$8LT T$ RA| vL3umFTud 1Vm=to vL~3u\FTuSt9 VPl$ D$Vh$VWWuĻ PjhfkVhVW-Vh$VW vL2%VPVWuȺ PjhZD$ Pj VhVW# vL`2FT 1V t. vL*2%VPVW, vL1utFTuk PjhmVh$VWaЃ vL1%VPVWVhVW냍(vHPjhD$ Pj{ xUPjht$ jV UPjh t$ j,T$$R>JvHPjhq vL0%VPVWdt&'UWVSEqA 8u MEЉUeE1VMƒMԃ>@ )ԍT$ Q}V׃QPW EЃ0ujh@jWȡ  jhPjuw t}e3=e[^_]Ðt& 1PjhPj 뻍v' 1PjhPj 닍v' PjhPjq Zt&UWVSED@ H}MỦEċuWMe M1P >)čD$WEȍFPRQob1EMM̅uD jjPEDPuu E}E;EEЃ0jjhju UuEЃu0$jju P6uWuq0uErHRjhRj EvUe3upe[^_]Í&d PjhPj 1뿍v'ErHRjhy, Pjh v'UWVSSB> 8uUeE1P  PjjVW t E\&'UWVSA< 8uuUԉEeE1W4$H`@lr08~HRW t+)U̍H)̍L$PWQfỦǃFLRUWu} v*E UjujjPEW ƠEjVutNMe3 e[^_]Ít&UR@pHU ~HDf Pjh1Pj 댍v'/ Pjh|΍ PjhvPjn HVD$1ɋPT@PƁu ^ÍvVS?: D$@Qt6 Pm^Plƃ:u rtFl@[^f1[^Ð&UWVS>Ã: D$0@Qu[^_]Í& t$<]ŋ@ pƒ8tD$0@Q ucE011u뢍;u0s8$El |W3t Wou&t$tL$$9L$L$ …!Є D$@D$ P D$$<@9E0wJ&MlL9HPt$ Q u4VU 9u0Ml A`P`TqXZj D$(@LpuTQ Pjht$@jt 1v'D$t$‰t$ )9ЉT$$!vD Pjhj릉$ Pjhzt$@j $D$$E0D$$D$h1D$rE pL u5E pLL %URPRBL0G迷 wLGT W,wHPjh't$@j E pL诒E1pHPjh/t$@jW7t2 wLU%WPWGL0Sٶ wLGT uE pL%URPRBL0̳t$ltD$ D$t‹D$D |$$D$,tL$ D$ pHt$Pjh^t$@jc $ Pjh&{1t$$vHPjht$@jU9fPfTD$4$eD$@PD$%= t$VRD$YXvHPjht$@j D$1ɋ@0m|$l$ϋt$&VlT*PPt$ 9~0/Vl, B`P`TrwXZj D$(@LpuI Pjhv$ Pjht$@j $aEpHPjht$@jEpLd1'T$tLD$D$$?D$tD$D$ D$$ U~D$[Wh$WGL0 t$(+El xgPgTW@,$D$ZYWt$(踽|$#t$D$Z t$( t$(OŋD$u D$hD$@Q 9jH H9uT u1莲E pLEu @TtPhP@L0ï u Wjh+t$@j Wjh,t$@j 13WhWGL0lGE닋E pLA+EpHPjh/t$@jD t&EpHPjh=|$l$ t$( D$pL.Ntq D$pLuZD$@TuM t$:D$ pHGAPjh$ PjhXD$Ph$P@L04u묉$ PjhQ$D$ pHPjh1 wL%WPWGL0ŭt$4;4$u&6;4$VD$u$ PjhE{t&D$T$BS$ PjhvoPwHPjh8E pL%URPRBL0$ Pjh UD$W$_ Pjh t$vLd%VPVFL0b D$pL8$ 1t$ $t9 t$vL%VPVFL0 $Ɖ $q $uZD$ $PhP@L0« $ u $ Wjht$@j $ $ Wjh $ D$pLN $uD$@Tx딃 1t$t6 t$vL %VPVFL0 萭D$PhP@L0/D$ pHPjh \ t$(o, t$(VJHX VJPXFL jQj3$t PjhU~$ PjhL5 D$pLD$@TD$`P`Tg$ PjhIsvUWVS)Ó% H|$dD$\eT$81҉|$|$hƉD$ |$PD$,+D$dD$(ǍD$($D$ VH;x0 t$t$jt$tt$$t$$ T$(9 $)ׅ3+tE9|$ t$  t$|$$)ǍWPjhPj¾ 1T$,e3<[^_]Ít&L$ VcL$tE+|$(k^' VGH0i'T$(t$$t& $ Rjh}Rj $> PjhpXUWVS'Ã# ԫS WG$tV@tzF0PFjjjjjU  t$<'u[^_]ÐwHPjhPj 1[^_]ÐFpHPjhPj [^_]Ív0D$ RjhRj赼 D$ [^_]ÍUWVS&S" ,D$HT$LD$D$@T$D$9>F @ 8VFL$ՋT$lj|$l$ |$ #D$!ωʼn1‹D$1 ‰Xl$t$/t&P B pT$x!3T$!1 ;D$u͍t$D$T$DF49FT\~0& t&9~0vPv4WV胎u䍓 D$ RjhRjY D$,[^_]Ív'D$Dn06;t$^̉t&pD$HpHPPjhPj 1,[^_]fD$Dh;n00n0뚍vt$|$ t$t$t$t$pD$XpHpPjhPj臺01,[^_]F0t$D$L@L0F "jVjV舍 D$ RjhvS $ L$9u ;v9t2P B tPl:uB @p@ [Ð&1[É'UWVl$Ř9t7w0t*Wl1 v 9t:uB@Q t^_]Ít&?9u^1_]ÍS:# t$t P[1UWVS" D$0|$pPt$$;D$$uD$ [^_]Í&?;|$uՍTQ PjhgPjg 1[^_]Í PjhTҍ&UWVS'  D$09L$D$ 9'G9u|t&Gm9tiu t$D$<09uՋEXt΃UP u D$ RjhRj肵 D$[^_]Ív?;|$ d[^_]Í&Vt$T$L$D$ t$t$T$L$ t$^UWVS 8t$Pl$LeD$(1|$TFLD$PctC PjhPj輴 1ɋT$e3,[^_]Ít& VD$ VL$ L$ t$ L$ XD$L D$fPfT j4 VC$W$PV tG6t& jD$(PjVU |$u j4땐D$ PjhPj荳 L$L$vHPjhPjZ L$D$ Pjhɐ|L$vHPp Q jD$8PjVt$( 1҅1ҁ|$( Pjh뢍 Pjh1Pjͮ PjhՍH Pjh'&UWVSuA u jjVr9PuWju$u vtuu(uuPjvL2%0E(2 PFLu$PdE9PEu(V EEjuuuuVD  V7ZYuPu& Pjh!Pjo t& W"e[^_]Í&EjuuuuV u W!1e[^_]Í& u|u6T Pjh,Pj׬ f'E pL|tE pLmttE pL([ PjhPja e1[^_]Ít& Pjhΐt&t Pjh Pj 1& PjhPj UWVSÓ ,eD$1D$H D$Xl$@t$D|$\ vL]u5D$dL$XtRD$dtc Pjhft&FP`#|$Xv PjhTZ' j+D$dD$dta|$L Pjhuv3 Pjh@PjѪ 1ҋL$e3 $,[^_]ÐD$dD$HYt$hWt$dt$lVU 믍v j>+D$dHT$X|$L PjhkTv VW V#D$ 9D$PFL0T$ I@T$ H,"D$PjFL0уT$ D$IHT$ PjhKVjy T$ t&t$`Wt$\t$Tyt& t$dt$pWt$lt$lt$lt$lVU0Gv$ Pjhv't$`Wt$\t$TW Pjj`Vj豨 T$  Pjj]  PjjZUWVSe1 TE M}MЉEĉe M1PwL/tGGLpXtVPjhPj 1Me3 *e[^_]Ít&聻  W@1EGLGQEM]$wHuPjhsEPj蕧W0UЃEȅ@0ƃ@M}M̉Ẽ Eȃ @lT8RUUuǃuRktVuHVm뗍& ERjhRj辦 Evű}E܃ EPSNEEuEЉ}CEȃj @LpmxPuE؃9EEFF0Nl@F0zgPgTv4PV!ywHujhujܥEԃ ^ W}zv' H Pjh~uj菥 t& Vjhujs 1U' Pjhn EPj8 뫍vwHPjhiˍv' Vjhuj et&}ȃuċGLpMԃAH u9E1Ex0xE @pLtFE @pLE@@TE pkuFpHPjhujF pLMA]TQ Pjhujʣ 4E@Ph$Pu臍^r Vjh8uj| uԉe vHH /)čMЉeȃ PjjVu  u,MQPPPE;ẺxF։}ĉEE؉ElfEăuЋ@LpLuPuȋEpLmduuW6;űExHFEEpHuuuq PjhujF e0 PjhKƋ@l @`P`TEPP{4$(YXuW˘gPgT9| PjhE @pLiM%QRPRucSE @pL7iE pt7u FpL%VRPRu{0E @pLE@@T Ph Pu螊. Pjhuj蛠 P}ċŰE% Pjhujb PPEpHPjhuj: Vjhuj f Pjhuj j e-eRRE@pHPjhuj貟Ep4Et=E @pLEM%QRPRu?Eċ>E @pL!E@@T}! wLfEEԃ pL+E@T uI8EKEPhPuh}UԉѲԊEԃ pLu~E@Tur uX Pjh:E@PhPuهPPE@pHPjh E@EPh$Pu薇q녋EPh$PuwX PjhEԃ pL(%MԃQPQu%EEԃ pL%MԃQPQu uEt7Eԃ pL%MԃQPQu蔆EEPhPuo}^EЅt ‰RtNtA;Eԃ pLE@T Vjhuj uEԃ pLBE@T2B Vjh#uj賛 #t&'UWVSS D$( D$,|$8l$< t$0$Ƌ@ @ t^ t$09D$( t$0iVl+D$8:trT$,UWPt$0o [^_]Ít& PjhPj 1 [^_]Ít&3 Pjhΐt&RBRt 1ҋL$8Rt$Dt$DPt$@ 뭉't$,v0Pjhtv Pjh[fffffWVS|$$ t$W B Ht7%wt % FTFTVsXZWV[^_ÍvB WY^PPsjj$PjÙ 1[^_Ív'WVS|$` wtt FTu6 w3ZYPPsjj7Pjg 1[^_ÍWVt VrD$$fPfT0Gt[^_Ív'WVS t$ |$$F H Htt1@tXRPjWjV@ F V@ % % BTBTWKr[^_Ít&1@럍&@ VZYP(PsjjIPjS 1[^_Í& D$ RsjjPRj D$ [^_fUWVS |$0l$4t$8G @ 0@ Ow<% % ATATtWVWUD$WVu(^_PPsjhSPjR 1[^_]Ðt&9븍 D$ RjhJsUWVS $$$D$e$1FtPFL0tWt#E@,tjjVL2ЃC jjjjWVj$t$4%0輩tvHPsjh}Ph E @u PRvHPhT$HRT$,Y T$ ZvLjjhjRSSD$, jjjjVt$(O  jjj$WV$jt$4%0E @u PvTvPVFL0  VXYRT$WT$  Pjh'sWj JL=x vLzFT 1V&wt" vL7uFTtVhVFL0/uhvHPjhWj( 1(vHPsjhhPj 1$e3 ļ[^_]Ív' vL[t vLRX PjhsPj艊 1f D$ RsjhyRj] D$X Pjhn릐t&D$uRsjhsRj D$ Pjhv'Vh$VFL0s# VXt vLYZX PjhX&D PjhsWja z'NPNTu vLFT V蛬D$ cut vLu FTtvVhVFL0rD$ tL1DrD$t$(t$(t$(t$(t$(t$(jV: &vHPjh&Vh$VFL0rv' Pjhv'j WRT$T$uk Pjh Pjhf vLe%VPVFL0cqt$R,ƒa PjhT vL O1. vL%VPVFL0pD$fPfTNs vLFT V9D$ st vLBu FTtVhVFL0@pD$ 5 PjhK Pjh5Vh$VFL0oW붃 vL%VPVFL0oD$8Y'UW/VSn $|$$$$ D$1T$󫋄$D$,e$1D$4D$8D$p$ D$PDŽ$D$t$$$$$$$|$PFLpdt$ t$ 0$ |PFL0p$WvLRjUPFL0%tP$e3 [^_]Í& Pjhs1Pj' f Pjh֐t& Pjh뾐t& PsjhPjу YT~t&UWVSs $e$1FTVP@ LJVPFTV\ hvHl$(UXZj_U腺*UW tShUPWDNHWXL$ T$  UT$RL$ QRLRsjhRT$4P迂0jUV71$T$t6jjjW$e3 Ĭ[^_]Ív D$ QjhRjS D$븍v'vHPjhsPj 1녍&UPjhЍt& Pjhp|UWVSÓ $e$1~Lt9ְtl WvHPhl$(UjUV7"tH VZNPNT$e3 Ĭ[^_]Í& D$ RjhosRj D$ 뮍t& D$ RjheΉ'vHPsjhjPj螀 1^{ UWVSg3 $$$D$e$1ҋui91vPBTt Rt9s׋9u勄$uhu/$e35>[^_]Ë$u5 Psjh@Ph 몋$tvT$ U Ɖ,$衪EtmT$ 9a)juXt$jRvP1Qv F0Pv U0- D$ RsjhWRj~ D$f|$/|$ D$D$ D$(D$,D$<D$DD$d$$DŽ$ DŽ$DŽ$$P$_]P6$t$V_j wLGT 1W|Ljt wLu GTtWhW6gtx Wƒ Wjh"sVjm} WjhFVjW} 1^t&Wh$W6g8(s PjhVj } 뛃 wL%WPW6fF|- Wjh8 Wjh"(wffffVT$t$B@0t RЃ;Vv ^fsV^Í&;sfVS) t$ t$Cu[^Í&'UWVSó (|$@t$Z $L$e3 ,[^_]Í& V jjVROD$D$9t$1ɉ v9tB;h@u9ufɋt$ QL$L$|$LD$P) UQL$nL$t QL$pL$D$ $@t Ut$Rt$Pfjh PhY0D$D$(9t$ l$& v69ul$t$ 1 W VPt& t$Pjhf1Pj[X 묍 U.|D$t P;jUMuN 1PfjhAPjW bt&t$Pjhc$t$RfjhDRPW t&t$Pfjh*PjeW t& QL$k Pt$PU `fffUWVS Jj t$0u͋9yt;ov ;nw Oq9uBT$PQ6T$RP ,[^_]fUWVS觾s ,:l$@t$Dt5t$ 9vL$ ;l$ Ǽ9D$ ׋L$ D$"&9͋69F FP9rڃ~u9vA)L$D$jt$$3L$tuL$D$ 7ft$UPt$8jj6PjST$@D$<$jBB :Gjzn nL$69Ov,[^_]Í Wjj3VjgSWjjbVjWS 1,[^_]Ív'UWVS' $jt$ ot&UWVSŨÑ (M8uU؉MMWMvP /)ąe9E EBE Et/ PjhZ8Pj`> 1e[^_]ÍvVPRuvdE E} ƋE0jWVju EPE؋0d$WVjPujuu f0t'u VE0e[^_]Íu܉ER8jhnRjs=E e[^_]Ðt&E E&VPRuuU '9P$PjhavduPjhhi& PjhW8Pj< 1L& PjhT΍'UWVSc/ 8UWeE1YwHs)čE܉eԃ PEyF @ t~0tDwHP8jhPj; 1Me3 Ke[^_]Ðt&wHuoX+ZPuftGLuWpKtljjwXujvPjjjv jwL育0WLu̍GHjjjVuj tS V8t&WLwHErXR8jhRj: Ef ER8jhRj: E P8jhPj: 1%5t&UWVSuA HD$`T$D$$D$dD$(eD$81V]XD$X@PFLptD$$EjjVTO A eWPT$ AzFtUjvXt$Pt$ t$ht$ljQjvLӰD$80L$PPFH|$D$ FL1D$D$P@,D$(D$gD$(EUt$$uXZt$jjVt$ jT$0D$,n D$( GW t$(u;t$Pt$jjD$dPt$ jT$0D$, i D$ Rjh8Rj8 D$L$,e3 <[^_]Í0FL 0O D$A y&01)NjFtx& t$f D$ RjhRPFL0^ Pjht& Pjh8Pj7 1 PjhՍ Pjh$2t&UWVSwC ,D$Dl$@ESETD$L$ 9ljto&F01tO&Vl8t2 UZYP8t$jhPj6D$d ;~0r6;t$u&,[^_]ÉT$ UD$ @ pD$$8T$ D$H0L$ ɉL$pll$@11ɉʼnt$t&;L$s1҉t$ ȃ!ǍRT$TRPu!upD@Pu t vl$@ Uk_]P$Pjh8Pj5 @0D$D$t$1ɉl$@T$@~lD$ 1t&TRPu!uptvPu tt& ;D$ uĉȉ΋L$T$l$@9tdD$@9sJtF U|$ ƋG @<$VPG pxP8jhPj40D$D1 UKY^PLPjht&eD$ 1D$ T$L$ e3 u.&'SJ t$訽H A tP0[Í'UWVSә hl$|$eD$X1U;D$t: U s.;|$tT U[D$,EL,$D$4D$ER%>6 D$HD$P5q_|$PW*qD$P B tL$y0 D$(D$t+D$D$Wt$P1D$@ @ tD$x06D$ }T$B @ 4z0* U!HHZ$jhUEL0n+ MPMT UD$Ƌ@l@HPHTELY0UpElL$ D$$NPw;D$vb8H|$ D$t$t&|$ɃOPQt$$jhZt$(j1UpEl OP19rw9r|$ PEL0~XT$B   Pjh]8Pj1 v'1S' |$PW#oWWjV$ |$tZ uLot uLЅUh$UEL0t UsTuHELpXPjh8Pj0 1 uLU UqD$uHELpXPjh t&D$ Pjh8Pj-0 L$T$Le3> \[^_]ÍvD$ELpXuHPjh뭐&ePeT U@$o'D$t4@ELVppL$A0@PL$qlRT$ \D$T$ PlXELZVpkp5 D$Ppt@0@PRV\D$T$tP0T$ppt$<!;t$ 8D$dD$[ l$ |$,׋t$(m;l$ D$$pHEpHt$$j ht$(jz.E!pP`TPǷ!p`EZYpTpPjPWt$$踡 ul$ |$,uHFpHtPjht$(j. t$<;t$ l$ u4t&69& vuD$ Pjh8Pj- L$t&PuHELpXP8jhPh- Lft Pjhv'D$uHELpXLPjht&ET*D$p Pjhl Pjhm8Pj, &t$D9u;v69. vuD$ Pjhf Bt$ PuHPjh!v' uL%UPUEL0@ uL5t$D9|$lFPh$PEL0F 1PSO#u_FPhPEL0{6;t$tF pL-Fq@TtcF pLFu@Tt}'F pL%VRPREL0+vD$ Pjh&t$D9MD$ &NPRHQH9 W_e9u؃ uHa ZYPELpdnt$uHt$0jjPD$85lFT$8 PH뒍t&|$,t$Dl$ 9l$ t$(|$(|$&m;l$(D$$pHEpHt$$j ht$(j)E!pP`TP!p`EZYpTpPjPWt$$ ul$ |$(uHFpHtPjht$(jR) ;v'ELj pcD$ D$Pt$t$[eD$(t$<;t$ l$ |$(t)|$t$ & wm?9u|$t$D9t& vE69u uLZ UKt7 uL}%UPUt$0uHELpXPjhR$ Pjh<|$ 1U{KKt uL|u ETtUhUEL0EL 0<$at$D9D$ |$t&FPh$PEL0,F 1PJu}FPhPEL0u v6;t$jIqF pL{FW@TiEF pLT{Fi@TpWF pL%{%VRPREL0 D$ PjhUD$ELpXuHPjh Pjhv( Pjh9D$ELpXuHPjhouHELpXDPjhL$ L$Pjht$D9Ut& uL  UHt7 uLy%UPUt$0+RuHELpXDPjh uLy%UPUEL0w4 Pjht$<;t$ L$ L$ uLL$tL$ uLL$u L$ Pjh[D$QELpXuHPjh PjhP PjhO:` U'P0k plHp1l$ T$1ҋD@Ru lERt|gPgT`P`T ;T$uąl$  uLt uLPuHELpXPjhY&UWVSÈ XD$pl$lD$D$xD$eD$H1ELD$ Uo_ƍD$0D$$P~`XD$8D$(Po`+t$xtKuHELpXPjh&8Pj{" 1L$ PjjFt$(j: =D$ PhPt$$D$ PhPt$$ D$pLh%T$ RPRt$$D$,; D$pLkh%T$ RPRt$$fD$,Hv'UWVSW}#y $t$8nLvHuQPWO>LFQWU荚@ D$PRD$@0@Il11& 9t!9tu|$p| 9u'o wL@gGT W5D$~ wLfgGTZv'D$No vLfFT 1VX5(t vLifYVhVun V*T$FTJPFTʉL$ VP,$t D$pLeD$ Ph$Put t$4D$pHuXPjh/4Wh$WuOzwHPjh8Pj 1[^_]Í&8vHuXPjhō& wLe%WPWuD$ Pjh8Pj  1qVh$VuvHuXPjh (v'WhWu'D$uXD$pHRjh)8Rjs D$&dvHuXPjh FT |$wLc%WPWu UC 1t$f2n6 D$pLocD$ @T D$ VHuXxHT$脔 WVT$RVR8jh@RPF0D$ @T Pjh vLb%VPVuvHuXPjhD$ PhPuD$uXD$pHRjh5D$pHDuXPjh; |$wLb%WPWuYt&UWVSwr XU EỦEԉeU1PLENEԃ pLaEЍ9Ű@ pru!uu8@ u4$PEpH@LpXP8jhPjN 01}e3=e[^_]Ð u5MVEЋEԃpHPLrXR8jhRj E뛍t&e u2Nj@0M܍@M)ĉ QjIER7 u6@ZYPEԋ@LpLEG02F1ɉEЍ8EčpE1uЃMȉPuGMȉ EЃ;O0Gl4IMD0pHuj h^uj GlUЃ D0SMuEЋEԃpHWlT2rHRjhauj EЃ eG P8jhPjq 1&EЋEԃpHPLrXR8jhQRj2 E뒍8EĐH Pj hguj E 芼GXt>pHPj hnuj Eԃ jjP@L0TEu1;uGpdE}Љ'6;uEԃpHFpHuj hyujO F`P`TP蘒``XvFZYpTpPjPWu}| uEЋEԃpHVrHtRjh9}ЍM1EG0fEԃVpHujjQMJMЃvQGlMȉUЋDpHlPj hujnUWl MȋBHHB`P`TBHPHT;w0s}Eԃ pH? YZPEԋ@LpLIO Pjhuj 1R ERjhiuj E) j臈Y^uԍvHPj hujVTẼG ЁfPUЉFTOOvLtsEԃ pL\u]E@TuQ u*EԃpH@LpXPjh ERjhp EPh$P@L0u먍LM P8jhXPj 1EЋEԃPLrXpHRjh}ԃ wL)[%WPWGL0'Eԃ pL u1)t5}ԃ wLZ%WPWGL0EtTEԃ pLZu>E@Tu2 PEpH@LpXDPjh EPhP@L0I뵉EREԋPLrXpHRjhUWVS%oj M EMMPEĉMe M1cE@0)čẺe PEBEԉ$EBE܉$EBFSt Eċ@LHH uEEunEă pLHYuERpH@LpXPjhM8PjK Me3 Ee[^_]Ðt&Ex0QE@l0MQp 1E1M3t&Q0E9vzAl hQp:Z@@RuɋRBRuuMP٣MuuApt0轣MuQ09w'E9E@ H;Msp)EE1uB&uFltUEUN0 9A1҉RUtuFltUɢU}E뢐& Pjh^8Pj1 EfEȹEEăpH@LpXPjhSvuFpt&U]FlD@RL8uFptUFlED@RFpMD@R8}1EUEuuWEE@S%?uă VaFSBw0{E1҉։EE ;r0QFj@Tt\F pLQFu@Tt{F pLP%VRPRGL0E1 Pjh8Pj EEăpH@LpXPjhSEăpH@LpX PjhoKEP0R1}UE'9uEMWl vuϋWpuŃ uM8$E+XE@pH]2ZYPEċ@LpY5‹EҋM9E UM@pH2MċU4$qHuPR3 MEM@pTpPjPVWm ME Mp Zu18$E+EY@pH1ZYPEċ@Lp4ME.E @pH_1MčM4$qHRPuS2 E@pTpPjPVW/m E pVG0E8Eă pLE ut7uă vLN%VPVFL0ufEăpH@LpXPjhEăpH@LpX@PjhMăALpXqHPjhtEă pLE u6iuă vLMM%VPVFL0K.u;u}FPh$PGL0 F PErvFPhPGL0E vB6;ufEp0tpE1u}E1M5D$ VD$D$ D$9‰T$)D$D$H(@8D$@4FD$P0@, D$D$99|$<4$fnGtDPUt!u3D$@HPpUPjh]Pj% D$ F ;G VT$@9?9;|$nwU ^D$ pHUt$ jhTPjn D$ /WoD$G@H1 V PD$pHPjhPjG 1,[^_]Ív' vT$rHQPPjhlPj?0D$ 9T$BT$9ʼnT$t&9D$9AQ}u11  |$@9wHr9sB $L$qL$qHWVRPPjhPjJ0 $D$ m9 ;l$A t ;E q $uV% $GD$ pHPVPjh~Pj D$ $ t&vT$ rHPPjhdPj F D$ p $ |$wL$qHRPPjhPjFL$00AQD$ t& ;L$tLD$@Jf $T$ rHpHt$$jhxPj D$ $D$;D$D$D$ ,[^_]ËD$P8‹@,R0|$4uQ D$H8D$pD$pHt$(jhJPjQ D$ |$wD$pHPjhAPj w4 D$ OD$@4NT$B0 B,D$@4!D$H84 |$w|$wHRPPjh.Pj0D$ T$rT$ rHP|Pjh(PjE D$ T$rT$ rHP@Pjh"Pj D$ 5D$ pH@LpXPjh|$wD$pH D$ t$$hx9u2v'm9t!Vuu [^_]Ít&Vt$,rt6PW(XZVPjj!Ph [^_]Í PjjPj 1ffffUWVSUB!> eD$ 1t$0|$4D$u'?L$ e3 uK[^_]ÐPUt‹@@,tT$ RjUЃtD$t11Y'D$@xVSAe= t$FTt1[^Í Vu⋖1[^Ðt&UW1VSCA= ,l$@t$DElUpWVRP|$ t$Ɖ׃D$T$ t$ t$ RPXƋELWVuL$T1d$TD$ELT$L$HdȉD$ T$$WQt$$t$$0щD$8‰ȉL$< tD$T$ +D$T$D$T$ T$ ;T$D$r vD$T$WVRP<[^_]Í;D$vِ&UWVS@; l$0|$8Ed4$d$4w9r[^_]Ív1҉׃t$ |$WVuoUd1ɉL$T$ P|$l$ D$T$t$t$RPPDPjjfPjo 1[^_]fWVD$ xTpP^_Ð&WVD$ xTpP^_Ð&D$Ðt&WVS>: t$txp[^_Ít&[1^_fD$t @<Í1Ðt&UWVS>c: 8l$LUu ,[^_]Ðt&El D$(EpD$$UIx8,$|$$1PlHpWVЃʃRP|$t$Ɖ׃D$T$t$t$RPfƋEL׃WV|$$9T$wr9D$r ȃ,[^_]f1ɉv'VS=e9 t$FQtBdt& V$uX V_u8 V@Qu$ VuFPVT[^Ð1[^Ð&[^Ðt&S<8 D$T$H HHJPJTA u@`P`T[Ít& P@pb[Ív'UWVSD$TPXt$Xht$L$$QTFD$TPXt$Xlt$Q(D$PL$P@||L$ 9ȉD$RD$t&D$ hD$`UF- t$Xt$t$$ U- t$Xt$t$(cD$9u69Vu U, F t$Xt$t$ - U,u t$XFt$Qu D$ Rjh~HD$XpX@Pjh>Pj詥 1<[^_]Í D$ Rjh_Rjy D$ <[^_]Íx PjhK렍&D$;D$ D$\D$PL$PL$ 9ȉD$fD$,D$xWHGtt$Xt$t$$D$9,xD$(UHFt$Xt$t$8UHFt$Xt$t$4UHN4t$Xt$PeUHNTt$Xt$P;F0to1ɉl$ΉD$$P^y׃[^_]Í'UWVSà , $D $@ e $ 1ɋ$H /t$L T$D"PTPjjDUjK 8D$jjPRT$mT$ 9T$ЃօD$ VR7RjjfUj˖ D$ rf Pǎ9 D$ RDjjBRj茖 D$ 3v 0 PT$RPjjZUjU 1$ e3 , [^_]ÐˍvfQPjj_몍& 0Q$aPPPPjjGUj̕01rf PDjj9Pj褕 1Jv'R7RjjhUjw D$ vyOPPW7Z0:u0 PYPQRPjjSUj$64F΍t&UWVSã , $H $@ e $ 1ɋ$D $L t P貌 D$ PZT$D.PPjhVjT E t$$LH'Pt$ nljE$ e3 , [^_]Ðt&s 01'$PPPPDjhPj虓0떍t&+ 0$P4FPPPjhVj1Q0K' 04FD$$hPUD$ PD$(PjhVj$t$ L$ 12$PUt$ t$(jhVj谒0& 1PDjhPj y& 0$PPPPjhnj$PPjUD$ j- 0G$PUUWjj}VjΑ0 t$R PjhVj蛑 3 0Y$ 0$RP4FPUPjjxVjU0PPjt$3 t$K t$ 4tE 0^$P4FPPPjhVjА00 jN 0$P4FPPPjhVjv0 0$.xPUUWjhVj70{ 0t$.xPUUWjhVj0%UUjt$$Ӻtr t$$"RRWPLY0:uv PYPQRPjhVjq0 0$.xP4FPPPjhVj,04F 0m$P4FPPPjhVjߎ0?&VSÅ t$,eD$16 jD$Pv;Fu$T$1T$ e3[^f 0$PPPPDjhPj#01룍t& 0i$P4FPPPDjhPjՍ0/XffffUWVSs L$`$d$l$pD$e$<1D$r fL$0RyRD$(XZhD$ID$PƒD$y~&?j/PRuFD$&D$ D$;t$Vt$ t$t$t$ $W* hhW苸ExT$(Rj P1 ux 0?4Fu Pt$,RWPjjGPj0;t$/v'1$<e3 L[^_]Í& Pjj9Pj輋 1뷐t&D 0$ PPPPjj+PjomeD$mnohoD$qstnafD$uD$w0=ӅvUWVS' $$eD$t1UVukD$PVj|$ 7UVPjjgPj轊 L$le3 |[^_]Í&3 01Ph UVPjj]Pjk0묍 0豿>4Fu 1P> PRVPjjbPj0St& Vu4 09>4Ft3 P" PRVPjjlPj襉0t&t&'Sj6 x$eD$l1:tD$PRjiЃL$le3 ux[躃v'VS1 t$eD$l1:uL$le3 u6t[^ÐD$PRjxӋD$%=@<UWVSS |$,W& Vgt>z.uBt<.u zt֍ 1Vuu& [^_]Ít& VRtݍv 0Y?4Ft6 PPRWPjhPj‡0 [^_]ÍH 0?4Fu 1PPRWPjhPj_0)&WVS8 t$ Pu8 Vp:/t9r&:/t9r9jVƲ P/t`SƒtO P>4Fu PPRVPjhPja0 Wouh V[^_Ð&˿ 0聻>4Fts PRPRVPjhPj0띐t&{ 01>4Fu PPRVPjh먍념&O PjhPjq [^_Ív'.qt&UWVS7 4Fu PRPRVPjhWjփ0jit&S D$0>4Fu PPQVD$(PjhWjj$U| D$0裸>4FtU PPRVt$(jh5& PjhWj v'룐& UVU PjhPj节  }'WVSX$ t$0eD$1DrfD$ VPjhWjD$Pj V赺u:蘻 0N$PPPPjhWjƁ0 Vt:N 0$PPPPjhWj|0D$e3u [^_{SJ t$蘼t6ܺu6t$PjhPj [Í PWL$4F9t= PPRt$,PjhPj蹀0[Ít&뻋D$4S =Ív'D$43 ܁Ív'VSI t$t,؁u"  P{jjDPh ؁[^ËD$e4 ԁÍv'D$E4 ЁÍv'D$%4 ́Ív'D$4c =Ív'D$3C ȁÍv'D$3# Ív'D$3 Ív'D$3 Ív'D$e3 =Ív'D$E3 =Ív'D$%3 Ív'D$3c =Ív'D$2C Ív'D$2# Ív'S: D$=u+ Pjh{Pj~ [Ít& PjhӐt&D$E2 =Ív'SÆ D$u+\ Pjh{Pj} [Ít& PjhӐt&D$1# HqÍv'D$T$1 ==ËD$1 DqÍv'S jt$P迶ƃ[ÍvSÖ qht$P茶ƃ[ 1g tÍ'D$03 Ív'0 Í&'0 ؁Í&'y0 ԁÍ&'Y0 ЁÍ&'90 ́Í&'0w =Í&'/W ȁÍ&'/7 =Í&'/ Í&'/ Í&'y/ Í&'Y/ =Í&'9/ Í&'/w =Í&'D$.S āÍv'D$.3 =Ív'T$. t 1=Ít&'. =Í&'i. āÍ&'I. ܁Í&'). Í&' .g =Í&'-G =Í&'-' Í&'- qÍ&'- HqÍ&'i- ==Ð&I- Dqfffffff)- ǁÍv'Sf t Pjj&Pj{x [Í', ǁÍv'WVS( e$ 1~!$ e3[^_Ív$Vjj脷it!$$iDPVj?t$VjjSjVw<jV jVj 轰 0sPPPDPjjXPjv0v{ 01PPPDPjjSPjv09; 0PP PDPjjOPjiv0 0豫PP PDPjjHPj)v0XpVS e$1tP<jiDPjKu$$e3Ĕ[^Í& 0PP+PDPjjlPj9u0렍t&t$VjjXZjV jVjB蘮 0NPPPDPjjhPjt0Io'VSe e$1t$$e3Ĕ[^Í& t$VctL 0蝩$:P4FPEPPjjwPj t0냍&PVjΠuǃT&k 0!$P4FPEPPjj|'n&SzF u[fjPj=uǃ[Í&۬ 0葨$P4FPEPPjhPjr0ffffUWVSã -.t]T$RT$(Duu_trӉ<v+uCvTu1D[^_]Ht .uxuލ[^_]øĸ뽐t&UWVS |V` PVWt n 1U@ PUWձt [^_]Ít&UWVSc |$ t$$D$,Pt$4jj67ƒ 1xj9w9t ) [^_]fVS9 t$ tx1t_T$òT$t&Au/_t*B<v#+t=tЃG)čt$T>9K9w4&;M$d&UWVSï l$̔D$eD$\1tA jwL$\e3 l[^_]ÍpD$e1L$ }=L$Ĕt 9r#=PRYĔjjjȔ =1u륍&'ŋ=9v)PĔPȔuʋ=9ZĔD$(jhVD$<t$D$(L$|$t&j V襟>L$SD$t YD$ D$dPD$_PD$bPD$ePD$hPD$tPD$tPt$DV0F|$LrCl$X1҉t$ |$$֋WUT u܋D$TL$PT$,|$$t$ D$$)ȉL$0҉D$ D$,Pt$4|$8&v >u~?tWUnt׋t$4 |$8VQt$Pjht$$jg vw{W螠 0T$rPPPPjh&c 0Ą4Fu Px-PĄRPPjh%t$4juf01v 0蹛Ą4Fu PĄt$$RPPjh t$4jf0 jf~號 0O$PPPPjhePje01VPjht$$je D$(rt$4|$8T$L$  UD$[PD$^PD$aPjrt$@t$P P$ t$4Fu PSPRVPjht$4jd0x Vt$Pjht$$jd nt$(t$\膘S 0輙>4Fu PYPRVPjht$4j"d0|$D$8taRPPjh:t$$jc D$(/T Pjht$$jc 1 t$8|$WU譎uG;t$4ut$8|$É'D$@ÍD$@Ð&D$@Ð&D$@Ð&D$@ Ð&D$@Ð&D$Ít&'SÖ D$ Pt$ t$[Í&Sf D$ Pt$ t$[Í&Sj6 t$ t$ t$[Ít&'S: t$ t$ t$蠍[Ít&'S ־ e L$ 1ɋL$,D$ T$(A1u2XAL$L$ QRPIT$ e3u[Ít&hACSvVSe T$,L$ eD$ 1t$(D$@P u$tGBtC@t_>D$t&D$ PVQ豌L$ e3 u=[^Ívu&D$Ǎ& ?D$봍t& ?D$R SÖ D$ Pt$ t$/[Ív'WVSd eD$1D$8t$,|$4PD$ D$ PWVɊT$ e3u[^_Q'WVS( t$,|$4eD$1t$8bD$ D$ PWV_T$ e3u[^_sQvWVSÔ t$,|$4eD$1t$8¬D$ D$ PWVT$ e3u[^_QvWVSh4 t$,|$4eD$1t$8被D$ D$ PWV蟉T$ e3u[^_PvWVSԻ t$,|$4eD$1t$8被D$ D$ PWV?T$ e3u[^_SPvUW1VS西q D$00WVt$<8tSPt$0Vjt$0ۏtT0xPUt$4 [^_]Ð P jh8Pj!U 1 [^_]Ít&I Pjh@ PjT 1 [^_]Ít& Pjh;΍'UWVS觾s D$00xWVt$<8tRPt$0Ujt$0ڎtS0xPUt$4 [^_]Í P jhSPj!T 1 [^_]Ít&I Pjh[ PjS 1 [^_]Ít& PjhV΍'UWVS觽s 8L$Ll$\eD$(1t$P|$TL$t$XrD$ D$ T$$,$PWVL$(Q T$e3u,[^_]MUWVS' 8L$Ll$\eD$(1t$P|$TL$t$XqD$ D$ T$$,$PWVL$(Q) T$e3u,[^_]\MUWVS觼s 8L$Ll$\eD$(1t$P|$TL$t$XqD$ D$ T$$,$PWVL$(Q T$e3u,[^_]LUWVS' 8L$Ll$\eD$(1t$P|$TL$t$X赨D$ D$ T$$,$PWVL$(Q) T$e3u,[^_]\LUWVS觻s 8L$Ll$\eD$(1t$P|$TL$t$XeD$ D$ T$$,$PWVL$(Q T$e3u,[^_]KUWVS' 8L$Ll$\eD$(1t$P|$TL$t$XD$ D$ T$$,$PWVL$(Q) T$e3u,[^_]\KUWVS觺s 8L$Ll$\eD$(1t$P|$TL$t$XUD$ D$ T$$,$PWVL$(Q T$e3u,[^_]JWVS( eD$1D$8t$,|$4p(t0D$D$ PWVeT$ e3u[^_Í&[Jt&'WVS訹t eD$1D$8t$,|$4pXt0D$D$ PWVT$ e3u[^_Í&It&'WVS( t$,|$4eD$1t$8D$ D$ PWV_T$ e3u[^_sIvWVSȸÔ t$,|$4eD$1t$8D$ D$ PWVT$ e3u[^_IvUWVSg3 8L$Ll$\eD$(1t$P|$TL$t$XeD$ D$ T$$,$PWVL$(Qi T$e3u,[^_]HUWVSó 8L$Ll$\eD$(1t$P|$TL$t$XD$ D$ T$$,$PWVL$(Q T$e3u,[^_]HUWVSg3 8L$Ll$\eD$(1t$P|$TL$t$XeD$ D$ T$$,$PWVL$(Qi T$e3u,[^_]GUWVSó 8L$Ll$\eD$(1D$Xt$PL$|$TpBD$ D$ T$$,$PWVL$(Q T$e3u,[^_]G'UWVSg3 8L$Ll$\eD$(1D$Xt$PL$|$TpD$ D$ T$$,$PWVL$(Qf T$e3u,[^_]F'WVSô eD$1D$8t$,|$40耛D$ D$ PWV-T$ e3u[^_1FUWVS臵S ,D$DL$@t$l$HT$PD$eD$1D$Ltx xu8D$D$ RVUt$Qx |$e3=u+,[^_]ÉT$ L$VPΩL$T$ tE&Sڴæ t$ t$ t$0[Ít&'S誴v eD$1D$0D$ D$ Pt$0t$,T$ e3u[D&'SJ D$T$L$@t8u&PQR舄[ÃxxPQRt[Ít&Sö D$T$L$@t8u&PQR([Ãx x PQR,t[Ít&UWVS至S D$<|$0eT$ 1ҋt$8@Ttl$UPwu2jPVL$ e3 u[^_]ÍvUVW}CvUWVSî D$<|$0eT$ 1ҋt$8@Ttl$UPuu:&PPVSL$ e3 u[^_]ÍUVWs Ct&'UWVSW# ,t$Ll$@|$eD$1T$HD$FTFPu1ĠutWRUwL$e3 ,[^_]Ðt&T$ WVRsT$ tg|$tT$ VD$( WT$RU0w띍vT$ jWjVFL0q T$ f|$[륐t&FPGBvUWVSW# 8t$X|$LeD$(1l$TVouI VqT$u5D$RUWvL$e3 u],[^_]Ív'T$ RT$VoT$ tD$wT$ VzqT$ uD$0AUWVS臰S ,t$L|$@eD$1l$HFSD$ FTuKu/D$PUWzT$e3,[^_]Ít&burD$ 뼍vaD$ 뭍t& VostXFTutD$ 끃D$PVrhD$ D$Z D$ Kv' D$ 2@Sj6 t$$t$ tbtjPt$$[Ð P jhPj!E 1[Í&Sƪ L$AIttS&&t&u,&QRPe[Ð&T$&ԍt&&&fD$C Px@t‹D$D$AD$D$ G&D$ Px@t‹D$D$AD$D$ &D$eé Px@t‹D$D$BD$D$ &D$% PTD$D$ D$D$ 'D$C PT@P‹D$D$@D$D$ G&D$ PT@P‹D$D$@D$D$ &D$eè PT@PT$T$|`T$‹D$ &UWVS跬à T$x[Ð P jhPjq< 1[Í&SJ D$T$H A u(&PPRw[Ít&PRt$eo[Í'Sڥæ D$T$H A u(&PPRYw[Ít&xPRt$'f[ VSi5 t$FTt V@,u+&PPt$$v[^Ív V ,Pt$ t$kn[^fVSõ t$FTt V=@(u+&PPt$$Yv[^Ív V (Pt$ t$m[^fVSi5 t$FTt V@$u+&PPt$$u[^Ív V $Pt$ t$km[^fWVSô D$,|$ e L$ 1ɋt$(P R рuiu4jPVRu|$ e3=uY[^_Í 蒈D$ D$ PVWmv' P J {3 S D$@,t& Pt$ t$rm[Ív'jPt$${t[Í&'S誢v D$@t&@ Pt$ t$l[Í&jPt$$ t[Í&'S: D$@t&@tPt$ t$l[ÍvjPt$$s[Í&'SʡÖ D$@\t& Pt$ t$"l[Ív'jPt$$+s[Í&'WVSX$ D$,|$ e L$ 1ɋt$(P B u=&PPVrL$ e3 u:[^_Ív'@ PojD$ D$ PVWr[Ð P jhqPjq6 1[Í&WVSH eD$1|$,t$4t$8ҌD$t'D$ PVWxiT$ e3u)[^_Ð&PPVqj0v'WVSD$负À T$x`t`D$[^_t&&PPR)q[^_Í'SZ& t$$t$ 脗tjPt$$p[Ð P jhcPj5 1[Í&Sö t$$t$ ttjPt$$np[Ð P jhVPj4 1[Í&SzF D$@t6@Pt$ "t/jPt$$o[Ívِ& P jhbPj4 1v'Sö t$$t$ d"tjPt$$no[Ð P jhTPj3 1[Í&WVSD$t@ T$L$@t0u&PQRm[^_Ð D$[^_S* t$$t$ ktjPt$$n[Ð P jhPj2 1[Í&UWVS跜à l$,|$4WUjtFjU mt4HPVt$4n [^_]Ðt& P jhPjA2 1 [^_]Ít&WVS eD$1|$(t$0t$4t$0TD$t+D$ PVWTfT$ e3u([^_Ðt&jPVVm7,&WVS舛T eD$1|$(t$0t$4t$0.WD$t+D$ PVWeT$ e3u([^_Ðt&jPVl+&WVSĖ eD$1|$(t$0t$4t$0WD$t+D$ PVW4eT$ e3u([^_Ðt&jPV6l+&UWVSg3 4t$LD$T$|$HeD$$1D$ jjjjVFL0Q FT uFl$UjVVjUWt$m_L$e3 ,[^_]Ðl$Ut$Viu D$ Rjhy Rj/ D$롍vD$PWt$^뇐 D$ Rjh|)t&SJ D$T$L$@T u'&PPQj[ÍD$L$[fUWVSó 8D$Pl$X|$Lt$TD$$D$D$\D$eD$(1UWuIET0t+1UVL$e3 u=,[^_]Ðt&D$PVW]ҍt& t$UVt$ W (t&'UWVS' (t$H|$DeD$1l$LV`VtYD$PVVu/U?L$ e3 u?[^_]Í1҃|$ōt&&P&PW9i(v'UWVSg3 8D$L|$Pt$Tl$\D$eD$(1t$X5TT$$D$  u6&PPVhL$e3 u#,[^_]f UD$ PVWt$(, r'fUWVSǖÓ ,D$LL$@eT$1ҋ|$Dt$H@T L$ l$Pt@ P'TD$ D$ T$$,$PVWL$(Q T$e3u,,[^_]Ív&PPVg&v'UWVS |$(t$,l$0}HtY vL辀u. Vk<@l$$T$ [^_]t& V/l$wlf [^_]`UWVS臕S |$(t$,l$0GtY vL.u. Vj@l$$T$ [^_],t& Vk$Gkf [^_]UWVSÐ t$(l$,|$0]GtS uLu&1ҋd@|$$D$ [^_]& Uk$jt [^_]F UjSZ& t$$t$ ltjPt$$e[Ð P jhPj* 1[Í&Sö t$$t$ YtjPt$$ne[Ð P jhHPj) 1[Í&SzF t$$t$ tKtjPt$$d[Ð P jhPj1) 1[Í&S ֎ t$$t$ QtjPt$$d[Ð P jhPj( 1[Í&S蚒f t$$t$ tPtjPt$$d[Ð P jhPjQ( 1[Í&S* t$$t$ ItjPt$$c[Ð P jhPj' 1[Í&UWVS跑à (t$HVT vH^ZPYRT$t$@hŋT$ ivHPRU_xhvHt$@!ePUt$Db[^_]ÍHVt$@t$<|[ǃ[^_]Ðt&& Pjh Pj& [^_]Ít&I Pjhΐt& Pjh붍'UWVSwC (D$@t$Hl$<|$DD$D$LD$V輯4$D$Nu9FTu_jPWa,[^_]Ð& V7QT$T$PD$LD$|$Hl$@D$D,[^_]& V/P<tU VL$L$P@<밍&D$D$@D$ @l@|$8l$0D$<t'D$08Vt$0t$,`[^_Ðt& D$ R jhRj" D$ [^_Í&J P jhPj" 1[^_Í'UWVS藌c ,D$@|$Ht$Ll$PD$ eD$1D$PD$PVt$Pxt38t$Wt$SL$e3 uD,[^_]Í&D$ vHVLrXR jh3Rj" D$ UWVS׋ã ,D$@|$Ht$Ll$PD$ eD$1D$PD$PVt$Pwt38t$Wt$?SL$e3 uD,[^_]Í&D$ vHVLrXR jhCRjD! D$ S D$ 8t$ t$ t$V^[ÐUW1VSñ L$,l$4|$8t$@t|$D$8Pt$I$e3 [^_]Ðt&t- V苫D$TuFDt@D$XF@tD$\D$HD$Dy$F$F$F $F$F$F$F$t&WVS|$T DVWIt >u[^_fffffffD$uӃ x0t @ @Ít&C'É'Sڇæ t$K[ÍvS躇Æ tǃ[fC'jPt$ >uǃ[Í&jPt$=UWVS' t$@|$HD$LT$PN0t>v RPW3L v0jWVt$LP [^_]Ív'NiLqHuXL$DIHQudRPWG u D$ RjhV'FpHt'P&jhPj[ 1[^_]Í D$ Rjh&Rj% D$ [^_]ÍUWVSÁ ,D$Ht$@l$DD$ eD$1~0t!F P&PUPD$PPUf[t=F41҃v0F4jjt$t$,UVl NjL$e3 ua,[^_]ËF pHUAT VP'PjjU&Pj3 뷍F pHU T VP'PjjOfUWVSó t$0F0&P&Pjj*WjF @LyHF P'Pjj2Wj F0tC''1D$D$ Ut$jj5Wj\t$UV9n0wӍ Pjj9Wj-<[^_]Ðt&F 1RPQ@ZYP'Pjj/Wj ef&PjV됍vUWVS跃à t$0L$4F0;A0D$t 1[^_]ËA 9F uT$Fl8uڋQl:uҋN4xjL$ M9Ou1ɃL$t$ 8t&D$|$L$9t1xuzu*8 M9OsO ;M tdt$0D$[^_Ív D$ Rjjb&RjX D$ [^_Ív' D$ RjjfƍWVS| &hWj$XtSD$F F FDBFPFTPjhWj [^_É' PjhWj 1WVSt$d0| T$)Fу? H9u[^_Í&'UWVSD$l${ T$})MHMHMH M HMHMHM@EE?v'у? H9uEG[^_]ÍUWVSS{ D$0)h @D$ 1&EPWLt)Ɖ!;l$ uЃ[^_]Ð&VSz t$F V= t&9t80t1[^Ít&VT DQt܃ u[^UW1VS~Áz |$ wG) 9rj W2t4o )1C!k>)7A9uܸ [^_] S~y T$ D$ HJHJHJ HJHJHJHRPP[ÍWVS}Äy thD$H '9t9<up( P )jhPjq 1[^_Ð&[^_Í&1@)ǃ0v'u['S|öx j t$t$A[Ðt&UWVS|Ãx |$8&l$4v[D)1ɉ͍FD$ D$0>WPRT$@T$;t$ :P-uB[^_]Ðt&( P )jhPj9 1[^_]ÍVS1|w D$t$P<-t _Bu t1( Pjh )Pj 1[^Í& V[^Í( Pjh뵐t&VSi{5w j(t$KtLj(Pt$ }t[^Í 1P )jhPj fI P )jhPj ffffffD$@ @Ðt&D$T$JR4HP4ÍSzfv t$=[ÍvSzzFv  tǃ [fajPt$0ǃ [ÍvSzu t$4t$4t$4P[Ít&'Syöu aPt$0t$,=Bt[Ít&)D$ R)jjDRj D$ [ÍWVSxyDu )j^Wj$/QtND$F F aFBFaPFTPjjiWj( [^_Í& PjjaWj 1fffffSxæt T$v [Ít& r8[Ðt&VSxet D$ppVv@pHtQv@tPdB=wUJu[^Ív'X& Pjh@-Pj! 1[^ÍjhD$@ p' jjD$@ p VP*Pjh뛍v'jjD$@ pڧZYP(*Pjhet&UWVSwwCs DD$Xl$\eT$41҉D$jjuLu@Up t$UPg4$4$W4$菦XD$0D$(PJDžDžD$ DžD$$DžD$(R-ZYhP'IhP GpE@ G P7J$)JG,$PjVD$(pc GGG4W|$(WH jWt$D$ D$D$$V6L$,e3 <[^_]Ð& 1P@-jhPj 넍v' P@-jhPja S' Pjh@-Pj1 1V& f1P@-jhPj Pjhh&WVStÄp t$8|$4F|vF|Ѓ urGDu[^_Í& w P@-jhPj0 1] Wjht&'VShõd t$F(t PlR V,[^Ív'Shqd T$B u$ P@-jh Pj 1[É'VSYh%d t$>tg~t~pw[^É'jjD$@ pJZYP8,Pjh@-Pj 1[^à Vgk PFL8PV~t|,hPjh륍&'WVTeD$L1|$t$dD$l@dD$LVD$ Pjjjjt$| tNtNxT$Le3uT^_t&VSgb t$t$ëtJjp->tfC@ @PPFP29[^Í& P@-jhPj 1͍v'd, P@-jh!Pjqv&1 UWVS7fb DD$XD$D$\D$ eD$41}-h(P8d D$0D$ P9D$@ @HPDD$ D$L$,H||D$(L$9t&D$hhW6xE@ F P>9$09F,$Pt$WD$(@ pe t$ Pt$ V?t$Ut$ V VQ(Vt$ 97D$D$;D$ l$ Ut$ V4$t$,uXVt$(7 jt$D$p K& VW1,$jh@-Vj8 UjhVj" 1jt$O<$G$T$,e3u~<[^_]Í P@-jh Pj 몉' Ujhdv' P@-jh-Pj 1ufUWVSWc#_ @-l$4eD$1hSWj8+56hDC F F,0F TF4FF$FP64$',F  P0-v$UP2JF(F$$D$D$ D$PVPPv(ټXm ZvPjhWjN L$ e3 [^_]Í, PjhnWjFPR4$C%1볍t&, PjhXWj 1돐&, PjhhWjV$1[t& - Pjhuΐt& V $jhWjg 1ffffWVS4a] j%ZYP-7t$ PhV/ x[^_É'- P-jhPj 1[^_Ð&UW1VS`Á\ l$@t$DT$H}EDž)N,MN0MN4MN8M N UyZYP0P-jjgPj [^_]Í&'UWVS\ãX D$,l$0ǀD$,x1)D$,H@MfxUP,UP0UP4U P8UPt t+ L$8,L$,P U8D$, V'PXPPV_EfP@<'utuL V'}hVD$8P)t&D$(@`8-t$,L$,ǁ,, D$,R X 1P-jhPj| t&hPD$8,V')& D$8,D$,Q {&t$,|$,,,5%.1VP-jhPj [^_]É' Pjh-Pj [^_]ËE||$,LJ8& Pjh뮐t& -D$8,D$,R  PjhdvUWVSWóS l$4t$0N8N<N@NDNHNLNPVTW$Wt$,I+FXht$,.F`ptN0N4tN0N4lt N0N4t N0N4t N0N4uDFdFhFltFpF(Ft [^_]É'N0N4믍v Pjh-Pj 1 [^_]Ít& Pjhΐt& Pjh붐t&UW1VS%VQ t$ l$$~dž)U8U j D$(D$HD$PD$Lp%T$PD$DT$D$9um;l$ E@P%D$ uhPD$Lp@~ UFdžLD$)D$ HrHT$T$HrXt$Tt$(hjht$0hD$LpXPT$BPttt RJhzd  ϋJh0 z`O! Ly0I <Jl8(Jt4t dž@zXuD u| t$EpHt$$>~t$HuWt$L_ u t u VD$LPD$Pm;l$ t$$,[^_]É' RT$T$lj$T$0T$ : BPv'E P8f0p<;,(t& Pjh-Pj 1,[^_]Í P-jhPj}  Pjh -1PjT PjhՍ Pjhl PjhUWVSJþF ,$D|$D$$H‰D$ e$1Ћ99}7T$69tZDuVRT$ t$hD,$uD/RPjhD&T$;T$ cD$ 9L$D$$9uv6;4$t싆l,| Uu0 PwtjUW u-$ R-jhdRjp $,&/ Pjh=-PjA 1$e3 u=,[^_]ËD$;D$ D$ʍh/VPjhXzv'UWVSHÓD D$4|$0h||ǨD$|$ 9}t&Px @ǀ1)ENHN HNH NHNHNHN @F$Vt$m;l$tMhD$3jjPj(1[Ív'UWVSW8#4 $$$$D$e$1VU%t9VL$QL$UL$ 1҉RQPF,UPWug  PsT$ 1 RPWs<$wf<$s$e3ub[^_]Ít& D$ R>3jjGRj8 D$븍& P>3jjOPj 11L$ L$ T$u :HJtÐt&zMu1Í&'VS6u2 >3jwVjtCT$P[^Í= PjjxVjn 1fffUWVSG62 $$D$ $D$$D$e$13h(Pl$0oD$c1X|$$W $ Wt$t$jv q t$9l$t$t%VP7thD m9uˋl$L$ 1&cthLuT$  t$ q$e3ubļ[^_]Ð 1P3jj(Pj 밐t&1맍 P3jj%Pj 11WEffÍv'Ív'Sz4F0 T$v [Ít& r[Ðt&UWVS740 3t$(h3PX*Zt$,PjhUj FpPt$0("tqjWPV觡tx Pt$8jFpV: t#D$(pD W [^_]Ð PjhUj1u ɍ Pjhސt& PjhƐt& PjhUj' 1 [^_]Ív'UWVS2. u܋uԉ}i Uȍ?7MhQPENjEExu>f VP4$HG4$=tE>QhVW4$t4$ huPwvU1u v P;uu u E ucEăUe3e[^_]Ðt&.t+^qujqft&1MDM1`t&E̋UMEȉ5vqMjWV^MvE 1E覧UWVSÿ ,u UeE1E1 V1P!HM)ԍT$PVUԃR5EUԃ࿈E%Ѓ EBO1tEԀH0tEԀHO1&GHtEԀH}-}+7z}37E %Y'MuQM܉QuuԈE̋EE}1AEЍ7EȉXtK8 P?7RujhPj`E܋MЃ E8MMԃ9u~ai 8pu7RP?7jhPjE܃ ME8}}9uԉNjEЋUԋ0wEЉ0E̋ue35e[^_]Í&MԃȀAfE7f QU܃v'E@uB_&E@Eȃ@MԃAt&E@䍴&- $9 P?7jhpPj֩  Y}܉E9:P?7h<P`P v'UWVSg3 H$\$`D$e$81U= $Xt\t-+ARPjh?7Pj 1$,e3 <[^_]ÍvhPUt$8V4$hߍD$2$X9t&rA 3$X UGP UP28Pht$HV $X!2$X$!$XߍxtD$3;7D$$X7D$u D$$X7D$ u D$ $X7D$u D$$X7u$X@7u$X8D$u D$$X 8u$X8u$`t$t$t$$WUt$4RP9Qt$LVQP?7jhPj裦HV$dT$(D${v7D$7D$7D$7D$7D$q8 P?7jhPj-U$dPD$t&PV8PjhxtD$3"t& UDf$XUVSt&p9UP?7jhPjh+UhD$A_'88UPjh,:P?7hPL9P蕟t&Sö Eu1xXtK P?7jhPj輤 1[fCu+xRuʀxuĸᐍ&xu[ÃPuxRuxu뱐&1[É'UWVS5 j juZ} WDE<W)ԍT$щUW )ԍT$QjUVRPUU9Ej jL81MhEMFE1ҍU)čD$ RljxUW}jDWPz9E@09E\xDžh0)UMu19wEEp=lEjjpj@‰xE@lt|@L0 uuljuh6u1j~uuPj jVd0A t t&9uvUE4WuVutjh:uj Ex @lDM9uw}EE9G0E}1|>EvE = 7EQVujhGuj苑 <7AtEhHPHT9uwht<|jpL$ Pjhuj Me3 e[^_]Í Pjhuj ƍ Pjhuj1Ð 뤍|pH?VPjhuj1葐 o'|pH@uPjhă |xX|ZYMjjQjW@L0蓱 @wHPjhuj }@@ PjhWjEV1p0t@PjhWjď PjhƋEx@lDpHAPjh3ujv TE4=VPjhD=uuPjhuj0UčuuPj jRUxUHQRt褺Utt%@QRPjh"ujǎ x=vRPjh%uj蚎F Džh8AtOPOTDžhEP0<UWVSG 4D$Pt$L(>|$HD$ D$eD$$1UVt$GTPUVmO OEPUVD$P6>PVT$t GP<D$PPVOjht$t$(VW[F ‹L$e3 D,[^_]ÍvGPPUVJXD$ G xHV WPAPjjh0v'D$ G xHV WPpBPjh=Pǰ T$ Zt$ GpLNGXttHPHTt&D$ G xHVm WPdAPjj^둍vG xHVI WP(BPjjz=Pj; 1G xHV WPAPjjq蚆v'WVSô t$$|$(A>v0PW'F FXtpHf>PWFPu9PVW5[^_ÍvPx>PW跕uʍ D$ Rjhf'VFTS> RLPQbdRPW T D$ Rjh& D$ Rjh=RjՊ D$ [^_Í& D$ RjhƉ'UWVSS $t$8>v0P=jj3ljD$$Pjh>v4Pjj4WjOFX tpH>Pjj6Wj, FP> Pjj>l$$UjWjV;>$jj@Uj؉ ~0v&WUV;9n0wꍃ PjjCt$$j虉 [^_]Í1RPF@L0#ZYP>Pjj;t$$j[ 5vVS7 jhP1ZYPV[^fVS t$F@LVt$RPBL0,[^ÍWVSÒ jP5t W[^_Ð&B P=jhPj聈 1΍v'UWVSW# \$t$pD$tT$|L$$$D$ D$xL$$L$($L$,e L$L1ɋ?|$WP=jhD$4Pj߇ t$4VD$4P?PWD$(D$0l$l$4?1D$vl$49|$0Vt$UQtڍCt$Pjht$4jJ D$T$Le3D$\[^_]fBt$Pjh봉' VD$PPD$LP%?PU uuL$(T$PW/3 D$ RjhRt&P\'PW D$ Rjht& D$ RjhDRj]w D$ [^_Í&PDPW臁 D$ Rjh몐t&UWVS t$0F0DD1D$D$ vUt$jj&Wjvt$UV{(V09wхtID11L$ &VpD$ TrHUt$jj+WjcvD$( 9n0w̍ Pjj-Wj>v [^_]ÍD׍t&'WVS|$ G@L0jjt$$wPVZ [^_ÍvSÖ 4Pt$0t$,t[Ít& GD$ RDjhzRju D$ [É'UWVSR $$|$4$|$ D$$$T$D$$D$eD$|1E0D$|$@SEPEl1l$,D$1ɉ‰D$D$2FRt |$  9u׉l$(l$1ҋD$1D$&0FUt |$  9u׋l$,T$,"D$ T$,D$E p@t$4}0D$<)lj|$8EPT$PT$ D$@E T$pD$DD$(D$HD$D$LD$D$TE(D$dE,D$`D$D$lt$ t$ t$ t$ ' u0jt$(Ut$@薧 |$|e3=Č[^_]Í&taE0D$<D$87vEpH8GPjhDPjs 1뉍t&`C PjhԐt&E0D$8D$tD$ |$Ń`Őt&w V u G P9u݋|$뭍&DD$ Pt$ TDЍ~`Pv9VtuꍃTUv PKPDIjhPj[mDP 벍v'DK$WRDIjhRjm $g'UWVSó 0D$Hl$Tt$\|$`D$eD$ 1D$Pt$\t$Tt}tYEppplD$ p0jT$L$(EPp@lWQVt$e35uW,[^_]ÍvD$ L$Q AW뾐t& D$ RDIjhjRjl D$ f&UWVSó vӕ@ T$@ t# v踕D$T$& t$Rt$(t$(t$$מ  ZYUP跫Vjp9hpHlw5"D$,Pjt$(D$(@  P蚎 PWPt$袔t&FpHKPjh'DIPji 1s' D$ RjhADIRj}i D$; D$ RjhFΉ' D$ RjhW뮉';JlfpHXLPjhL@pHKPjh, pHLPjhSLcUWVSc 0t$Hl$|$DeD$ 1PIUPVHt$ GpLD$GxPZIPV舖=QRT$VT$D$RT$VΩT$URV褦at$ GpLWD$YPiIPV衜sIRT$VBT$ URVut$ GpLG xHVWPDOt$0PjhK$G xHVΟ WPHMPjhDIPjf $L$e3 },[^_]Ít&$G xHVv WPLPjh릐URV5t^t$ GpLD$;G xHVWPMt$0Pjhm&D$[v$G xHVޞ WPMPjh G hHV豞UPNPjhDIPje01vG xHVqWP Mt$0Pjhv$G xHVF WPNPjhs1t$t$ t$Wt%UWӜG$ PjhDIPjd $v$G xHV覝 WPNPjh$G xHVv WPxNPjh$ PjhkG xHV0WP@Nt$0Pjh|^fVS t$F@LVt$RPBL0,[^ÍUWVSÓ 0D$Hl$T|$\t$`D$eD$ 1D$Pt$\t$Tt]D$ppp pHL$(T$AQ WAQVt$e35uy,[^_]Ív D$ RDIjhRjc D$ 뼍t&p$p ppǎL$(T$AQWA Q$VzU]t&UWVSs p$$$$$$D$$L$T$D$4D$8D$ eD$`1D$0PjQEtD$,uU8JjPVD$jElpV}T$1ɅQu8PRu|uxt$0t$0t$0%0:D$,Fjjt$]w D$9DIl$D$D$EKIu Pjhgt$ j`1jjE RPut$ R =m;l$ul$ t$讚PDIu|uxPjhuVj~`ExU|RPRPjt$ D$ PjhzVj8` T$1&D$ PjhDIPj` T$|$\e3={l[^_]Ívu@DIP @4PRjh@VP_w :뇐t& u p<?jjD$HPjVt$0诀 L$8|$<D$8PD$(pXL$AxQ|3D$03T$4 [|$RvHE pHPPjh[t$ j^ T$P Pjhnt$ j^ 1v'ORPjhDIPjn^ 1ft&D$ Pjh13E8Pt&E 11pHIt$ Pjh_t$ j]u SM1҃WVRPQt$ T D$ Pjhdt$ j] T$t&E 1pHIPIPjh_t$ jm]VXu 1ҋ1^vEtpHPPjh#t&El@pHKPjh)D$ Pjh:Pjt$H`D$ Pjh=vO PjhD$ PjhkV |$ PjhXWV1S|$2 G8RDIPG@L0QZYPIPjj/Vj \ ZYPIPjj0Vj[GPVZYPIPjj2Vj[Iw|wxPjj3Vj[ u/PIPjj5Vjt[Pjj7Vj^[ [^_Í&S: TPt$0t$,荍t[Ít&QD$ RDIjhRjZ D$ [É'WVSÔ t$$|$,Wt$,Vlt]TPWVt [^_Ð4QD$ RDIjhRjmZ D$ [^_Í& D$ RDIjhRj5Z D$ [^_Í&WVSԿ t$$|$(pHJPWAd"Jv|vxPW#d8JPWdtpHGJPWcFUVފ[jUVPGpLkD$$D$,PPV}UUVlt2jUVRP_UUV#(UD$ PVPUV} jt$ VkRt$3Ut$ut jUP艅9G xHV_ WPxYPjjov'D$ G xHV- WP|VPjj2TPjG T$ L$,e3 <[^_]Ðt&D$ G xHV WP8XPjjB릍vG xHVWPVUPjj7TPjF01농D$ G xHVu WPTWPjj:C2UUV@>UD$ PV!tJUD$$PVG xHV~ WPYPjh&&G xHV~ WPVPjj4TPjE 1't$W蓬t$WKD$(G8W&D$ G xHVE~ WPXPjj]G xHV!~ WPWPjj 1 D$ RjhUPW0H D$ Rjhxv D$ Rjh[ D$ RjhA8 SZ& Pt$0t$,ot[Ít&$[D$ RTjhRj= D$ [É'UWVSó $t$u]t-t$[LpT$90T$ PPPQPl]jh PD$0j%0D$T$v'` PjhNT$^ 0ZLpT$9_ PP4FPQPl]jh PD$0j$0D$"v'] PjhUt&UWVS襎q p$$D$T$ eT$`1҉L$jj$1VjQW| t 7j-t$-UHpu&Et~PVOujEt$ T$#RT$]D$k 1jj$t$jt$$WT$ ttL$\e3 uIl[^_]Í1T$jj$t$jt$$W tt&VSG @LjvHpXpY^tPVv[^Í& Pl]jhPj" 1[^Í&'UWVSÌÏ D$  tK UJtuT$$tfD$(t [^_]Ít& UNtET u uHgt 닍t&'UWVS $$D$ T$eD$|1UvHFLpX7]D$ 7UVD$0WPD$dat$Pl]jhKD$4Pj!jD$,PjL$$NjL$D$$u#T$|e3Č[^_]ÃD$jjU:Pt$Tt$Tt$4UM ubt$Dt$DPjhlt$4j 녍vaQt$PjhMt$4j Y& PjhFl]1Pj )&Fd Vh|$$|RP1jjjjD$lP1A T$PavhvdPjhdt$4j PjhIKv'L$@91Qt$HRPavHPjh]t$Dj0F UWVSc/ t$0FT tC V跨P| Pxu[^_]Í& V菨Px P|j7A`8FT tKrBB cBdBBDpRPUWl&T$ tE VT$BGB iBjBBB듍t&lb PjhOl]PjA 1[^_]Ít& V臧 jjPWv'Db Pjh:랍'UWVSLJÓ ,|$@D$ T$GU Xt$D jWT$ D$i`PWT$ D$F]PWT$ D$#>GT tD$ P W^E9|$@|$ &69jvT$ u܉D$ Pjhv'`PWT$ D$X%GTD$ hfGT D$ pt GQ  W9qD$9 tL$ q EXtjPT$ D${EttjPT$ D$t/@U u L$ QujPT$ D$7M01u&9u0m;l$d|$@/D$ Pjh8D$ Pjh Wjh Wjh T$ Pjh T$ Pjh Wjh~ Wjhh WjhR Wjh$PULK$1a UN,$D$l%A‹$)$t$ RT$ FE 1t$_t$lT$$RPa$L$| T$ L$t$VZYVW1T$$RL$$QPxcPl]jhPj0~ l$ Pjh2l$ t$V t$`PtdPjh&l$ t$bVZYPcPjh Pjh l$ Pjhq l$ Pjh/ l$ Pjh=> l$ Pjh9t&D$fUWVSoãk t$$|$ t$(vHFLpXW@t$,VW8t_PdaUPl]jh Pj~t$u D$ Rjhl]Rj D$ [^_Í D$ Rjh͉'UWVSWk#g \L$tD$D$pT$ L$L$xD$ L$e L$L1ɉ@`AU D$HD$$ t$D$$pH@LpXD$0<t$t$(D$0c( Pt$8 P%@L$Le3 \[^_]Ív' t$,ĉ jt$@lpT$D$t] t$,蓉 jt$ptT$D$s Pjh t&l]Pj M Pjh ׍&jD$0(:O L$ T$ D$r T$rt$ L$0L$0D$ T$AL@0% BD$ RQT$ t$Wt$,PjjVUt$8*D$\0 t$8-GD$|$0@ <$-'<$5'W| D$ D$49 l]D$$D$eD$D$( vk)U B@Ut$UЃNjD$Ia RPFpHWt$4jh t$8j(E 0@@,tjUURL2Ѓ]tD$xFXt"jt$PT$D$VKFtt"jt$PT$D$-Ft/ P! Pt$T$D$1F @ n01u;~0,Fl8tlF @ tۃjt$Fpt(T$D$u Wjh t$(j Wjh t$(j1 jt$pT$D$'p Wjh t$(jp 뛍vV FJ@LI@d|$ RfRPGt$@t$ VPw7Wу0~F0F 9D$$sD$$6;t$4it$|$ GTt% t! WT$ l]1Pj F Wjhv t$(j Wjh t$(j PjhA jt$FpT$D$ Wjh1 t$(j? YD$$fD$HpD$PPt$,D$XS Pjh t$,! |$,W!]XjWD$T$Dtxu;F @ FjPD$T$dHYF @ D$@<jl$U|$D$'9щL$8t$tVPD$(uB uVtEuD$v u8t_ t$(D$8PD$8PVD$ 0R" L$ D$DPD$DPD$DPQD$ L$40!" L$t&t$(t$(Qu58bgt$RRQPjh l]Uj- PP(hvHPjh Uh ;|$t$'l]9gt$QQuPjh 느t&UWVSMsI $$eT$x1D$4D$8D$(P PW6sjjj j1輮 P&{ WuK Pjhl]1Pj W~$T$le3|[^_]ÃD$HPWT$@D$1D$ƍD$,D$D$(D$ D$8D$D$0D$?&D$(t'D$,tN II$tPVуat$t$t$(t$(UWVt$0uD$$pH_Pl]jhPj ' Pjhv'] Pl]jhPj ^' Pjhl]Pja 1n& Pjhΐt&Vt$F$f1D$$pH_Pl]jhPj v' PjhUt&UWVSJsF ?^l$(h@P t`j$P!t|h8t$,W:F D$(F F  [^_]Ív Pl]jhPj 1ύv' Pjhl]Pj W 1듍 PjhƐt&SIfE D$0 [ÐSzIFE  [Í&UWVSWI#E (t$@|$QL$$jhjt$Ht$HVt$LUD$(PD$P% L$t[^_]Ðt& D$ RjhAQj D$[^_]Ít& Pl]jh6Pj 1[^_]Ít&&^vHPl]jh9Pj 1gUWVSwFCB x$$D$$D$(D$Nj$D$eD$h1V PV7lhvHPl]jhVD$Pj 1jjj jZ P  U tiD$8PUt D$0 Pjhbt$j1z UL$\e3 Xl[^_]Í Pjh_붐t&K^ Pjh\t$j Kt& Pl]jhTPj 1~& PjhYt$j 1Qv'D$$PD$$PD$8PD$4PjUD$8 t~4tPhPjhht$t$$D$0 f1Pjhot$j v0t&'UWVSCã? (l$@UTETt$8 ut$8i^RUD$<0jjjjj1ߤ PI ^t$@Vt2 Va V[^_]Ív 1Pl]jhPj ft$8.t$8p^t$8^t$8t$8x^)^D$ t$@Rl]jhRj9 D$ t&uHELpXiPl]jhPj 1[^_]ÍvK^ Pl]jhPj {' f1Pl]jhPj u Pjhl]Pjq 1[^_]Ít& Pjh΍'UWVS'A< x$$D$$D$(D$Nj$D$eD$h1Vm PV7qgPivHPl]jhD$Pj 1jjj j  Pt U`tiD$8PUKt D$0 Pjht$j1* UL$\e3 Xl[^_]Í Pjh붐t&K^ Pjht$j Kt& Pl]jhPj 1~& Pjht$jt 1Qv'D$$PD$$PD$8PD$4PjUD$8 t~tPtiPjht$t$$D$0 f1Pjht$j v0;t&'UWVS>S: x$$$D$$D$(D$eD$h1V PVudcil]D$vHRjh&Wj jjj jD$1mH P$ VtmD$8PVt D$0 Pjh5Wj1 VL$\e3 El[^_]Í& Pjh2벐t& VW^ Pjh/Wh 3K^ Pjh,Wj & Pl]jh$Pj 1?& Pjh)Wj 1t&D$$PD$$PD$8PD$4PjVt$t$$u f1Pjh<Wj" t&UWVS;7 (t$@VtPvHFLpXD$L0  VI PVD$<0Ibthl]D$ WQjhTUj|$<jjt$H!΍VjQD$(PD$P: t[^_]Í D$ RjhWUj# D$ [^_]Ít& PjhOl]Pj 1[^_]Ít& PjhR΍'UWVS:s6 (t$@V$PvHFLpXD$L0 WVD$<0athl]D$ URjhkWjA|$<jjt$H!֍VjRD$(PD$P t[^_]Í& D$ RjhnWj D$ [^_]Ít& Pjhfl]Pj 1[^_]Ít& Pjhiΐt&UWVSg935 x$$$D$(eT$h1҉L$D$P PW6_P^Pl]jhD$Pj 1jjj jS PtnD$8PU t D$0 Pjht$j1 U T$\e3ol[^_]Ðt& Pjh뱐t& Pl]jhPj! 1뤍v' Pjht$j 1tv'D$ PD$(PD$8PD$4PjU1 t2D$pHiPjht$j1 t&D$t#L$ qHPiPjh붐&^t$Pt$$ f1D$ pH$jt$ Pjht$j rUWVS6ã2 <|$PeD$,1GLjwHpXp1jjjjjjD$P蟙 u.UGLp%L$,e3 ui<[^_]Ív$t! Wtڨ밍 Wg뚍 Pl]jhPj 1t&UWVS5ã1 $$D$ $D$e$1E@L@dD$$9$ |$ D$@D$^D$(vT$UlVM A u4EpHjPjhl]Pj 1t&(B@P@t jEp|$ t8D$0j[ Mp|$D$d9QPVjt$$ jEl|$ t8D$0[ Ml|$D$d9QPVjt$$ Vv$ D$ $ 9$D$t E@T~&Bt'@t @@t Pt 8UBLIHu BT@dD$D$ @,ƉD$8 D$˜D$ ED$,91 v9t9u΃9ug$Vt$8j j$W WuD$0YEWpH@LpXD$0VPD$0daPl]jh D$0PjjD$8PjģL$$T$01jjjjjVQt$< bD$0d$QPW" }lL$D$ dRPVjt$$G |$ VjhGWj VjhkWj 15&T$`RPjD$l%=`T$Ul&BU B SjPD$0W Ml|$D$d9QPVjt$$X  D$ Rjhl]Rj D$Wjjt$tjjt$if Pjhl]Pj 1$e35[^_]Ív jjjt$0t$$ D$t&t$Pt$Pt$,D|$bt$Pt$P Pjh0WjVjh1Wj & VjhEWj t& l] VjhJWj 3zD$Og  q@Ɖ<$VjPt$$  D$ Rjhp+TjrHPjhf|$ Vjh+Wj |$ Vjh)Wj j l]PjhWj a|$VQPjh"э PjhpH@LpXkPjh Pjh Vjhl]Wj 8 Vjh׍ D$ Rjh Pjh( D$ Rjh6UWVS-S) $t$@|$8l$PRVPtkjhPjؽ0L$le3 T|[^_]Ív'kVPjhUj薽V릍vSu?tkD$%=tlVPjhUj? b&{Ctkt$tHlVPjhUh 닍t&$l 1PtkjhPjϼ &[ 04Fu P" PRVPjhUjv0'u 1É'S:&" u1[Ðk[Í&'UWVS%! e $1ɋ$$ RP}PhD$P-  ~RWt$D$PhD$ P h UPt$hU k4$PhWD$0D$PWju7D$<%= mtkWPjhVjܺ t$t$ jD$<%-`|tkt"@tkt$4t&kt$ PjhVjSt$WkU|$ WPjhVjhWXZWUvjjz-t&mUPtkjhPj t&$e3 S[^_]Í&mVPjhtk1Pjh 뫍v tkt$ kD$ L$L$pv t$9x.P RT$(t$t$ht$0V T$$Pt$ju$%=`zt$t$(jjrVj苸t$ L 0  P" PRt$,PjjtVj,0t&P.xt&lVPjhimWPjhQ'DmWPjh1'{tkQ=D$5ot$ PjhVhQ ' 04Fu 1PkPRt$PjhVj(jju%t& t$  Wt$(jhVj誶W1 04Fu P" PRWPjhVjL0kt&$PUjM9t$t$ j0$$3T$P3D$L nt$ PjhVhǵ O&S 0 4Fu PPRt$PjjyVjn0 04Fu P" PRt$PjhVj0SvkRPjjkVj ntkt$ PjhVhô KV 0 4Fu tkPPRt$Pjj`Vjkk0D$ڮ4F UWVS Kt[^_]ÍvD$v t$TZYjjtotk Pjj-Uj UWVSÓ LD$ D$`T$t$dD$D$hD$D$lD$eD$<1S1 t$$Zt$4$YD$,t$(ZD$0t$ D$(D=)|$ |$$|$ |$$D$ 3tkhWl$0l$4U@$L$p UD$DD$|$DM Et$$XUt$U4$ZUt$(YU t$ D$^_ HUP&f t$|t$$t$0Vt$,T$8D$, L$u2NjVF v v vvv 9uǃ [^_]Ðt& PjhVjo s&^ Í&'D$^ Ív'y^ ǁÍv'Y^ uu 1ffffffSv tЃ[SV tЃ ǃǃǃǃǃ[WVS( tHt$rA tt$t$t$Ѓ[^_Ðt&[^_Ív'[1^_Ív'WVSÄ t8|$(p RojjIRP萨 [^_Ít&L$AAA jj[t$ KIjPWt$ {ƉIoPVoPVoPVty pPVt\pPVopWPjjhVj^t$D$phj|$PpWRojj^RP9ǃ1m PjjSoPj٦ 1G PjjV؃|$pWRjjfVP蜦 ffUWVSwC $$eD$|1$$?/t=@td WP~RPUV tD$ PVj9uEPWVD.D$|e3u6Č[^_]ÍvjjZRT$T$@vCvUWVSc ,$@$D$HD$ e$1+ht$ VUpt$q VWPjj8Uj4hVFt%$e3 ,[^_]Ít&$Lt T$ )uPP\qVWPjj@UjŤ 1롍(qUWPpjj2Pj蚤 1s{P\qVWPjj=Uju T$ LffVSI t$;Ft[^Ðt&vt$1q[^ÍVS õ D$t$PjPPvRt$J9Hw P[^Ðt&[^Ít&'UWVSp < Le L$<1Ʌҋt$`tz 6PqPj T$8RT$,F v0T$RP蟀tV tjw wPqw7PjRT$8v艄0t"T$ VL$GRT$vWPHt%T$ VL$uT$ WPuRt$Ht$HPjh&'UWVS a D$$$D$e$1pIT$ jP6ōq jP6kD$$q jP6TD$s jP6=D$ jPt$6Rljƍ/jjPD$$0D$@qT$D jjPD$0D$8T$<L$gQt$uD$ KD$pPWVuD$T$ U|$XW'D$MPl$xUD$MjUt$VWD$,p7  PDT$8L$D$DPPr 2 t$Pt$Pt$Pt$PW< i&$e3 J[^_]ÃD$pPt$$t$$LuUPjhqPj& 1뙍 PjhRqPj 1p PjhSՃj D$p$l$xUD$D$@$D$|uUPjh-c Pjh^s Pjh_] Pjh3G Pjh<1qUPjh(賔vS  t 躋ǃǃ[Í&'Sv tD$[Ð&r P!tJjP_uu Pqjj1PhI D$[Í&r뮐&VS  4tu t 4[^Ít&hL$ d$$qjRt$4PRQT$,D$(T$0T$4xLuBPDvPjj=Vjc ǃxLu PjjKVh %qɐYL Í&'VSÕ tfjPtCMt7 P$1rPPPPqjjZPjr01[^f뒐&S: [ÐS D$t [Ít[Ðt&UW1VSá t$, u),t&~ W PWUv Ņt>t؍HrUPPx [^_]fpv Pqjj{PhQ [^_]ÍS* fǃ[Í&D$eJ Ív'UWVSã <jD$\pTD$Rr8v PqjhD$$PjmD$fy PqjhPjѓ 1e&UWVSs LD$0l$`D$ D$D$D$(D$hD$D$$D$ D$D$rD$,bT$ h(P5'P4$gt$l$ D$ EPu uuuz t$lt$4̄ t"jPt$8t$Lt$Lt$Lt$L t$ t$Lt$Lt$Lt$Lat$Ht$Ht$Ht$HD$@4D$@4D$@4D$@4U,xE,t$ PRUPvzjhPjUq0t& 0虦4F$J 1PPRUPvzjhPjp0&胪 094F$u PPRUPvzjhPjp0&D$$Pt$$VD$ T$$D$T$ 1҉lj&ө 0艥4F$u 1PPRUPvzjhPjo0t&t&t$ T$0D$, T$,% Pzt$ PhU zt$ Pjhi&UWVSG TD$lL$hD$$L$eD$D1D$8PQ|$4w|$0G t$K|$0T$4瀉  ǍD$8ՉD$$PjRWt$( 1&11D$0T$4t+ft"ǃT$|$|$t$ t$$jWVt$( t|$,N+u t$^T$…҉uLt&T${jPWt%D$|$D$ T$WUt& P{jjNPjh t&o Pjj/{Pj]h Z Pjj4bD$@ @Ðt&S t$X[ÍvUWVS ({l$@P |jj D$$Pjg D$te4RD$$t&E<$t7>0 t&ƹtK0 u$t&muD$0T$P`[^_]ÐjUD$<@@Lp蘦tT$tBT$D$uD$뤍 Pjj't$$jf 1뛍t&Sæ D$p`t$ Q[ÍUWVSs  |l$$jFWj$ZtQhDHt$,uFFZFF YPTF `PjjSWjOf [^_]f| PjjIWj*f 1fUWVS l$(j P螔t WN PWVÝtdv jPV誝tK U PUV菝t0Z}jPVvt V [^_]Ív PJ|jjtPj\e 1 [^_] UWVS# XeD$H1J|D$@D$DD$ L$ 9uh@D$;D$t2|J|wPjhUj[w赌9$ 9|$t$wj茛t 0趐W4F:u Pt$QRPJ|jhPj[0늍t&諔 0aW4F:u P" PQRPjhUjZ0%&|t$ Pjh PJ|jhPjqZ Tt&UWVSG D$,|$0@WT$8 P#uLnD$ 9x tUm9uVD$,p藐 [^_]Í&&}WPJ|jhZPjY 돍v PJ|jhWPjY 1 [^_]ÍVSY% @T$Pt$LeD$81T$0Rt+F T$$L$,e3 u=4[^Í&?}D$ t$,RJ|jhkRjX D$ kSt&'WVSÄ ,t$$H똍%~ UWPht$8V< $PVq u Pjj<-~PjV &t&$H$H `df U Us~ L~URT$Ph|$8Wq T$y}URP-~jjUPjU r{jUt&D~ UVPh|$8W N$PW) _ PjjZ'~UP-~jjoPjU t~L$RUP-~jjrPjTVeZYVPjL$QUW蓨 S~UP-~jjwPjTVJeVTY^P PRjUW[릉'$H T$T$T$T$u T$tT~L$ t$RUP-~jj_PjSVd^ZPT$RjL$ QUW譯&h~UP-~jjdPjSVjd PUW蟰/t&{~UP-~jjiPjkSV"dVT^YP PRjt&~UWPjj7~UVPjjNMWVS|$t$ ù W dB FDBF $BFjjXWu$=wwPhRVVXZh@V4$蔓YXjju1[^_Ð&jV@u8u̍t&@V1P-~jhPjR [^_ffffffUWVSï e$1WPhj0UjQjV t9 V$e3[^_]ÍD$PWj耑uD$pPVjuT$hD$d3$3$ {T$D$ 3T$p3D$l c WO蓊 0IP" PDWPjj6UjP0t&[ 0PPDWPjj9UjP0K&UWVSe1 ,''T$ D$9ŋuT$u{bfu PjjGD$(PjPj u耆UE u /},$'} ;t$ƅtWu l{uك U|D$ ]ED$E D$ Pt$ hj&D$4PjnOD$P聐\ 0规PPDt$0Pjj)t$Dj%O0#t&賈 0iPPDu PjjIt$8jN0,1[^_]Í,[^_]ÍvUWVS裸o e$1$$1҃" PTRRWPhjeD$0PjRN D$ D$Tv'UP蓄‹D$D$0PWj e$fx PhhBWy$mXU6D$$D$L$ jL$T$JL$T$ Pjjyt$0jAM T$L$D$ Qy?4F PPRWPjj~t$@jL$6t3 D$0%PPDWPjht$@jL01v$P6jL|$$3$3$ XT$0D$,3$3$ :t& D$0rPDt$0WPjjht$@jK0" D$0:?4Fu PRPRWPjjkt$@jK01$e3 uA[^_]Ív Pjht$0jdK 1뿐t&FE&UWVS# 8UEWeE1o@#Uԃ)čt$RWV}xU:auxBXZUjjt(}t?UUЃu u}e3=u6e[^_]Í&Uu jUEԉaMDt&T$1t&UWVS' l$4|$0P/t2PPjhPjI 1[^_]Ðt&D$RD$hD$Pj衅T WF UFL$ ҃" RT$ RPPjht$jQIhWӆ'L$ VQt$ǃjj蛆tT'VPT[^_]Í&[^_]Mt&D$WD$ v u4$u $jht$jH 1[^_]Ðt&VQt$=t& Pjh밐t& Vou $jh됍'Sƭ 'P赅 jjYt$Es'[fffffWVS|$贱À u |$҃҃RW t$<肕ZYPhPjh#PjE 1҃[^_]Ít&EfRfulfE +E$E(}L vA=$|,uE,uL 9tGT/u#ꐍ& t$<Ĕ PEPPjh7&}PEL@\)H`1},uE,P8.ELT$ -P{@ 8ʋT$ ƄE$E( fVS1ө t$0VhD$<@ RPt$uMD$ V6-D$ [^É' P#jhPjC 1[^Í D$ R#jhRjMC D$ [^UWVS' $$$$T$D$,e$1PAhWXt$,|D$8ZD$  }T$0E RZ<$|$<}K<$hjjt$<ֵ {Wt$,^B#t$0PjhmWj#B FV$jv$t$(U;|$! t$,3H$e3=[^_]Í&D$ WPu T$tPR6mApFV$Qt$ t$(UE$1҉T$1ҋL$׉D$E(T$ωt$(|$,9&txD$D$uHvytD$Qt$88}D$D$;tXD$9xHit$H1u,hPu{V@ L$PhHWVu ̳ L$m # VjhWj>@Vjh%Wj+@ ht$0PjhWj @ 1Uuvf t$,蔏^_#PȁPjhWj? PjhgWj? 뜍t& PjhWj? &rD$9D$H:D$8l$D$Ő& Uht$ t$ D$,p 胲 xhD$ptyUx HPU|))΃ƀPt$0{D$T$D$$D$ 9D$r wD$9D$w l$kvD$T$;4Mt&4Vux1҃E4 WVRPu 莱 #psuR#PTt$0PjhWj= 1P#jhPj= & l$ Pjh#Wj}=T t$0PjhWj]= Mt& l$ Pjh뮉' # Pjh"Wj= ' Pjh;#Wj!t ?D#É'@7Ít&@0Ít&@=ÍWVT$ D$ rΉ0Hr JɉpH Hzrx  x))΁󥍸L,Ήɉɉɉ ɉ $ɉ$((Hɉ,0ɉ04ɉ48ɉ8<ɉ<@ɉ@DɉDHH)H)΁^_Ð&WVT$D$ rΉ0Hr JɉpH Hzrx  x))΁󥍸L,Ήɉɉɉ ɉ $ɉ$((Hɉ,0ɉ04ɉ48ɉ8<ɉ<@ɉ@DɉDHH)H)΁^_Ð&UWVSG D$0t$4|$8D$0@D$0P1)Ճ 9r t$4FL$uPPRVPj&t$$jу yt& VPj+t$$j D$ WS:D$D$11ED}T$K 0GPP4FP;PPjTt$4jT$8҃09&K‹T$D$CT$F D$2@G>4FFPPQVPj1t$$jD$(Ѓ ?&D L$7F>4FL$u PPRVPjj&t$4jу0v' Ct$ t$Pj9t$$j D$D$ WR|$l|$8t$H Vt$Tt$Tt$TWP t&D D$2E>4F PPQVPjj1t$4jD$8Ѓ0t&t$PDjj5t$$j t$t$PDjj9t$$j D$D$t&DT$I 05E$P4FP;PPjjTt$4jT$8҃0t&jjP6dumpconfig.ccurrent--atversion requires --type2.02.111(2) (2014-09-01)%u.%u.%uIncorrect version format.Failed to load profile %s.LVM configuration valid.LVM configuration invalid.diffprofilableprofilable-commandprofilable-metadataOnly one of --type and --validate permitted.--atversion has no effect with --type current--ignoreadvanced and --ignoreunsupported has no effect with --type current--mergedconfig has no effect without --type currentFailed to merge configuration.Incorrect type of configuration specified. Expected one of: current, default, missing, new, profilable, profilable-command, profilable-metadata.raid1lvchange.c%s:yProblem reactivating %score-logged disk-logged metadata areaFailed to clear %s %s for %sClearing %s device %sdoes not (inherited)Unable to change pvmove LV %s and %u other snapshot(s)Failed to prepare message.Failed to lock %s%s device number not changed.Ensuring %s is inactive.%s: deactivation failed%s: reactivation failedProblem reactivating %s.Logical volume "%s" changed.--write%s can only be used with 'raid1' segment type%s not found in volume group, %sUpdating writemostly for "%s" in kernelUpdating logical volume "%s" on disk(s)Unable to resync %s. It is not RAID or mirrored.Unable to resync pvmove volume %sUnable to resync locked volume %sCan't resync open logical volume "%s"Do you really want to deactivate logical volume %s to resync it? [y/n]: Logical volume "%s" not resyncedRAID logical volume %s/%s cannot be active remotely.Unable to deactivate %s for resyncCan't get exclusive access to clustered volume %sStarting resync of %s%s%s%s "%s"Failed to update metadata on disk.Failed to reactivate %s to resynchronize mirrorFailed to write intermediate VG metadata.Failed to commit intermediate VG metadata.Unable to activate %s for %s clearingUnable to reset sync status for %sFailed to deactivate log LV after wiping failedUnable to deactivate %s LV %s after wiping for resyncFailed to reattach %s device after clearingFailed to reactivate %s after resyncOnly -a permitted with read-only volume group "%s"Can't change logical volume "%s" under snapshotUse 'pvmove --abort' to abandon a pvmoveUnable to change mirror log LV %s directlyUnable to change mirror image LV %s directlyUnable to change internal LV %s directlyChange of snapshot %s will also change its origin %s%s. Proceed? [y/n]: Logical volume %s not changed.Logical volume "%s" is already writableLogical volume "%s" is already read onlyCannot change permissions of external origin "%s".Cannot change permissions of mirror "%s" while active.Cannot change permissions of RAID %s "%s"Change permissions of thin pool "%s" not yet supported.Setting logical volume "%s" read/writeSetting logical volume "%s" read-onlyUpdating permissions for "%s" in kernelAllocation policy of logical volume "%s" is already %sSetting contiguous allocation policy for "%s" to %sMetadata only supports readahead values between 2 and 120.WARNING: Overriding readahead to %u sectors, a multiple of %uK page size.Read ahead is already auto for "%s"Read ahead is already %u for "%s"Setting read ahead to %u for "%s"Minor number is already not persistent for "%s"Disabling persistent device number for "%s"Minor number must be specified with -MyOption -j/--major may not be repeated.Option --minor may not be repeated.Major number must be specified with -MyLogical volume %s will be deactivated temporarily. Continue? [y/n]: Setting persistent device number to (%d, %d) for "%s"Re-activating logical volume "%s"Logical volume "%s" is not a thin pool.Cannot change support for discards while pool volume "%s" is active.Logical volume "%s" already uses --discards %s.Logical volume "%s" already %szero new blocks.Updating logical volume "%s" on disk(s).Failed to update active %s/%s (deactivation is needed).Unable to change the recovery rate of non-RAID logical volume.Minumum recovery rate cannot be higher than maximum.Updating recovery rate for "%s" in kernelChanging configuration profile for LV %s: %s -> %s.Changing activation skip flag to %s for LV %s.Refreshing logical volume "%s" (if active)Logical volume, %s, is not activeNeed 1 or more of -a, -C, -M, -p, -r, -Z, --resync, --refresh, --alloc, --addtag, --deltag, --monitor, --poll or --discardsOnly one of --metadataprofile and --detachprofile permitted.Only one of -a and --refresh permitted.Only -a permitted with --ignorelockingfailure and --sysinitPlease give logical volume path(s)--major and --minor require -MyOnly give one logical volume when specifying minorOnly one of --alloc and --contiguous permittedOnly one of --poll and --sysinit permittedlvmetad is not active yet, using direct activation during sysinitlvmetad is active, skipping direct activation during sysinit%s: Failed query for merging percentage. Aborting merge.%s: Merging snapshot invalidated. Aborting merge.%s: Merge failed. Retry merge or inspect manually.Allocation of list of failed_pvs failed.Allocation of failed_pvs list entry failed.lvconvert: layer name allocation failed.lvconvert: layer name generation failed.%d missing and now unallocated Physical Volumes removed from VG.Failed to remove temporary sync layer.Failed to swap %s with merging %s.Logical volume %s has no merging snapshot.Merge of snapshot into logical volume %s has finished.Could not remove snapshot %s merged into %s.Converting thin%s segment type for "%s/%s" to %s is not supported.For pool data volume conversion use "%s/%s".For pool metadata volume conversion use "%s/%s".Thin repair commnand is not configured. Repair is disabled.Failed to build thin metadata path.Failed to build pool metadata spare path.Invalid string in config file: global/thin_repair_optionsFailed to duplicate thin repair string.Too many options for thin repair command.Only inactive pool can be repaired.Cannot activate pool metadata spare volume %s.Cannot activate thin pool metadata volume %s.Repair of thin metadata volume of thin pool %s/%s failed (status:%d). Manual repair required!WARNING: Cannot read output from %s %s.Transaction id %llu from pool "%s/%s" does not match repaired transaction id %llu from %s.Cannot deactivate thin pool metadata volume %s.Can't prepare new metadata name for %s.Can't generate new name for %s.WARNING: If everything works, remove "%s/%s".WARNING: Use pvmove command to move "%s/%s" on the best fitting PV.Mirror logical volumes cannot be used for pool metadata.Can't use same LV for pool data and metadata LV %s.Can't use thin or cache type LV %s for pool metadata.Logical volume %s is too small for metadata.Mirror logical volumes cannot be used as pools. Try "raid1" segment type instead.Failed to create internal lv names, pool name is too long.--%s and pool metadata swap is not supported.Cannot convert pool %s with active volumes.Chunk size can be only changed with --force. Conversion aborted.WARNING: Changing chunk size %s to %s for %s pool volume.Do you really want to change chunk size for %s pool volume? [y/n]: Do you want to swap metadata of %s pool with metadata volume %s? [y/n]: Can't use thin type logical volume %s for thin pool data.Do you really want to convert %s%s%s? [y/n]: Aborting. Failed to deactivate %s.Aborting. Failed to activate metadata lv.Aborting. Failed to wipe metadata lv.Aborting. Failed to deactivate metadata lv. Manual intervention required.Aborting. Failed to deactivate logical volume %s.WARNING: Pool zeroing and large %s chunk size slows down provisioning.Failed to activate pool logical volume %s.Failed to deactivate pool data logical volume.Failed to deactivate pool metadata logical volume.WARNING: Converting logical volume %s%s%s to pool's data%s.THIS WILL DESTROY CONTENT OF LOGICAL VOLUME (filesystem etc.)Please use a single volume group name ("%s" or "%s")Logical volume %s is already not mirrored.Can't add mirror to out-of-sync mirrored LV: use lvchange --resync first.Can't add additional mirror images to mirrors that are under snapshots%s is already being converted. Unable to start another conversion.ABORTING: Failed to remove temporary mirror layer %s.Manual cleanup with vgcfgrestore and dmsetup may be required.--trackchanges is not available to 'mirror' segment typeInternal error: Name "%s/%s" is too long.Conversion starts after activation.Unable to merge mirror imagesof segment type 'mirror'Mirror segment type cannot be used for thinpool%s. Try "raid1" segment type instead.Only up to %d images in mirror supported currently.Unable to reduce images by specified amount - only %d in %sAdjusting mirror image count of %sLog type, "mirrored", is unavailable to cluster mirrorsMirror log region size cannot be changed on an existing mirror.Logical volume %s has multiple mirror segments.Cannot both allocate and free extents when specifying physical volumes to use.Please specify the operation in two steps.%s is consistent. Nothing to repair.Mirror status: %d of %d images failed.Mirror log status: %d of %d images failed.Attempt to replace failed mirror log? [y/n]: Attempt to replace failed mirror images (requires full device resync)? [y/n]: Trying to up-convert to %d images, %d logs.WARNING: Failed to replace %d of %d images in volume %sWARNING: Failed to replace %d of %d logs in volume %sCan't convert snapshot logical volume "%s"Unable to convert pvmove LV %sUnable to split LV %s/%s that is a snapshot origin.Unable to split off snapshot %s/%s being merged into its origin.Unable to split off snapshot %s/%s with virtual origin.Unable to split off LV %s/%s needed by thin volume(s).Unable to split off snapshot %s/%s using old LVM1-style metadata.LV %s/%s type is unsupported with --splitsnapshot.Do you really want to split off active logical volume %s? [y/n]: Splitting snapshot %s/%s from its origin.Logical Volume %s/%s split from its origin.Can't repair LV "%s" of segtype %s."%s" is not a mergeable logical volume.Snapshot %s is already merging into the origin."%s" is read-only external origin "%s".Merging into the old snapshot origin %s is not supported.Delaying merge since snapshot is open.Delaying merge since origin volume is open.Failed to reactivate origin %s.Merging of thin snapshot %s will occur on next activation of %s.Snapshot %s is already merging.Snapshot %s has virtual origin.Cannot merge snapshot "%s" into the read-only external origin "%s".Unable to merge invalidated snapshot LV "%s".Can't merge over open origin volume.Can't merge when snapshot is open.Can't initialize snapshot merge. Missing support in kernel?Merging of snapshot %s will occur on next activation of %s.Unable to merge LV "%s" into its origin.Unable to convert mirrored LV "%s" into a snapshot.Unable to convert origin "%s" into a snapshot.Couldn't find origin volume %s.Unable to use %s as both snapshot and origin.Unable to convert an LV into a snapshot of a %s LV.WARNING: Converting logical volume %s to snapshot exception store.Do you really want to convert %s? [y/n]: Aborting. Failed to wipe snapshot exception store.Failed to deactivate zeroed snapshot exception store.Logical volume %s converted to snapshot.Can't use same LV %s for thin pool and thin volume.Can't use pool %s as external origin.Aborting. Unable to deactivate new LV. Manual intervention required.Converted %s to thin volume with external origin %s.Unable to deactivate failed new LV. Manual intervention required.Manual intervention may be required to remove abandoned LV(s) before retrying.Can't use same LV %s for cache pool and cache volume.Can't cache pool or cache type volume %s.Logical volume %s is now cached.'--mirrors/-m' is not compatible with %sUnable to convert %s/%s from %s to %sUnable to %s images by specified amount%s/%s must be active %sto perform this operation.Unable to determine sync status of %s/%s.WARNING: %s/%s is not in-sync.WARNING: Portions of the array may be unrecoverable.Attempt to replace failed RAID images (requires full device resync)? [y/n]: Failed to replace faulty devices in %s/%s.Faulty devices in %s/%s successfully replaced.Use 'lvconvert --repair %s/%s' to replace failed device.Conversion operation not yet supported.ABORTING: Can't reread LV %s/%sABORTING: Can't relock VG for %s after polling finished--type mirror requires -m/--mirrorsConversion using --type %s is not supported.--mirrorlog and --corelog are incompatible.cannot be used with --splitsnapshot--snapshot/--type snapshot or --merge argument cannot be mixed with --mirrors/--type mirror/--type raid*, --mirrorlog, --repair or --thinpool.--stripes or --stripesize argument is only valid with --mirrors/--type mirror/--type raid*, --repair and --thinpool--cache is incompatible with --type %s--thin is incompatible with --type %s--cachepool argument is only valid with the cache or cache-pool segment type.--thinpool argument is only valid with the thin or thin-pool segment type.is invalid with --poolmetadataPlease specify the pool data LV.--snapshot and --merge are mutually exclusive.--mirrors/--type mirror/--type raid* and --splitmirrors are mutually exclusive.Please name the new logical volume using '--name'The 'name' argument is only valid with --splitmirrorsPlease provide logical volume path for snapshot origin.--regionsize is only available with mirrors--stripes and --stripesize are only available with striped mirrorsNegative chunk size is invalid.Chunk size must be a power of 2 in the range 4K to 512KFailed to get '--replace' argument--chunksize is only available with snapshots or pools.--zero is only available with snapshots or thin pools.Negative regionsize is invalidNegative regionsize in configuration file is invalidRegion size (%u) must be a multiple of machine memory page size (%d)Region size (%u) must be a power of 2Non-zero region size must be supplied.%s: Required device-mapper target(s) not detected in your kernelPlease specify a logical volume path.Logical volume name for caching is missing.Please specify a logical volume to act as the external origin.Please specify a logical volume to act as the snapshot exception store.Please provide logical volume path.Please provide a valid volume group nameToo many arguments provided for snapshots.Too many arguments provided with --splitsnapshot.Too many arguments provided for pool.is valid only with cache poolslvconvert.c%s: %s: %.1f%%%s_mimage_%%d_mimagetmp_%dlayer name allocation failed.Failed to insert resync layerUpdating "%s" in kernelLogical volume %s converted.LV %s is not merged.-i-otransaction="%s_meta%%d_cmeta_cdata_tdata and Unknown pool data LV %s.Unknown pool metadata LV %s.Can't convert internal LV %s.Can't convert locked LV %s.is invalid with existing poolConversion aborted.Continuing with swap...pvmove_tmetaCreation of pool LV failed.Converted %s to %s pool. and metadata volumesraidmirrorCan't find LV %s in VG %sMergedConvertedNo usable images left in %s. metadatacoremirroredUnknown mirrorlog type: %sSetting logging type to %spvmoveexclusive locally Cannot convert locked LV %s%s/%s is not a snapshot.Logical volume %s not split.Failed to suspend origin %s.Merging of volume %s started.Couldn't deactivate LV %s.WARNING: "%s" not zeroedCouldn't create snapshot.allocatethin-poolcache-poolcannot be used with --repair--cache requires --cachepool.is valid only with thin pools--thin requires --thinpool.is invalid with poolsis valid only with pools_rimage_cannot be used with --mergeSetting chunk size to %s.stripedBInconsistent volume group names given: "%s" and "%s"Please specify a logical volume to act as the origin or cache_pool.The origin or cache_pool name should include the volume group.Please specify a logical volume to act as the snapshot origin.The origin name should include the volume group.The pool name should include the volume group.Please provide a volume group nameVolume group name expected (no slash)Volume group name %s has invalid charactersLogical volume name "%s" is invalidLogical volume name %s and pool name %s must be different.--thin, --thinpool and --mirrors are incompatible.Unable to create LV with unknown segment type %s.--thin and --snapshot are incompatible.Snapshots are incompatible with pool segment_type.Mirrors argument may not be negativeOnly up to 8 images in mirror supported currently.--mirrors must be at least 1 with segment type %s.Redundant mirrors argument: default is 0RAID10 currently supports only 2-way mirroring (i.e. '-m 1')-Z is incompatible with snapshotsmirrors and snapshots are currently incompatible--corelog is only available with mirrors--mirrorlog is only available with mirrors--nosync is only available with mirrors%s: Required device-mapper target(s) not detected in your kernel.RAID module does not support RAID10.Please specify either size or extents (not both)Please specify either size or extentsNegative number of extents is invalid--poolmetadatasize may only be specified when allocating the pool.Virtual size in incompatible with thin_pool segment type.Negative virtual origin size is invalidVirtual origin size may not be zeroPlease use only one of --mirrorlog or --corelogLog options not applicable to %s segtypeSegment type 'raid10' requires 2 or more stripes.Mirror argument cannot be used with segment type, %sStripe argument cannot be used with segment type, %sInternal error: region_size not set.Minimum recovery rate cannot be higher than maximum.Chunk size must be a power of 2 in the range 4K to 512K.--chunksize is only available with snapshots and pools.--poolmetadataspare is only available with pool creation.Conflicting contiguous and alloc argumentsUnable to allocate memory for tag %sSnapshot origin LV %s not found in Volume group %s.Snapshot of cache LV is not yet supported.Please specify either size or extents with snapshots.Please specify device size(s).Please either create snapshot or thin volume.%s is only available for thin pool creation.Only specify Physical volumes when allocating the thin pool.Please specify name of existing thin pool.Thin pool %s not found in Volume group %s.Logical volume %s is not a thin pool.Thin pool %s already exists in Volume group %s.--name may only be given when creating a new thin Logical volume or snapshot.--readhead may only be given when creating a new thin Logical volume or snapshot.--permission may only be given when creating a new thin Logical volume or snapshot.--persistent may only be given when creating a new thin Logical volume or snapshot.Internal error: Origin LV is not defined.Number of stripes must be at least %d for %sUnable to create RAID10 LV, insufficient number of devices.--activate n requires --zero n-Z and -W is incompatible with --activate a--persistent is not permitted when creating a thin pool device.Please specify minor number with --minor when using -MyPlease specify major number with --major when using -MyIgnoring supplied major number - kernel assigns major numbers dynamically. Using major number %d instead.--major and --minor incompatible with -Mn--setactivationskip y requires either --zero n or --ignoreactivationskipPlease express size as %s%%VG, %%PVS, or %%FREE.Couldn't find origin volume '%s'.Internal error: Unsupported percent type %u.Internal error: Missing snapshot chunk size.Reducing COW size %s down to maximum usable size %s.Rounding size (%d extents) down to stripe boundary size (%d extents)Not enough space for thin pool creation.Internal error: --thinpool not identified.Internal error: Inconsistent snapshot and origin parameters identified.Internal error: Failed to identify what type of thin target to use.Internal error: Thin volume cannot be created with thin pool segment type.Making thin pool %s in VG %s using segtype %sMaking thin LV %s in pool %s in VG %s%s%s using segtype %sInternal error: Couldn't find origin volume.Converted %u%%%s into %u extents.lvcreate.c%ORIGIN, with generated name as snapshot of raid10Negative size is invalidSetting chunksize to %s.Finding volume group "%s"Failed to get tag2.4.hl><=vuIncompatible options selectedlvdisplay.cIncompatible options selected.Options -c and -m are incompatible.With LVM2 and the device mapper, this program is obsolete.lvmchange.cCommand not implemented yet.stub.hAvailable lvm commands:lvmcmdline.c%-16.16s%sPVSFFRORIGINunmanagedLVM version: %sLibrary version: %sDriver version: %s/proc/%u/cmdline%s%s%s failed: %s/proc/self/fd/%u Parent PID %d: %s %s.lvm1execvp -Unrecognised option.Option requires argument.Invalid argument for %s: %skmgtpebsSize is too big (>=16EiB).noneCouldn't allocate memory.Out of memory.%s: no such command.%s: %s %sOption %s %s.devtypesDump configurationdumpconfigformats formatshelp Display help for commandslvchangeChange logical volume layoutlvconvertCreate a logical volumelvcreatelvdisplayAdd space to a logical volumelvextendlvmchangelvmdiskscanCollect activity datalvmsadcCreate activity reportlvmsarlvreducelvremoveRename a logical volumelvrenameResize a logical volumelvresizelvslvscanpvchangeResize physical volume(s)pvresizepvckpvcreatepvdatapvdisplaypvremovepvsList all physical volumespvscansegtypes List available segment typestags vgcfgbackupvgcfgrestorevgchangevgckvgconvertCreate a volume groupvgcreatevgdisplayvgexportvgextendvgimportMerge volume groupsvgmergevgmknodesvgreduceRemove volume group(s)vgremoveRename a volume groupvgrenamevgsSearch for all volume groupsvgscanvgsplitversion degradedCouldn't copy command line.Parsing: %scompleteInvalid units specificationProcessing: %sO_DIRECT will be usedCompleted: %slvm.staticinitrd-lvm/dev/nullstdin stream openstdin stream open: %s stdout stream openstderr stream open: %s opendirgetrlimitRLIMIT_NOFILEclosedir/sbin/lvmLVM_DID_EXECLVM_SHARED_PATHunsetenvPlease supply an LVM command.Too many arguments: %squitexitfcloseNo such command. Try 'help'.LVM_SUPPRESS_FD_WARNINGS--version--setphysicalvolumesize--ignorelockingfailure--nolocking--pvmetadatacopies--vgmetadatacopies--metadatacopies--metadatasize--metadataignore--bootloaderareasize--norestorefile--restorefile--labelsector--driverloaded--aligned--binary--unbuffered--noheadings--segments--units--nosuffix--removemissing--restoremissing--abort--addtag--deltag--refresh--mknodes--minor--alloc--separator--mirrorsonly--nosync--resync--corelog--mirrorlog--splitmirrors--trackchanges--replace--use-policies--monitor--config--trustcache--cache--cachemode--cachepool--ignoremonitoring--nameprefixes--unquoted--rows--dataalignment--dataalignmentoffset--virtualoriginsize--noudevsync--originname--poll--poolmetadata--poolmetadatasize--poolmetadataspare--discards--force--stripes--sysinit--thinpool--withcomments--withversions--ignoreadvanced--ignoreunsupported--atversion--validate--syncaction--raidsyncaction--writemostly--raidwritemostly--writebehind--raidwritebehind--minrecoveryrate--raidminrecoveryrate--maxrecoveryrate--raidmaxrecoveryrate--commandprofile--metadataprofile--profile--detachprofile--mergedconfig--ignoreskippedcluster--splitsnapshot--readonly--atomic--activationmode--resizable--allocation--available--activate--all--autobackup--activevolumegroups--background--blockdevice--chunksize--clustered--colon--columns--contiguous--debug--exported--physicalextent--file--full--help--stripesize--interval--iop_version--logicalvolume--maxlogicalvolumes--extents--lvmpartition--list--size--logicalextent--persistent--major--setactivationskip--ignoreactivationskip--mirrors--metadatatype--maps--name--oldpath--nofsck--novolumegroup--options--sort--permission--maxphysicalvolumes--partial--physicalvolume--quiet--readahead--resizefs--reset--regionsize--physicalextentsize--stdin--snapshot--short--select--thin--test--uuid--uuidlist--verbose--volumegroup--virtualsize--wipesignatures--allocatable--resizeable--yes--zeroThere's no 'pvdata' command in LVM2.Use lvs, pvs, vgs instead; or use vgcfgbackup and read the text file backup.Metadata in LVM1 format can still be displayed using LVM1's pvdata command.Use 'lvm help ' for more informationFile descriptor %d (%s) leaked on %s invocation.Close failed on stray file descriptor %d (%s): %sFailed to create LVM1 tool pathnameWARNING: Running as a non-root user. Functionality may be unavailable.Unable to allocate memory for command line arguments.Option%s%c%s%s may not be repeated.Size is not a multiple of 512. Try using %llu or %llu.%s and %s are synonyms. Please only supply one.Major number outside range 0-255Minor number outside range 0-255Major number outside range 0-4095Minor number outside range 0-1048575devtypes [--aligned] [--binary] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--nameprefixes] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [--rows] [-S|--select Selection] [--separator Separator] [--unbuffered] [--unquoted] [--version] Display recognised built-in block device typesdumpconfig [-f|--file filename] [--type {current|default|diff|missing|new|profilable|profilable-command|profilable-metadata} [--atversion version]] [--ignoreadvanced] [--ignoreunsupported] [--config ConfigurationString] [--commandprofile ProfileName] [--profile ProfileName] [--metadataprofile ProfileName] [--mergedconfig] [--validate] [--withcomments] [--withversions] [ConfigurationNode...] List available metadata formatslvchange [-A|--autobackup y|n] [-a|--activate [a|e|l]{y|n}] [--activationmode {complete|degraded|partial} [--addtag Tag] [--alloc AllocationPolicy] [-C|--contiguous y|n] [--commandprofile ProfileName] [-d|--debug] [--deltag Tag] [--detachprofile] [-f|--force] [-h|--help] [--discards {ignore|nopassdown|passdown}] [--ignorelockingfailure] [--ignoremonitoring] [--ignoreskippedcluster] [-k|--setactivationskip {y|n}] [-K|--ignoreactivationskip] [--monitor {y|n}] [--poll {y|n}] [--noudevsync] [-M|--persistent y|n] [--major major] [--minor minor] [--metadataprofile ProfileName] [-P|--partial] [-p|--permission r|rw] [--[raid]minrecoveryrate Rate] [--[raid]maxrecoveryrate Rate] [--[raid]syncaction {check|repair} [--[raid]writebehind IOCount] [--[raid]writemostly PhysicalVolume[:{t|n|y}]] [-r|--readahead ReadAheadSectors|auto|none] [--refresh] [--resync] [--sysinit] [-t|--test] [-v|--verbose] [--version] [-y|--yes] [-Z|--zero {y|n}] LogicalVolume[Path] [LogicalVolume[Path]...] Change the attributes of logical volume(s)lvconvert [-m|--mirrors Mirrors [{--mirrorlog {disk|core|mirrored}|--corelog}]] [--type SegmentType] [--repair [--use-policies]] [--replace PhysicalVolume] [-R|--regionsize MirrorLogRegionSize] [--alloc AllocationPolicy] [-b|--background] [-f|--force] [-i|--interval seconds] [--stripes Stripes [-I|--stripesize StripeSize]] [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] [-y|--yes] LogicalVolume[Path] [PhysicalVolume[Path]...] lvconvert [--splitmirrors Images --trackchanges] [--splitmirrors Images --name SplitLogicalVolumeName] [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] [-y|--yes] LogicalVolume[Path] [SplittablePhysicalVolume[Path]...] lvconvert --splitsnapshot [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] [-y|--yes] SnapshotLogicalVolume[Path] lvconvert [--type snapshot|-s|--snapshot] [-c|--chunksize] [-Z|--zero {y|n}] [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] [-y|--yes] OriginalLogicalVolume[Path] SnapshotLogicalVolume[Path] lvconvert --merge [-b|--background] [-i|--interval seconds] [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] [-y|--yes] LogicalVolume[Path] lvconvert [--type thin[-pool]|-T|--thin] [--thinpool ThinPoolLogicalVolume[Path]] [--chunksize size] [--discards {ignore|nopassdown|passdown}] [--poolmetadataspare {y|n}] [--poolmetadata ThinMetadataLogicalVolume[Path] | [--poolmetadatasize size] [-r|--readahead ReadAheadSectors|auto|none] [--stripes Stripes [-I|--stripesize StripeSize]]] [--originname NewExternalOriginVolumeName]] [-Z|--zero {y|n}] [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] [-y|--yes] [ExternalOrigin|ThinDataPool]LogicalVolume[Path] lvconvert [--type cache[-pool]|--cache] [--cachepool CacheDataLogicalVolume[Path]] [--cachemode CacheMode] [--chunksize size] [--poolmetadataspare {y|n}]] [--poolmetadata CacheMetadataLogicalVolume[Path] | [--poolmetadatasize size] [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] [-y|--yes] [Cache|CacheDataPool]LogicalVolume[Path] lvcreate [-A|--autobackup {y|n}] [-a|--activate [a|e|l]{y|n}] [--addtag Tag] [--alloc AllocationPolicy] [--cachemode CacheMode] [-C|--contiguous {y|n}] [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [--ignoremonitoring] [--monitor {y|n}] [-i|--stripes Stripes [-I|--stripesize StripeSize]] [-k|--setactivationskip {y|n}] [-K|--ignoreactivationskip] {-l|--extents LogicalExtentsNumber[%{VG|PVS|FREE}] | -L|--size LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [-M|--persistent {y|n}] [--major major] [--minor minor] [--metadataprofile ProfileName] [-m|--mirrors Mirrors [--nosync] [{--mirrorlog {disk|core|mirrored}|--corelog}]] [-n|--name LogicalVolumeName] [--noudevsync] [-p|--permission {r|rw}] [--[raid]minrecoveryrate Rate] [--[raid]maxrecoveryrate Rate] [-r|--readahead ReadAheadSectors|auto|none] [-R|--regionsize MirrorLogRegionSize] [-T|--thin [-c|--chunksize ChunkSize] [--discards {ignore|nopassdown|passdown}] [--poolmetadatasize MetadataSize[bBsSkKmMgG]]] [--poolmetadataspare {y|n}] [--thinpool ThinPoolLogicalVolume{Name|Path}] [-t|--test] [--type VolumeType] [-v|--verbose] [-W|--wipesignatures {y|n}] [-Z|--zero {y|n}] [--version] VolumeGroupName [PhysicalVolumePath...] lvcreate { {-s|--snapshot} OriginalLogicalVolume[Path] | [-s|--snapshot] VolumeGroupName[Path] -V|--virtualsize VirtualSize} {-T|--thin} VolumeGroupName[Path][/PoolLogicalVolume] -V|--virtualsize VirtualSize} [-c|--chunksize] [-A|--autobackup {y|n}] [--addtag Tag] [--alloc AllocationPolicy] [-C|--contiguous {y|n}] [--commandprofile ProfileName] [-d|--debug] [--discards {ignore|nopassdown|passdown}] [-h|-?|--help] [--ignoremonitoring] [--monitor {y|n}] [-i|--stripes Stripes [-I|--stripesize StripeSize]] [-k|--setactivationskip {y|n}] [-K|--ignoreactivationskip] {-l|--extents LogicalExtentsNumber[%{VG|FREE|ORIGIN}] | -L|--size LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [--poolmetadatasize MetadataVolumeSize[bBsSkKmMgG]] [-M|--persistent {y|n}] [--major major] [--minor minor] [--metadataprofile ProfileName] [-n|--name LogicalVolumeName] [--noudevsync] [-p|--permission {r|rw}] [-r|--readahead ReadAheadSectors|auto|none] [-t|--test] [--thinpool ThinPoolLogicalVolume[Path]] [-v|--verbose] [--version] [PhysicalVolumePath...] lvdisplay [-a|--all] [-c|--colon] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--ignoreskippedcluster] [-m|--maps] [--nosuffix] [-P|--partial] [--readonly] [--units hHbBsSkKmMgGtTpPeE] [-v|--verbose] [--version] [LogicalVolume[Path] [LogicalVolume[Path]...]] lvdisplay --columns|-C [--aligned] [-a|--all] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--ignoreskippedcluster] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-S|--select Selection] [-P|--partial] [--readonly] [--segments] [--separator Separator] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [-v|--verbose] [--version] [LogicalVolume[Path] [LogicalVolume[Path]...]] Display information about a logical volumelvextend [-A|--autobackup y|n] [--alloc AllocationPolicy] [--commandprofile ProfileName] [-d|--debug] [-f|--force] [-h|--help] [-i|--stripes Stripes [-I|--stripesize StripeSize]] {-l|--extents [+]LogicalExtentsNumber[%{VG|LV|PVS|FREE|ORIGIN}] | -L|--size [+]LogicalVolumeSize[bBsSkKmMgGtTpPeE]} --poolmetadatasize [+]MetadataVolumeSize[bBsSkKmMgG]} [-m|--mirrors Mirrors] [--nosync] [--use-policies] [-n|--nofsck] [--noudevsync] [-r|--resizefs] [-t|--test] [--type VolumeType] [-v|--verbose] [--version] LogicalVolume[Path] [ PhysicalVolumePath... ] lvmchange [--commandprofile ProfileName] [-d|--debug] [-h|--help] [-R|--reset] [-v|--verbose] [--version] With the device mapper, this is obsolete and does nothing.lvmdiskscan [--commandprofile ProfileName] [-d|--debug] [-h|--help] [-l|--lvmpartition] [--readonly] [--version] List devices that may be used as physical volumeslvmsadc [--commandprofile ProfileName] [-d|--debug] [-h|--help] [-v|--verbose] [--version] [LogFilePath] lvmsar [--commandprofile ProfileName] [-d|--debug] [-f|--full] [-h|--help] [-s|--stdin] [-v|--verbose] [--version] LogFilePath lvreduce [-A|--autobackup y|n] [--commandprofile ProfileName] [-d|--debug] [-f|--force] [-h|--help] {-l|--extents [-]LogicalExtentsNumber[%{VG|LV|FREE|ORIGIN}] | -L|--size [-]LogicalVolumeSize[bBsSkKmMgGtTpPeE]} [-n|--nofsck] [--noudevsync] [-r|--resizefs] [-t|--test] [-v|--verbose] [--version] [-y|--yes] LogicalVolume[Path] Reduce the size of a logical volumelvremove [-A|--autobackup y|n] [--commandprofile ProfileName] [-d|--debug] [-f|--force] [-h|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] LogicalVolume[Path] [LogicalVolume[Path]...] Remove logical volume(s) from the systemlvrename [-A|--autobackup {y|n}] [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] { OldLogicalVolumePath NewLogicalVolumePath | VolumeGroupName OldLogicalVolumeName NewLogicalVolumeName } lvresize [-A|--autobackup y|n] [--alloc AllocationPolicy] [--commandprofile ProfileName] [-d|--debug] [-f|--force] [-h|--help] [-i|--stripes Stripes [-I|--stripesize StripeSize]] {-l|--extents [+|-]LogicalExtentsNumber[%{VG|LV|PVS|FREE|ORIGIN}] | -L|--size [+|-]LogicalVolumeSize[bBsSkKmMgGtTpPeE]} --poolmetadatasize [+]MetadataVolumeSize[bBsSkKmMgG]} [-n|--nofsck] [--noudevsync] [-r|--resizefs] [-t|--test] [--type VolumeType] [-v|--verbose] [--version] LogicalVolume[Path] [ PhysicalVolumePath... ] lvs [-a|--all] [--aligned] [--binary] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--ignoreskippedcluster] [--nameprefixes] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--readonly] [--rows] [--segments] [-S|--select Selection] [--separator Separator] [--trustcache] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [--unquoted] [-v|--verbose] [--version] [LogicalVolume[Path] [LogicalVolume[Path]...]] Display information about logical volumeslvscan [-a|--all] [-b|--blockdevice] [--cache] [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [--ignorelockingfailure] [-P|--partial] [--readonly] [-v|--verbose] [--version] List all logical volumes in all volume groupspvchange [-a|--all] [-A|--autobackup y|n] [--commandprofile ProfileName] [-d|--debug] [-f|--force] [-h|--help] [-t|--test] [-u|--uuid] [-x|--allocatable y|n] [--metadataignore y|n] [-v|--verbose] [--addtag Tag] [--deltag Tag] [--version] [PhysicalVolumePath...] Change attributes of physical volume(s)pvresize [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [--setphysicalvolumesize PhysicalVolumeSize[bBsSkKmMgGtTpPeE] [-t|--test] [-v|--verbose] [--version] PhysicalVolume [PhysicalVolume...] pvck [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--labelsector sector] [-v|--verbose] [--version] PhysicalVolume [PhysicalVolume...] Check the consistency of physical volume(s)pvcreate [--norestorefile] [--restorefile file] [--commandprofile ProfileName] [-d|--debug] [-f[f]|--force [--force]] [-h|-?|--help] [--labelsector sector] [-M|--metadatatype 1|2] [--pvmetadatacopies #copies] [--bootloaderareasize BootLoaderAreaSize[bBsSkKmMgGtTpPeE]] [--metadatasize MetadataSize[bBsSkKmMgGtTpPeE]] [--dataalignment Alignment[bBsSkKmMgGtTpPeE]] [--dataalignmentoffset AlignmentOffset[bBsSkKmMgGtTpPeE]] [--setphysicalvolumesize PhysicalVolumeSize[bBsSkKmMgGtTpPeE] [-t|--test] [-u|--uuid uuid] [-v|--verbose] [-y|--yes] [-Z|--zero {y|n}] [--version] PhysicalVolume [PhysicalVolume...] Initialize physical volume(s) for use by LVMpvdata [-a|--all] [--commandprofile ProfileName] [-d|--debug] [-E|--physicalextent] [-h|-?|--help] [-L|--logicalvolume] [-P[P]|--physicalvolume [--physicalvolume]] [-U|--uuidlist] [-v[v]|--verbose [--verbose]] [-V|--volumegroup] [--version] PhysicalVolume [PhysicalVolume...] Display the on-disk metadata for physical volume(s)pvdisplay [-c|--colon] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--ignoreskippedcluster] [-m|--maps] [--nosuffix] [--readonly] [-s|--short] [--units hHbBsSkKmMgGtTpPeE] [-v|--verbose] [--version] [PhysicalVolumePath [PhysicalVolumePath...]] pvdisplay --columns|-C [--aligned] [-a|--all] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--ignoreskippedcluster] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-S|--select Selection] [--readonly] [--separator Separator] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [-v|--verbose] [--version] [PhysicalVolumePath [PhysicalVolumePath...]] Display various attributes of physical volume(s)pvmove [--abort] [--alloc AllocationPolicy] [--atomic] [-A|--autobackup {y|n}] [-b|--background] [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [-i|--interval seconds] [--noudevsync] [-t|--test] [-v|--verbose] [--version] [{-n|--name} LogicalVolume] SourcePhysicalVolume[:PhysicalExtent[-PhysicalExtent]...]} [DestinationPhysicalVolume[:PhysicalExtent[-PhysicalExtent]...]...] Move extents from one physical volume to anotherpvremove [--commandprofile ProfileName] [-d|--debug] [-f[f]|--force [--force]] [-h|-?|--help] [-t|--test] [-v|--verbose] [--version] [-y|--yes] PhysicalVolume [PhysicalVolume...] Remove LVM label(s) from physical volume(s)pvs [-a|--all] [--aligned] [--binary] [--commandprofile ProfileName] [-d|--debug] [-h|-?|--help] [--ignorelockingfailure] [--ignoreskippedcluster] [--nameprefixes] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--readonly] [--rows] [--segments] [-S|--select Selection] [--separator Separator] [--trustcache] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [--unquoted] [-v|--verbose] [--version] [PhysicalVolume [PhysicalVolume...]] Display information about physical volumespvscan [-b|--background] [--cache [-a|--activate ay] [ DevicePath | --major major --minor minor]...] [--commandprofile ProfileName] [-d|--debug] {-e|--exported | -n|--novolumegroup} [-h|-?|--help] [--ignorelockingfailure] [-P|--partial] [--readonly] [-s|--short] [-u|--uuid] [-v|--verbose] [--version] List tags defined on this hostvgcfgbackup [--commandprofile ProfileName] [-d|--debug] [-f|--file filename] [-h|-?|--help] [--ignorelockingfailure] [-P|--partial] [--readonly] [-v|--verbose] [--version] [VolumeGroupName...] Backup volume group configuration(s)vgcfgrestore [--commandprofile ProfileName] [-d|--debug] [-f|--file filename] [--force] [-l[l]|--list [--list]] [-M|--metadatatype 1|2] [-h|--help] [-t|--test] [-v|--verbose] [--version] VolumeGroupNameRestore volume group configurationvgchange [-A|--autobackup {y|n}] [--alloc AllocationPolicy] [-P|--partial] [--commandprofile ProfileName] [-d|--debug] [--detachprofile] [-h|--help] [--ignorelockingfailure] [--ignoremonitoring] [--ignoreskippedcluster] [-K|--ignoreactivationskip] [--metadataprofile ProfileName] [--monitor {y|n}] [--[vg]metadatacopies #copies] [--poll {y|n}] [--noudevsync] [--refresh] [--sysinit] [-t|--test] [-u|--uuid] [-v|--verbose] [--version] {-a|--activate [a|e|l]{y|n} | [--activationmode {complete|degraded|partial}] -c|--clustered {y|n} | -x|--resizeable {y|n} | -l|--logicalvolume MaxLogicalVolumes | -p|--maxphysicalvolumes MaxPhysicalVolumes | -s|--physicalextentsize PhysicalExtentSize[bBsSkKmMgGtTpPeE] | --addtag Tag | --deltag Tag} [VolumeGroupName...] Change volume group attributesvgck [--commandprofile ProfileName] [-d|--debug] [-h|--help] [-v|--verbose] [--version] [VolumeGroupName...] Check the consistency of volume group(s)vgconvert [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--labelsector sector] [-M|--metadatatype 1|2] [--pvmetadatacopies #copies] [--metadatasize MetadataSize[bBsSkKmMgGtTpPeE]] [--bootloaderareasize BootLoaderAreaSize[bBsSkKmMgGtTpPeE]] [-t|--test] [-v|--verbose] [--version] VolumeGroupName [VolumeGroupName...] Change volume group metadata formatvgcreate [-A|--autobackup {y|n}] [--addtag Tag] [--alloc AllocationPolicy] [-c|--clustered {y|n}] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [-l|--maxlogicalvolumes MaxLogicalVolumes] [--metadataprofile ProfileName] [-M|--metadatatype 1|2] [--[vg]metadatacopies #copies] [-p|--maxphysicalvolumes MaxPhysicalVolumes] [-s|--physicalextentsize PhysicalExtentSize[bBsSkKmMgGtTpPeE]] [-t|--test] [-v|--verbose] [--version] [-y|--yes] [ PHYSICAL DEVICE OPTIONS ] VolumeGroupName PhysicalDevicePath [PhysicalDevicePath...] vgdisplay [-A|--activevolumegroups] [-c|--colon | -s|--short | -v|--verbose] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--ignoreskippedcluster] [--nosuffix] [-P|--partial] [--readonly] [--units hHbBsSkKmMgGtTpPeE] [--version] [VolumeGroupName [VolumeGroupName...]] vgdisplay --columns|-C [--aligned] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--ignoreskippedcluster] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [-S|--select Selection] [--readonly] [--separator Separator] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [--verbose] [--version] [VolumeGroupName [VolumeGroupName...]] Display volume group informationvgexport [-a|--all] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [-v|--verbose] [--version] VolumeGroupName [VolumeGroupName...] Unregister volume group(s) from the systemvgextend [-A|--autobackup y|n] [--restoremissing] [--commandprofile ProfileName] [-d|--debug] [-f|--force] [-h|--help] [-t|--test] [-v|--verbose] [--version] [-y|--yes] [ PHYSICAL DEVICE OPTIONS ] VolumeGroupName PhysicalDevicePath [PhysicalDevicePath...] Add physical volumes to a volume groupvgimport [-a|--all] [--commandprofile ProfileName] [-d|--debug] [-f|--force] [-h|--help] [-t|--test] [-v|--verbose] [--version] VolumeGroupName... Register exported volume group with systemvgmerge [-A|--autobackup y|n] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [-l|--list] [-t|--test] [-v|--verbose] [--version] DestinationVolumeGroupName SourceVolumeGroupName vgmknodes [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--refresh] [-v|--verbose] [--version] [VolumeGroupName...] Create the special files for volume group devices in /devvgreduce [-a|--all] [-A|--autobackup y|n] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--mirrorsonly] [--removemissing] [-f|--force] [-t|--test] [-v|--verbose] [--version] VolumeGroupName [PhysicalVolumePath...] Remove physical volume(s) from a volume groupvgremove [--commandprofile ProfileName] [-d|--debug] [-f|--force] [-h|--help] [--noudevsync] [-t|--test] [-v|--verbose] [--version] VolumeGroupName [VolumeGroupName...] vgrename [-A|--autobackup y|n] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [-t|--test] [-v|--verbose] [--version] OldVolumeGroupPath NewVolumeGroupPath | OldVolumeGroupName NewVolumeGroupName vgs [--aligned] [--binary] [-a|--all] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--ignoreskippedcluster] [--nameprefixes] [--noheadings] [--nosuffix] [-o|--options [+]Field[,Field]] [-O|--sort [+|-]key1[,[+|-]key2[,...]]] [-P|--partial] [--readonly] [--rows] [-S|--select Selection] [--separator Separator] [--trustcache] [--unbuffered] [--units hHbBsSkKmMgGtTpPeE] [--unquoted] [-v|--verbose] [--version] [VolumeGroupName [VolumeGroupName...]] Display information about volume groupsvgscan [--cache] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [--ignorelockingfailure] [--mknodes] [-P|--partial] [-v|--verbose] [--version] vgsplit [-A|--autobackup {y|n}] [--alloc AllocationPolicy] [-c|--clustered {y|n}] [--commandprofile ProfileName] [-d|--debug] [-h|--help] [-l|--maxlogicalvolumes MaxLogicalVolumes] [-M|--metadatatype 1|2] [--[vg]metadatacopies #copies] [-n|--name LogicalVolumeName] [-p|--maxphysicalvolumes MaxPhysicalVolumes] [-t|--test] [-v|--verbose] [--version] SourceVolumeGroupName DestinationVolumeGroupName [PhysicalVolumePath...] Move physical volumes into a new or existing volume groupDisplay software and driver version informationError during parsing of command line.Updated config file invalid. Aborting.Only one of --profile or --metadataprofile allowed.Only one of --profile or --commandprofile allowed.PARTIAL MODE. Incomplete logical volumes will be processed.--partial and --activationmode are mutually exclusive argumentsInvalid activation mode given.--trustcache is incompatible with --allWARNING: Cache file of PVs will be trusted. New devices holding PVs may get ignored.DEGRADED MODE. Incomplete RAID LVs will be processed.%s: Command not permitted while global/metadata_read_only is set.Disabling use of lvmetad because read-only is set.Test mode: Wiping internal cacheRun `%s --help' for more information.Falling back to LVM1 tools, but no command specified.Line too long (max 255) beginning: %sInternal error: Failed command did not use log_errorCommand failed with status code %d./proc/self/fdFailed to apply %s %s.Setting global %s "%s".Failed to add %s %s.command profilemetadata profile_;D%-*s [%15s] %slvmdiskscan.cdev_iter_create failedCouldn't get size of "%s"LVM physical volumedev_close on "%s" failed%d disk%s%d partition%s%d LVM physical volume%sWARNING: only considering LVM devices%d LVM physical volume whole disk%slvremove.cPlease enter one or more logical volume pathslvrename.cOld and new logical volume names requiredLogical volume names must have the same volume group ("%s" or "%s")New logical volume name "%s" may not exceed %zu characters.New logical volume name may not be blankNew logical volume name "%s" is invalidOld and new logical volume names must differChecking for existing volume group "%s"Existing logical volume "%s" not found in volume group "%s"Cannot rename a RAID %s directlyCannot rename %s while it is tracking a split imageRenamed "%s" to "%s" in volume group "%s"lvresize.cFinding volume group %sPlease specify either size or extents but not both.Can't reduce pool metadata size.Negative argument not permitted - use lvreducePositive sign not permitted - use lvextendPlease provide the logical volume nameStripesize may not be negative.Logical volume %s not found in volume group %sinactive ACTIVE OriginalSnapshotlvscan.c%s%s '%s%s/%s' [%s] %sIgnoring lvscan --cache because lvmetad is not in use.WARNING: Device for PV %s already missing, skipping.No additional command line arguments allowedFailed to generate list of copied LVs: can't abort.ABORTING: Failed to generate list of copied LVsABORTING: Segment progression failed.Internal error: Handle is undefined.%s: Skipping inactive LV. Try lvchange or vgchange.ABORTING: Mirror percentage check failed.Argument to --interval cannot be negativeChecking progress %s waiting every %u secondsABORTING: Can't reread VG for %s%s: no pvmove in progress - already finished or aborted.ABORTING: Can't find LV in %s for %s%s: Interrupted: No longer active.polldaemon.cpvchange.cChanging uuid of %s to %s.Updating physical volume "%s"Physical volume "%s" changedUnable to find %s in %s#globalUnable to obtain global lock.Volume group containing %s does not support tagsVolume group containing %s has active logical volumesCan't change tag on Physical Volume %s not in volume groupAllocatability not supported by orphan %s format PV %sPhysical volume "%s" is already allocatable.Physical volume "%s" is already unallocatable.Override preferred number of copies of VG %s metadata? [y/n]: Physical volume %s not changedFailed to generate new random UUID for %s.pv_write with new uuid failed for %s.Failed to store physical volume "%s" in volume group "%s"Failed to store physical volume "%s"Setting physical volume "%s" allocatableSetting physical volume "%s" NOT allocatablePlease give one or more of -x, -uuid, --addtag, --deltag or --metadataignorePlease give a physical volume pathOption --all and PhysicalVolumePath are exclusive.Using physical volume(s) on command lineFailed to read physical volume %sScanning for physical volume names%d physical volume%s changed / %d physical volume%s not changedScanning %spvck.c--uuid is required with --restorefile--restorefile is required with --uuidCan only set uuid on one volume at onceUnable to read volume group from %sCan't find uuid %s in backup file %sPhysical volume size may not be negativepvcreate.cpvdisplay.cUnable to find "%s" in volume group "%s"Device "%s" has a capacity of %sPhysical volume "%s" of volume group "%s" is exported"%s" is a new physical volume of "%s"Option -c not allowed with option -mOption -c is not allowed with option -spvmove.cRemoving temporary pvmove LVreloadABORTING: Can't reread PV %sMovedconvertingmergingcache-relatedsnapshot-relatedthin-relatedRAIDRAID-relatedFailed to clone PV namepvmove%dSkipping %s LV, %sSkipping %s LV %sSkipping locked LV %sLogical volume %s not found.No data to move for %sUnable to resume logical volumesUnable to reactivate logical volume "%s"ABORTING: Removal of temporary mirror failedABORTING: Failed to write new data locations to disk.ABORTING: Locking LVs to remove temporary mirror failedABORTING: Unable to deactivate temporary logical volume "%s"ABORTING: Removal of temporary pvmove LV failedWriting out final volume group after pvmoveInternal error: %s is not a proper mirror imageInternal error: %s is not a pvmove mirror of LV-typeInternal error: Mirror image %u not found in segmentUpdating volume group metadataABORTING: Volume group metadata update failed.ABORTING: Temporary pvmove mirror %s failed.ABORTING: Temporary pvmove mirror activation failed. Run pvmove --abort.--name takes a logical volume nameNamed LV and old PV must be in the same VGIncomplete LV name supplied with --nameLogical volume name %s is invalidDetected pvmove in progress for %sIgnoring remaining command line argumentsABORTING: Failed to generate list of moving LVsABORTING: Temporary mirror activation failed.No extents available for allocationCreation of temporary pvmove LV failedlvs_changed list struct allocation failedUnable to pvmove when %s volumes are presentSkipping %s because a parent is of cache typeSkipping LV %s which is activated exclusively on remote node.Moving %u extents of logical volume %s/%sAll data on source PV skipped. It contains locked, hidden or non-top level LVs only.Cannot move in clustered VG %s, clustered mirror (cmirror) not detected and LVs are activated non-exclusively.Cannot move in clustered VG %s if some LVs are activated exclusively while others don't.Failed to convert pvmove LV to mirroredFailed to split segments being movedPlease enter a physical volume pathpvremove.cpvresize.cPlease supply physical volume(s)%d physical volume(s) resized / %d physical volume(s) not resizedpvscan.c%s: autoactivation failed.%i:%iof exported volume group(s)in no volume groupPhysical Volume %s not found.%-*s with UUID %sInvalid PV name with uuid.PV %-*s %-*s %s [%s]Failed to read Volume Group "%s" (%s) during autoactivation.%s: refresh before autoactivation failed.Device %s not found. Cleared from lvmetad cache.Ignoring pvscan --cache command because lvmetad is not in use.Only --activate ay allowed with pvscan.Both --major and --minor required to identify devices.Failed to parse major:minor from %sToo many parameters on command line.--activate is only valid with --cache.--major and --minor are only valid with --cache.Options -e and -n are incompatibleWARNING: only considering physical volumes %sWalking through all physical volumesPV %-*s is in exported VG %s [%s / %s free]PV %-*s VG %-*s %s [%s / %s free]No matching physical volumes foundTotal: %d [%s] / in use: %d [%s] / in no VG: %d [%s]reporter.cInvalid options string: %s%s,%sUnable to find missing PV %s in volume group %sInternal error: Unknown report type.options string allocation failedCan't report LV and PV fields at the same timeWARNING: devtypes currently ignores command line arguments.Adding PE range: start PE %u length %u on %sOverlapping PE ranges specified (%u-%u, %u-%u) on %sPhysical volume %s not allocatable.Physical volume %s is missing.No free extents on physical volume "%s".Unable to allocate physical volume list.Allocation of pe_ranges list failedPE range error: start extent %u to end extent %uPhysical extent parsing error at %sForking background process: %sBackground process failed to setsid: %sskip_dev_dir: Couldn't split up device name %sIgnoring virtual origin logical volume %s.Allocation failed for str_list.One or more specified logical volume(s) not found.Unable to find %s in volume group %sUsing volume group(s) on command linePhysical Volume "%s" not found in Volume Group "%s"Failed to find physical volume "%s"Using all physical volume(s) in volume groupEnvironment Volume Group in LVM_VG_NAME invalid: "%s""%s": Invalid path for Logical VolumePath required for Logical Volume "%s"Using logical volume(s) on command lineNo specified PVs have space availablePhysical extent size may not be negativePhysical extent size cannot be larger than %sMax Logical Volumes may not be negativeMax Physical Volumes may not be negativeSpawning background pvmove process for %sSpawning background lvconvert process for %sRefusing to activate merging "%s" while snapshot "%s" is still active.Cannot fully deactivate merging origin "%s" while snapshot "%s" is still active.Refusing refresh of partial LV %s. Use '--activationmode partial' to override.labelsector must be less than %luMetadata and data alignment parameters only apply to text format.Bootloader area parameters only apply to text format.metadataignore only applies to metadatacopies > 0Physical volume data alignment may not be negativePhysical volume data alignment is too big.Physical volume data alignment offset may not be negativePhysical volume data alignment offset is too big.WARNING: Ignoring data alignment %s incompatible with restored pe_start value %s)Metadata size may not be negativeBootloader area size may not be negative--ignoremonitoring or --sysinit option not allowed with --monitor optionNegative pool metadata size is invalid.Please specify either metadata logical volume or its size.Negative stripesize is invalidStripe size cannot be larger than %sIgnoring stripesize argument with single stripeNumber of stripes (%d) must be between %d and %dFailed to add tag %s to physical volume %sNo physical volume label read from %stoollib.cAllocation of list failedfork failed: %sdup2redirect(lvm2)vg/lv string alloc failedSkipping volume group %sSkipping invalid tag %sstrlist allocation failedInvalid volume group name: %sFinding all volume groupsNo volume groups foundFailed to find device "%s"dev_iter creation failedLVM_VG_NAMEAllocation of vg_name failedFinding all logical volumesFailed to suspend %s.Failed to reactivate %s.Setting pool zeroing: %uSetting pool discards: %sSetting pool chunk size: %sUsing default stripesize %sInvalid stripe size %s/dev/nullvgcfgbackup.cFailed to allocate filename.Error processing filename template %sVGs must be backed up into different files. Use %%s in filename for VG name.No backup taken: specify filename with -f to backup an inconsistent VGVolume group "%s" successfully backed up.Volume group name "%s" is invalidPlease specify a *single* volume group to restore.Unable to lock volume group %svgcfgrestore.c#orphansUnable to lock orphansRestore failed.Restored volume group %svgchange.c(no profile)No volume groups changed.ActivatedDeactivatedVolume group "%s" is exportedRefreshing volume group "%s"Volume group "%s" is already resizeableVolume group "%s" is already not resizeableChanging configuration profile for VG %s: %s -> %s.Number of metadata copies for VG %s is already unmanaged.Number of metadata copies for VG %s is already %u.Volume group "%s" is already clusteredVolume group "%s" is already not clusteredLVM cluster daemon (clvmd) is not running. Make volume group "%s" clustered anyway? [y/n]: LVM locking type is not clustered. Make volume group "%s" clustered anyway? [y/n]: Volume group allocation policy is already %sVolume group has active logical volumesFailed to generate new random UUID for VG %s.Physical extent size cannot be larger than %s.Physical extent size of VG %s is already %s.Failed to change physical extent size for VG %s.Can't deactivate volume group "%s" with %d open logical volume(s)%d logical volume(s) in volume group "%s" already active%d existing logical volume(s) in volume group "%s" %smonitored%s/%s is exclusively active on a remote node%s %d logical volumes in volume group %s%d logical volume(s) in volume group "%s" now activeVolume group "%s" successfully changed%d logical volume(s) in volume group "%s" %smonitoredBackground polling started for %d logical volume(s) in volume group "%s"Need 1 or more of -a, -c, -l, -p, -s, -x, --refresh, --uuid, --alloc, --addtag, --deltag, --monitor, --poll, --vgmetadatacopies or --metadatacopiesOnly -ay* allowed with --monitor or --poll.Only one of --poll and --sysinit permitted.-A option not necessary with -a optionMaxPhysicalVolumes may not be negativeChange clustered property of all volumes groups? [y/n]: vgck.cThe volume group is missing %d physical volumes.Clustered Non-clustered vgcreate.cCan't get lock for %s.Can't get lock for orphan PVsPlease provide volume group name and physical volumesA volume group called %s already exists.WARNING: Setting maxlogicalvolumes to %d (0 means unlimited)WARNING: Setting maxphysicalvolumes to %d (0 means unlimited)%s%colume group "%s" successfully createdvgconvert.cPlease enter volume group(s)Volume group "%s" already uses format %sArchive of "%s" metadata failed.Logical volume %s lvid format is incompatible with requested metadata format.Logical volume %s must be deactivated before conversion.Deleting existing metadata for VG %sFailed to setup physical volume "%s"Use pvcreate and vgcfgrestore to repair from archived metadata.Set up physical volume for "%s" with %llu available sectorsFailed to wipe existing label on %sWriting physical volume data to disk "%s"Failed to write physical volume "%s"Physical volume "%s" successfully createdRemoval of existing metadata for %s failed.Test mode: Skipping metadata writing for VG %s in format %sWriting metadata for VG %s using format %sConversion failed for volume group %s.Volume group %s successfully convertedInvalid option --metadatacopies, use --pvmetadatacopies instead.Metadata parameters only apply to text formatMetadatacopies may only be 0, 1 or 2Bootloader area parameters only apply to text format--- Physical volumes ---vgdisplay.cOption -A is not allowed with volume group namesVolume group "%s" has active logical volumesVolume group "%s" successfully exportedPlease supply volume groups or use -a for all.No arguments permitted when using -a for all.vgexport.cPlease enter volume group name and physical volume(s)Checking for volume group "%s"WARNING: PV %s not found in VG %sWARNING: PV %s was not missing in VG %sWARNING: The PV %s is still missing.WARNING: Changing preferred number of copies of VG %s metadata from %u to %uVolume group "%s" will be extended by %d new physical volumesVolume group "%s" successfully extendedvgextend.cNo PV has been restored.Volume group %s not changedVolume group "%s" is not exportedVolume group "%s" is partially missingVolume group "%s" successfully importedWARNING: Volume groups with missing PVs will be imported with --force.vgimport.cPlease enter 2 or more volume groups to mergeDuplicate volume group name "%s"Failed to generate new random LVID for %sWriting out updated volume groupVolume group "%s" successfully merged into "%s"vgmerge.cChanged LVID for %s to %svgmknodes.cWARNING: Partial LV %s needs to be repaired or removed. There are still partial LVs in VG %s.To remove them unconditionally use: vgreduce --removemissing --force.Proceeding to remove empty missing PVs.Volume Groups must always contain at least one PVRemoving PV with UUID %s from VG %sLVs still present on PV with UUID %s: Can't remove from VG %sPlease give volume group name and physical volume paths--mirrorsonly requires --removemissingPlease enter physical volume paths or option -aOption -a and physical volume paths mutually exclusivePlease only specify the volume groupVolume group "%s" is already consistentTrying to open VG %s for recovery...Non-mirror-image LV %s found: can't remove.Failed to write out a consistent VG for %sWrote out consistent volume group %svgreduce.cPlease give volume group nameRemoving partial LV %s.vgremove.cVolume group "%s" not removedWARNING: %d physical volumes are currently missing from the system.Do you really want to remove volume group "%s" containing %u logical volumes? [y/n]: Please enter one or more volume group pathsvgrename.cCan't get lock for %sRenaming "%s" to "%s"Test mode: Skipping rename.Renaming "%s" to "%s" failedChecking for new volume group "%s"New volume group "%s" already existsNo complete volume groups foundFound more than one VG called %s. Please supply VG uuid.Volume group "%s" successfully renamed to "%s"Old and new volume group names need specifyingexported vgscan.cFound %svolume group "%s" using metadata type %sToo many parameters on command lineCannot proceed since lvmetad is not active.Reading all physical volumes. This may take a while...Logical volume %s (part of %s) must be inactive.Logical volume %s must be inactive.Existing VG, new VG and either physical volumes or logical volume required.A logical volume name cannot be given with physical volumes.Unable to set new VG metadata type based on source VG format - use -M option.Can't split Logical Volume %s between two Volume GroupsCan't split RAID %s between two Volume GroupsCan't split mirror %s between two Volume GroupsCan't split snapshot %s between two Volume GroupsCan't split external origin %s and pool %s between two Volume Groups.Can't split pool data and metadata %s between two Volume Groups.Unable to split VG while it contains cache LVsCannot split: Nowhere to store metadata for new Volume GroupWriting out updated volume groupsVolume group "%s" became inconsistent: please fix manually%s volume group "%s" successfully split from "%s"Volume group "%s" exists, but new VG option specifiedvgsplit.cExistingNewPhysical Volume %s not found-%cHOME%s/.lvm_historylvm.cCouldn't write history to %s.lvm> Too many arguments, sorry.Exiting.$HOME/.lvm_history: path too longCouldn't read history from %s.No such command '%s'. Try 'help'.activate/activate.cdm_snprintf error from %s/%sNo host tag matches %s/%stpoolreal%s/lvm/globalGetting driver versionGetting target version for %sFound %s target v%u.%u.%u.dm-%s/sbin/modprobe%s/%s is %sactive%s%sLogical volume %s/%s in use.idleCounted %d open LVs in VG %sUnmonitoredMonitored%s %s for events [Test mode: skipping this]MNot mFailed to %smonitor %s%s/%s already monitored.%s/%s already not monitored.%sonitoring %s/%s%s%sonitoring %s/%s failed. (reverting) if activeSkipping: Resuming %s%s%s.Resuming LV %s/%s%s%s%s.already resumed temporary noscanSkipping: Activating '%s'.Activating %s/%s%s%s%s%s. origin without snapshotsSkipping: Suspending %s%s.already suspendedsuspending pvmove LVfailed precommitted suspendfailed suspendfailed suspend (pvmove)suspendingSkipping: Deactivating '%s'.Deactivating %s/%s.deactivatingdeactivated%s configuration setting defined: Checking the list to match %s/%sNo item supplied in %s configuration setting matches %s/%sIgnoring invalid string in config file %sIgnoring empty string in config file %sIgnoring empty tag in config file %sactivation/volume_list configuration setting not defined: Checking only host tags for %s/%sLVM1 proc global snprintf failedmodule string allocation failedsnap_seg module string allocation failedactivation/auto_activation_volume_list configuration setting not defined: All logical volumes will be auto-activated.Activation enabled. Device-mapper kernel driver will be used.WARNING: Activation disabled. No device-mapper interaction will be attempted.Activation disabled. No device-mapper interaction will be attempted.Failed to get %s target versionmodule_present module name too long: %sUnable to determine exclusivity of %sLogical volume %s/%s is used by another device.Logical volume %s/%s contains a filesystem in use.Retrying open_count check for %s/%s.Checking transient status for LV %s/%sChecking snapshot percent for LV %s/%sChecking mirror percent for LV %s/%sChecking raid device health for LV %s/%sChecking raid mismatch count for LV %s/%sChecking raid sync_action for LV %s/%sThin pool data or metadata volume must be specified. (E.g. "%s/%s_tdata")%s/%s must be a RAID logical volume to perform this action.Unable to send message to an inactive logical volume.Failed to retrieve status of %s/%sKernel driver does not support this action: %s"%s" is not a supported sync operation.%s/%s state is currently "%s". Unable to switch to "%s".Internal error: Unable to get block info of unlinked cache_pool, %sInternal error: Unable to get block info of non-cache LV, %sChecking cache block info for LV %s/%sInternal error: Unable to get policy info of unlinked cache_pool, %sInternal error: Unable to get policy info of non-cache LV, %sChecking cache policy for LV %s/%sChecking thin %sdata percent for LV %s/%sChecking thin percent for LV %s/%sChecking device id for LV %s/%sCounted %d active LVs in VG %sFailed to allocate dmeventd library path.Skipping unmonitor of opened %s (open:%d)Skipping monitor of snapshot larger then origin %s.%s/%s: %s segment monitoring function failed.%s/%s %smonitoring still pending: waiting...Not activating %s/%s since it does not pass activation filter.Refusing activation of partial LV %s. Use '--activationmode partial' to override.Refusing activation of partial LV %s. Try '--activationmode degraded'.Refusing activation of LV %s containing an unrecognised segment.Internal error: LV %s missing from preload metadataInternal error: LV %s (%s) missing from preload metadatafailed precommitted suspend (pvmove)LV %s/%s has open %d snapshot(s), not deactivating.Releasing activation in critical section.Metadata cache: VG %s wiped.cache/lvmcache.c#orphans_lvm2#orphans_lvm1#orphans_poolCache locking failure for %s with %u mdaslvmcache: initialised VG %spre-committed VG %s reused %d times.vgids list allocation failedpvids list allocation failedvgname allocation failednowno longer, precommittedWiping internal VG cache_lvmcache_update: vgid hash insertion failed: %slvmcache: %s: setting %s VGID to %sInternal error: VG lock %s hits NULL.Internal error: VG lock %s must be requested before %s, not after.Internal error: Internal cache cannot lookup vgid.Metadata cache has no info for vgid "%s"Internal error: Internal cache is no yet initialized.Metadata cache has no info for vgname: "%s"Metadata cache has not found vgname "%s" with vgid "%.32s".Precommitted metadata cache: VG %s upgraded to committed.Internal error: metadata commit (or revert) missing before dropping metadata from cache.Internal cache initialisation failedInternal error: Nested locking attempted on VG %s.device_list element allocation failedInternal error: Attempt to unlock unlocked VG %s._vgname_hash re-insertion for %s failedlvmcache_update_vgname: list alloc failedcache vgname alloc failed for %sInternal error: Orphan vginfo %s lost from cache.lvmcache: %s: now in VG %s%s%s%s%sWARNING: Duplicate VG name %s: Existing %s takes precedence over exported %sWARNING: Duplicate VG name %s: %s takes precedence over exported %sWARNING: Duplicate VG name %s: Existing %s (created here) takes precedence over %sWARNING: Duplicate VG name %s: %s (with creation_host) takes precedence over %sWARNING: Duplicate VG name %s: %s (created here) takes precedence over %scache_update: vg hash insertion failed: %sUsing cached %smetadata for VG %s with %u holder(s).VG %s decrementing %d holder(s) at %p.vgnames list allocation failedCouldn't find device with uuid %s.%s: Couldn't find device. Check your filters?Internal error: NULL vgname handed to cachelvmcache: %s: VG %s %s exportedcache creation host alloc failed for %slvmcache: %s: VG %s: Set creation host to %s.Metadata cache: VG %s (%s) stored (%zu bytes%s).Internal error: Volume Group %s was not unlockedInternal error: _vginfos list should be emptyMust be exactly one data area (found %d) on PV %sMust be at most one bootloader area (found %d) on PV %sPV %s is a different format (seqno %s)lvmcache_info allocation failedIgnoring duplicate PV %s on %s - using %s %sIgnoring duplicate PV %s on %s - using dm %sDuplicate PV %s on %s - using %s %sDuplicate PV %s on %s - using dm %sFound duplicate PV %s: using %s not %sUpdating pvid cache to %s (%s) from %s (%s)_lvmcache_update: pvid insertion failed: %scommands/toolcontext.cdup2(%d, %d) returned %dfdopenLogging initialised at %suname_init_hostnameprofile_params alloc failedinit_formatsegment typeinit_multiple_segtypesinit_segtypeSetting host tag: %sFailed to create config treeDM_DISABLE_UDEV/dev/archive_init failed.backup_init failed.host_listhost_filterhost_filter not supported yet%s/lvm%s%s.conf/run/lvm/lvmetad.socketSet umask from %04o to %04o%s/LVM-%s/mounts_get_sysfs_dir fopensysfs/dev/ioerror stat failed: %sLVM_LVMETAD_SOCKETLVM_ configuration invalid.Reloading config filesstdoutsetlocale failedsetvbufLVM_SYSTEM_DIRlog/debug_classes contains a value which is not a string. Ignoring.Unrecognised value for log/debug_classes: %sSetting log debug classes to %d_init_hostname: dm_pool_strdup failed_init_hostname: dm_pool_strdup kernel_vsn failed_init_profiles: dm_strncpy faileddevices/filter not found in config file: no regex filter installedFailed to create regex device filterFailed to create lvm type filterFailed to create partitioned device filterFailed to create persistent device filter.Failed to load existing device cache from %sInvalid string in config file: global/format_librariesShared library %s does not contain format functions_init_formats: Default format (%s) not foundInvalid string in config file: global/segment_librariesWARNING: Shared lib %s has conflicting init fns. Using init_multiple_segtypes().init_multiple_segtypes() failed: Unloading shared library %sInternal error: _destroy_config: cmd config tree not destroyed fully_set_tag: str_list_add %s failedDM_DISABLE_UDEV environment variable set. Overriding configuration to use udev_rules=0, udev_sync=0, verify_udev_operations=1.Udev is running and DM_DISABLE_UDEV environment variable is set. Bypassing udev, LVM will %s.obtain device list by scanning device directoryFailed to add /dev to internal device cachedevice/scan not in config file: Defaulting to /devInvalid string in config file: devices/scanNon standard udev dir %s, resetting devices/obtain_device_list_from_udev.Failed to add %s to internal device cacheInvalid string in config file: devices/loopfilesFailed to add loopfile %s to internal device cacheWARNING: Metadata changes will NOT be backed upInvalid tag in config file: %sInvalid hostname string for tag %sLVM_SYSTEM_DIR or tag was too longconfig_tree_list allocation failedDevice directory given in config file too longWARNING: proc dir %s not found - some checks will be bypassedNo proc filesystem found: skipping sysfs detectionFailed to create /proc/mounts string for sysfs detectionFailed to find sysfs mount pointInvalid readahead specificationmanage logical volume symlinks in device directoryWARNING: activation/missing_stripe_filler = "%s" is invalid,Falling back to "error" missing_stripe_filler.WARNING: activation/missing_stripe_filler = "%s" is not a block device.Ignoring invalid activation/mlock_filter entry in config fileIgnoring too small pv_min_size %lldKB, using default %dKB.WARNING: configuration setting use_lvmetad overridden to 0 due to locking_type 3. Clustered environment not supported by lvmetad yet.Duplicate segment type %s: unloading shared library %sShared library %s does not contain segment type functionsFailed to allocate command contextFailed to allocate line buffer.LVM_SYSTEM_DIR environment variable is too long.Failed to create LVM2 system dir for metadata backups, config files and internal cache.Set environment variable LVM_SYSTEM_DIR to alternative location or empty string.Library memory pool creation failedCommand memory pool creation failed<#config/config.c%s%s option%s# Configuration %s %s. %s# %s %s# Since version %s. string float integer boolean section array with values of type:%s%s%s%s%s%sFailed to duplicate filename.%s is not a regular file%s is emptymmap%s: Checksum errormunmapconfig_tree allocation failedLoading config file: %sFailed to load config file %sDumping configuration to %sFailure while writing to %smetadata profilecommand profileUndefined profile name.profile allocation failed%s/%s.profileIgnoring invalid %s %s.genericperformance/run/lvm%s/%s.cache(root)Configuration handling.shellchecksabort_on_errorsprofile_dir#S/devloopfilesobtain_device_list_from_udevpreferred_namesglobal_filtercache_dircache_file_prefixwrite_cache_statesysfs_scanmultipath_component_detectionmd_component_detectionmd_chunk_alignmentdefault_data_alignmentdata_alignment_detectionignore_suspended_devicesignore_lvm_mirrorsdisable_after_error_countrequire_restorefile_with_uuidpv_min_sizeissue_discardscling_tag_listmaximise_clinguse_blkid_wipingcache_pool_chunk_sizethin_pool_zerothin_pool_discardsthin_pool_chunk_size_policythin_pool_chunk_sizesilentsyslogoverwritelevelindentcommand_namesactivate_filedebug_classesbackup_dirarchive_dirretain_minretain_dayshistory_sizeumasksi_unit_consistencyfallback_to_lvm1format_librariessegment_libraries/proclocking_typewait_for_locksfallback_to_clustered_lockingfallback_to_local_lockinglocking_dir/run/lock/lvmprioritise_write_lockslibrary_dirlocking_libraryliblvm2clusterlock.soabort_on_internal_errorsmetadata_read_onlymirror_segtype_defaultraid10_segtype_defaultuse_lvmetadthin_check_executable/usr/sbin/thin_checkthin_check_options#S-qthin_disabled_featuresthin_dump_executable/usr/sbin/thin_dumpthin_repair_executable/usr/sbin/thin_repairthin_repair_options#Scache_check_executable/usr/sbin/cache_checkcache_check_optionscache_dump_executable/usr/sbin/cache_dumpcache_repair_executable/usr/sbin/cache_repaircache_repair_optionsudev_syncudev_rulesverify_udev_operationsretry_deactivationmissing_stripe_filleruse_linear_targetreserved_stackreserved_memoryprocess_priorityauto_activation_volume_listread_only_volume_listmirror_region_sizeraid_region_sizeraid_fault_policywarnmirror_device_fault_policymirror_log_fault_policymirror_image_fault_policysnapshot_autoextend_thresholdsnapshot_autoextend_percentthin_pool_autoextend_percentmlock_filteruse_mlockallpolling_intervalauto_set_activation_skipactivation_modepvmetadatasizepvmetadataignoredirsdisk_areasdisk_areastart_sectorlist_item_separator,colums_as_rowsbinary_values_as_numericdevtypes_sortdevtype_namedevtypes_colsdevtypes_cols_verboselvs_sortvg_name,lv_namelvs_colslvs_cols_verbosevgs_sortvg_namevgs_colsvgs_cols_verbosepvs_sortpv_namepvs_colspvs_cols_verbosevg_name,lv_name,seg_startpvsegs_sortpv_name,pvseg_startpvsegs_colspvsegs_cols_verbosemirror_libraryraid_librarysnapshot_librarythin_library/sbin/dmeventdhosttagsundefinedmerged filesspecial purposeInternal error: _cfg_def_make_path: supplied buffer too small for %s/%sCouldn't create default backup path '%s/%s'.Couldn't create default archive path '%s/%s'.Couldn't create default profile path '%s/%s'.Internal error: Profile %s already added as %s type, but requested type is %s.Internal error: Configuration node %s has invalid id.%s# This configuration %s is advanced. %s# This configuration %s is not officially supported. %s# This configuration %s has variable name. %s# This configuration %s does not have a default value defined. _out_prefix_fn: couldn't create version stringPersistent cache directory name too long.Failed to create default empty array for %s._get_def_array_values: dm_strdup failedFailed to create default config array value for %s.Failed to duplicate token for default array value of %s.Internal error: Default array value malformed for "%s", value: "%s", token: "%s".Internal error: inconsistent state reached in _check_value_differs_from_defaultFailed to create default config setting node.Failed to create default config setting node value.Internal error: _add_def_node: unknown typeInternal error: couldn't determine missing config nodes - unknown status of last config check.Failed to create default config section node.Configuration setting "%s" has invalid type. Found%s, expected%s.Failed to construct path for configuration node %s.Configuration setting "%s" unknown.Configuration section "%s" unknown.Configuration setting "%s" invalid. Empty value not allowed.Configuration setting "%s" invalid. Found string value "%s", expected boolean value: 0/1, "y/n", "yes/no", "on/off", "true/false".Configuration %s "%s" is not customizable by a profile.Configuration %s "%s" is customizable by metadata profile only, not command profile.Configuration %s "%s" is customizable by command profile only, not metadata profile.Failed to allocate config source.Failed to allocate config file.Internal error: config_file_check: expected file, special file or profile config source, found %s config source.Internal error: config_file_changed: expected file config source, found %s config source.Config file %s has disappeared!Failed to reload configuration filesConfiguration file %s is not a regular fileDetected config file change to %sFailed to allocate configuration check handle.Internal error: override_config_tree_from_string: config cascade already contains a string config.Failed to set overridden configuration entries.Failed to allocate circular buffer.Internal error: config_file_read_fd: expected file, special file or profile config source, found %s config source.Configuration node %s not foundFailed to create default config tree.Internal error: add_profile: incorrect configuration source, expected %s or %s but %s requested%s: bad profile name, it contains '/'.Internal error: add_profile: loaded profile has incorrect type, expected %s but %s foundInternal error: trying to load profile %s in critical section.LVM_SYSTEM_DIR or profile name too long_check_profile: profile check handle allocation failedInternal error: _override_config_tree_from_command_profile: config cascade already contains a command profile config.Internal error: _override_config_tree_from_metadata_profile: config cascade already contains a metadata profile config.Internal error: override_config_tree_from_profile: incorrect profile source typeInternal error: %s cfg tree element not declared as string.Internal error: Cannot find configuration.Thin pool chunk size calculation policy "%s" is unrecognised.Internal error: %s cfg tree element not declared to allow empty values.Persistent cache filename too long.Internal error: %s cfg tree element not declared as integer.Internal error: %s cfg tree element not declared as float.Internal error: %s cfg tree element not declared as boolean.Failed to create configuration definition hash.Failed to insert configuration to hash.Configuration setting "%s" invalid. It's not part of any section.Configuration tree check on each LVM command execution.Abort LVM command execution if configuration is invalid.Directory with configuration profiles.data_alignment_offset_detectionwipe_signatures_when_zeroing_new_lvsmirror_logs_require_separate_pvscache_pool_metadata_require_separate_pvsthin_pool_metadata_require_separate_pvs#Smemory#Sdevices#Sactivation#Sallocation#Slvmetad#Smetadata#Scache#Slockingdetect_internal_vg_cache_corruptionlvdisplay_shows_full_device_paththin_pool_autoextend_thresholddevtype_name,devtype_max_partitions,devtype_descriptionlv_name,vg_name,lv_attr,lv_size,pool_lv,origin,data_percent,metadata_percent,move_pv,mirror_log,copy_percent,convert_lvlv_name,vg_name,seg_count,lv_attr,lv_size,lv_major,lv_minor,lv_kernel_major,lv_kernel_minor,pool_lv,origin,data_percent,metadata_percent,move_pv,copy_percent,mirror_log,convert_lv,lv_uuid,lv_profilevg_name,pv_count,lv_count,snap_count,vg_attr,vg_size,vg_freevg_name,vg_attr,vg_extent_size,pv_count,lv_count,snap_count,vg_size,vg_free,vg_uuid,vg_profilepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_freepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,dev_size,pv_uuidlv_name,vg_name,lv_attr,stripes,segtype,seg_sizelv_name,vg_name,lv_attr,seg_start,seg_size,stripes,segtype,stripesize,chunksizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_sizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_size,lv_name,seg_start_pe,segtype,seg_pe_rangeslibdevmapper-event-lvm2mirror.solibdevmapper-event-lvm2raid.solibdevmapper-event-lvm2snapshot.solibdevmapper-event-lvm2thin.so$Ĕ$$ԓ$$$ԓ$$$$$$$$$$$$$$$$$$$$$$Ԕ4str_list allocation faileddatastruct/str_list.cblock/dm-disk/lstat%s: %s failed: %sdevice/dev-cache.cfilename strdup failed%s: Already in device cache%s: Added to device cache (preferred name)%s: Not a block device%s: Not in udev db%s: Not a regular file%s: New preferred nameIgnoring %s: %s.Ignoring %s: Not a directory.dir_list allocation faileddev_iter allocation failedunknown devicedev_cachestrdup dev_dir failed.preferred device name matcherUsing %sstruct device allocation failedstruct dm_str_list allocation failedCouldn't insert device into binary tree.Failed to duplicate path string.Couldn't add alias to dev cache.Couldn't add name to hash in dev cache.%s: Aliased to %s in device cache%s%s: Symbolic link to directoryudev failed to return a device for entry %s.udev failed to return a device node for entry %s.udev failed to return a symlink name for entry %s.Failed to enumerate udev device list.%s: Failed to insert devices from udev-managed directory to device cache fully%s: Failed to insert devices to device cache fullyIgnoring %s: Not a regular file.dir_list allocation failed for fileDevice '%s' has been left open (%d remaining references).Internal error: %d device(s) were left open and have been closed.Couldn't create binary tree for dev-cache.devices/preferred_names not found in config file: using built-in preferencespreferred_names patterns must be enclosed in quotesFailed to allocate preferred device name pattern list.Failed to allocate a preferred device name pattern.Preferred device name pattern matcher creation failed.Path %s no longer valid for device(%d,%d)Aborting - please provide new pathname for what used to be %sdevice/dev-io.cClosed %sRead size too large: %llu%s: lseek %llu failed: %s%s: size is %llu sectorsioctl BLKGETSIZE64 O_EXCLRWRO%s: Not using O_DIRECTOpened %s %s%s%sioctl BLKBSZGET%s: block size is %u bytesioctl BLKPBSZGETBounce buffer malloc failedioctl BLKRAGET%s: read_ahead is %u sectorsRead from %s failedCircular read from %s failedWiping %s at %llu length %zuAttempt to read an unopened device (%s).%s: %s failed after %llu of %llu at %llu: %sWARNING: Error counts reached a limit of %d. Device %s was disabledAttempt to close device '%s' which is not open.%s: Immediate close attempt while still referenced%s already opened read-only. Upgrading to read-write.dev_open(%s) called while suspended%s: fstat failed: Has device name changed?Discarding %llu bytes offset %llu bytes on %s.%s: BLKDISCARD ioctl at offset %llu size %llu failed: %s.%s: physical block size is %u bytesWiping %s at sector %llu length %zu sectorsdevice/dev-type.cAborted wiping of %s.Wiping %s on %s.Failed to wipe %s on %s.%s/dev/block/%d:%d/%sdm_snprintf %s failed.%s/devicesmdblkextdrbdemcpowerpower2device-mappersdDRBDEMCPOWERPOWER2BLKEXT%s/dev/block/%d:%d/partitiondm_snprintf partition failedreadlink%s/block/%s/devdm_snprintf dev failedsysfs file %s does not existfgetsDevice %s %s is %lu bytes.software RAID md superblockswap signatureLUKS signaturealignment_offsetqueue/minimum_io_sizequeue/optimal_io_sizequeue/discard_max_bytesqueue/discard_granularitySCSI diskIDE diskMultiple Disk (MD/SoftRAID)Loop deviceRAM diskMapped devicePartitionable MDDAC960Network Block DeviceCompaq SMART2Compaq CCISS arrayATA RaidEMC Powerpathi2o Block DiskiSeries disksNetwork block deviceATA over EthernetXen virtual block devicePlayStation 3 internal diskVirtIO diskMMC block deviceExtended device partitionsFusion IOMicron PCIe SSDViolin MemorySTECbcache block device cacheNVM ExpressZFS ZvolsFatal error while trying to detect %s on %s.WARNING: %s detected on %s. Wipe it? [y/n]: Failed to allocate device type register.No proc filesystem found: using all block device typesFailed to create /proc/devices stringWARNING: /proc/devices line: %s, replacing major with %d.Expecting string in devices/types in config fileMax partition count missing for %s in devices/types in config fileZero partition count invalid for %s in devices/types in config filesysfs file %s not in expected MAJ:MIN format: %ssysfs file %s not in expected format: %sDASD disk (IBM S/390, zSeries)User-mode virtual block deviceDistributed Replicated Block Device (DRBD)SUN's LDOM virtual block deviceStorage Class Memory (IBM S/390)device/dev-luks.cLUKSdisplay/display.c0%s%.*f%s Exabyte EB Petabyte PB Terabyte TB Gigabyte GB Megabyte MB Kilobyte Byte B Exbibyte EiB Pebibyte PiB Tebibyte TiB Gibibyte GiB Mebibyte MiB Kibibyte KiB kB B Units UnU Sectors Secling_by_tagsnext free--- Physical Segments ---Physical extent %u to %u: Logical volume %s%s/%s Logical extents %d to %d FREENEW (exported)(but full)--- %sPhysical volume ---PV Name %sVG Name %s%sPV Size %sAllocatable yes %sAllocatable NOPE Size %sPE Size (KByte) %uTotal PE %uFree PE %uAllocated PE %uPV UUID %sNOT PV Name %s Total PE / Free PE %u / %uread onlyread/writeINACTIVE--- Logical volume ---LV Name %sInternal LV Name %sVG Name %sLV UUID %sLV Write Access %sLV Creation host, time %s, %sLV Pool name %sLV Thin origin name %sLV External origin name %sLV merging to %sLV merged with %sLV Pool metadata %sLV Pool data %s# open %uLV Size %sAllocated pool data %.2f%%Allocated metadata %.2f%%Mapped size %.2f%%Current LE %uCOW-table size %sCOW-table LE %uAllocated to snapshot %.2f%%Snapshot chunk size %sMirrored volumes %uSegments %uAllocation %sRead ahead sectors autoRead ahead sectors 0Read ahead sectors %u- currently set to %uBlock device %d:%dPersistent minor %dPersistent major %dMissing%sPhysical volume %s%sPhysical extents %d to %d%sLogical volume %s%sLogical extents %d to %d%sUnassigned areaVirtualLogical--- Segments ---%s extents %u to %u: Type %s Monitoring %sexported/--- Volume group ---VG Name %sSystem ID %sFormat %sMetadata Areas %dMetadata Sequence No %dClustered yesShared %sMAX LV %uCur LV %uOpen LV %uMax PV %uCur PV %uAct PV %uVG Size %sAlloc PE / Size %u / %sFree PE / Size %u / %sVG UUID %sr/wName is zero length.NONEno memory for size display bufferUnrecognised allocation policy %s%s:%s:%llu:-1:%llu:%llu:-1:%u:%u:%u:%u:%sPV Size %s / not usable %sPV Status %sallocatable%s%s/%s:%s:%llu:%d:-1:%d:%llu:%d:-1:%d:%d:%d:%dread/write (activated read only)LV Name %s%s/%sLV Path %s%s/%sLV snapshot status source of %s%s/%s [%s] %s [%s]LV snapshot status %s destination for %s%s/%sLV snapshot status %s destination for %sLV Status suspendedLV Status %savailableLV type Mirror undergoing conversionVG Access %s%s%s%sVG Status %s%sresizable%s:%s:%llu:-1:%u:%u:%u:-1:%u:%u:%u:%llu:%u:%u:%u:%u:%s"%s" %-9s [%-9s used / %s free]Name cannot start with hyphen.Name starts with . or .. and has no following character(s).Name contains invalid character, valid set includes: [a-zA-Z0-9.-_+].Name length exceeds maximum limit of %d.Internal error: Unknown error %d on name validation.WWWWTW}Wcontiguouscclinglcling_by_tagstnormalnanywhereainheriti_erroerror/errseg.cInitialised segtype: %serror module string list allocation failedInternal error: Destroying composite filter while in use %u times.Composite filters allocation failed.filters/filter-composite.cComposite filter initialised.Internal error: Destroying persistent filter while in use %u times.Wiping cache of LVM-capable devicesFailed to hash device to filter.Failed to hash alias to filter.Obtaining device list from udev. Removing obsolete %s.persistent_filter_cache/valid_devicesCouldn't find %s array in '%s'Devices array contains a value which is not a string ... ignoringCouldn't add '%s' to filter ... ignoringLoaded persistent filter cache from %sInternal persistent device cache empty - not writing to %sDevice cache incomplete - not writing to %sDumping persistent device cache to %s# This file is automatically maintained by lvm. Allocation of persistent filter failed.Filename duplication for persistent filter failed.Couldn't create hash table for persistent filter.Allocation of device filter for persistent filter failed.Persistent filter initialised.filters/filter-persistent.c%s: Skipping (cached)%s: Skipping unusable device, valid_devices %s=[ "%s" ] unlink%s: stat failed: %sfstat%s.tmppersistent_filter_cache { } %s: rename to %s failed: %sInternal error: Destroying regex filter while in use %u times.Filter patterns must be enclosed in quotes.pattern must begin with 'a' or 'r'invalid separator at end of regexfilters/filter-regex.c%s: Skipping (regex)filter regexfilter dm_regexFailed to allocate regex.Failed to create bitset.Regex filter initialised.Invalid filter pattern "%s".Internal error: Destroying sysfs filter while in use %u times.sysfs path name too long: %s in %ssysfs device file not correct formatNo proc filesystem found: skipping sysfs filterfilters/filter-sysfs.cEmpty sysfs device file: %s%u:%u%s: Skipping (sysfs)sysfs pool creation failedSysfs filter initialised.sysfs dev_set creation failedsubsystem/block/devicesclass/blockblockInternal error: Destroying md filter while in use %u times.%s: Skipping md component device%s: Skipping: error in md component detectionfilters/filter-md.cmd filter allocation failedMD filter initialised.Internal error: Destroying mpath filter while in use %u times.Sysfs path string is too long.Cannot find device name in sysfs path.%s: Device is a partition, using primary device %s for mpath component detectionCannot find '/' in device name.Failed to get primary device for %d:%d.Sysfs path to check mpath is too long.Failed to parse major minor from %s%s: Skipping mpath component deviceNo proc filesystem found: skipping multipath filtermpath filter allocation failedfilters/filter-mpath.c%s/dev/block/%d:%dDevice name is not valid.%s/block/%s/holdersPath %s is not a directory.mpath-mpath filter initialised.Internal error: Destroying partitioned filter while in use %u times.%s: Skipping: dev_get_size failed%s: Skipping: Too small to hold a PV%s: Skipping: Partition table signature foundPartitioned filter allocation failedPartitioned filter initialised.filters/filter-partitioned.c%s: Skipping: open failedInternal error: Destroying lvm_type filter while in use %u times.%s: Skipping: Unrecognised LVM device type %lluLVM type filter allocation failedfilters/filter-type.cLVM type filter initialised.*before**after*Failed to allocate desc.format_text/archiver.cCreated %s executing '%s'Failed to build desc.archive_params alloc failedbackup_params alloc failedCouldn't copy archive directory name.Test mode: Skipping archiving of volume group.Archiving volume group "%s" metadata (seqno %u).Volume group "%s" metadata archive failed.Couldn't copy backup directory name.Failed to generate backup filename (for removal).Couldn't create text format object.Failed to allocate format instanceFailed to duplicate empty name.Format-specific setup for %s failedConsider using option --force to restore Volume Group %s with thin volumes.WARNING: Forced restore of Volume Group %s with thin volumes.Cannot restore Volume Group %s with %i PVs marked as missing.Failed to generate backup filename (for restore).Creating volume group backup "%s" (seqno %u).Couldn't create backup object.Internal error: No in use metadata areas to write.Failed to generate volume group metadata backup filename.WARNING: This metadata update is NOT backed upTest mode: Skipping backup of volume group.Backup of volume group %s metadata failed.Skipping check for current backup, since backup is disabled.Failed to generate backup filename.Internal error: problem tracking indentationDoubling metadata output buffer to %upv device name size is out of bounds.# Generated by LVM2 version %s: %scontents = "Text Format Volume Group"creation_host = "%s" # %s %s %s %s %sRAID segment has non-RAID areastext_export buffer allocation failedCould not format metadata for VG %s.Error parsing metadata for VG %s.format_text/export.cuname failed: %sBuffer reallocation failed.Kilobytes# %g %s# Hint onlystatus = %sflags = %stags = %sseqno = %uformat = "%s"# informationalsystem_id = "%s"extent_size = %umax_lv = %umax_pv = %uallocation_policy = "%s"profile = "%s"metadata_copies = %uphysical_volumes {%s {device = "%s"dev_size = %llupe_start = %lluba_start = %lluba_size = %llu}# %Y-%m-%d %T %zcreation_host = "%s"creation_time = %lluread_ahead = -1# Noneread_ahead = %umajor = %dminor = %dsegment_count = %usegment%u {start_extent = %uextent_count = %utype = "%s"version = %ddescription = "%s"creation_time = %lu # %stext pv_namespv%dlogical_volumes {%ss = ["%s", %u%s"%s", "%s"%sMegabytesGigabytesTerabytesPetabytesExabytes?:Unknown flag set requested.format_text/flags.cStatus value is not a string.PARTIALUnknown status flag '%s'.READWRITEFIXED_MINORVISIBLEPVMOVELOCKEDNOTSYNCEDREBUILDWRITEMOSTLYACTIVATION_SKIPALLOCATABLEEXPORTEDMISSINGRESIZEABLECLUSTEREDSHAREDInternal error: Metadata inconsistency: Not all flags successfully exported.format_text/format-text.cUnlinking %sCommitting %s metadata (%u)Renaming %s to %sTest mode: Skipping renameRead volume group %s from %spe_startMDA1 startba_startdisk sizeMDA0 endlabel scan sizeba_endpe_endPV %s missing from cachemda_context allocation failed LVM2 x[5A%r0N*>free_sectors = %lldstart = %lldignore = %lldWriting %s metadata to %sfsyncPre-VG %s metadata writing failedpre-commit VG %s not found on %sName too long %s/%stextFailed to allocate dir_list_add_dir allocation failedCouldn't find device._add_raw allocation failedtext_orphanInitialised format: %sVolume group name found in metadata does not match expected name %s.Test mode: Skipping committing %s metadata (%u)'%s' does not contain volume group '%s'.Creating metadata area on %s at sector %llu size %llu sectorsInternal error: can't remove metadata area with index %u from PV %s. Metadata layou not supported by %s format.Internal error: invalid index of value %u used while trying to add metadata area on PV %s. Metadata layout not supported by %s format.Internal error: metadata area with index %u already exists on PV %s and removal failed.Using limited metadata area size on %s with value %llu (limited by %s of %llu).Failed to wipe new metadata area at the %s of the %sstruct metadata_area allocation failedstruct mda_context allocation failedNot enough space available for metadata area with index %u on PV %s.Failed to move metadata area with index 1 while resizing PV %s.PV %s too large for extent size %s.%s: invalid data alignment of %lu sectors (requested %lu sectors)%s: invalid data alignment offset of %lu sectors (requested %lu sectors)%s: pe_align (%lu sectors) must not be less than pe_align_offset (%lu sectors)%s: Data alignment must not exceed device size.%s: Bootloader area with data-aligned start must not exceed device size.%s: Bootloader area would overlap data area.Physical extents end beyond end of device %s.%s: Volume group filename may not end in .tmpCouldn't allocate text format context object.Extent size must be power of 2Incorrect metadata area header checksum on %s at offset %lluWrong magic number in metadata area header on %s at offset %lluIncompatible metadata area header version: %d on %s at offset %lluIncorrect start sector in metadata area header: %llu on %s at offset %lluText format failed to determine directory.Couldn't create temporary text file name.Failed to write metadata to %s.Random lvid creation failed for %s/%s.struct mda_header allocation failedFound text metadata area: offset=%llu, size=%lluFound LVM2 metadata record at offset=%llu, size=%zu, offset2=%llu size2=%zuFailed to write metadata area header%sCommitting %s metadata (%u) to %s header at %lluWiping pre-committed %s metadata from %s header at %lluVG %s metadata too large for circular bufferWriting %s metadata to %s at %llu len %lluWriting metadata to %s at %llu len %lluRead %s %smetadata (%u) from %s at %llu size %lluCouldn't allocate text_fid_context.Couldn't create metadata index for format instance of VG %s.Internal error: vgname_from_mda called with NULL pointer for mda_header%s: metadata too large for circular buffer%s: Found metadata at %llu size %llu (in area at %llu size %llu) for %s (%s)Failed to allocate text format type structure.Couldn't create text label handler.Couldn't register text label handler.Invalid string in config file: metadata/dirsAdding text format metadata dir: %sEmpty metadata disk_area section of config fileMissing start_sector in metadata disk_area section of config fileMissing size in metadata disk_area section of config fileMissing uuid in metadata disk_area section of config fileInvalid uuid in metadata disk_area section of config file: %sCouldn't find device with uuid '%s'.Failed to add %s to text format metadata directory list format_text/import.cCouldn't read volume group metadata.There are %d physical volumes missing.statusCould not find status flags.format_text/import_vsn1.cCould not read status flags.flagsCould not read flags.descriptioncreation_timeEmpty logical volume section.creation_hostallocation_policyread_aheadCouldn't find section '%s'.contentsmissing contents fieldText Format Volume Groupunrecognised contents fieldmissing version numberunrecognised version numberCouldn't find uuid.Invalid uuid.system_idseqnoextent_sizemax_lvmax_pvmetadata_copieslogical_volumesEmpty pv section.dev_sizeba_size%s: Couldn't get size.Empty segment section.start_extentextent_countSegment allocation failed_mimagetmpsegment_countNULLCouldn't read status flags for logical volume %s.Invalid creation_time for logical volume %s.Couldn't read creation_host for logical volume %s.Missing creation_time for logical volume %s.WARNING: Ignoring unrecognised allocation policy %s for LV %sAdding profile configuration %s for LV %s/%s.Failed to add configuration profile %s for LV %s/%sCouldn't read tags for logical volume %s/%s.Couldn't use another pool metadata spare logical volume %s/%s.Logical volume %s is pool metadata spare.Can't process text format file - %s.Couldn't create pv hash table.Couldn't create lv hash table.Couldn't read uuid for volume group %s.Couldn't read 'seqno' for volume group %s.Error reading flags of volume group %s.Couldn't read extent size for volume group %s.Couldn't read 'max_lv' for volume group %s.Couldn't read 'max_pv' for volume group %s.WARNING: Ignoring unrecognised allocation policy %s for VG %sAdding profile configuration %s for VG %s.Failed to add configuration profile %s for VG %sCouldn't find all physical volumes for volume group %s.Couldn't read tags for volume group %s.Couldn't read all logical volume names for volume group %s.Couldn't read all logical volumes for volume group %s.Failed to fixup mirror pointers after import for volume group %s.Couldn't find volume group in file.Couldn't read uuid for physical volume.Couldn't read status flags for physical volume.Recovering a previously MISSING PV %s with no MDAs.Couldn't read dev size for physical volume.Couldn't read extent start value (pe_start) for physical volume.Couldn't find extent count (pe_count) for physical volume.Found bootloader area specification for PV %s in metadata: ba_start=%llu, ba_size=%llu.Found incomplete bootloader area specification for PV %s in metadata.Couldn't read tags for physical volume %s in %s.Fixing up missing size (%s) for PV %sWARNING: Physical Volume %s is too large for underlying deviceLost logical volume reference %sCouldn't read uuid for logical volume %s.Couldn't read 'start_extent' for segment '%s' of logical volume %s.Couldn't read 'extent_count' for segment '%s' of logical volume %s.Segment type must be a string.Couldn't read tags for a segment of %s/%s.Only one segment permitted for snapshotCouldn't read segment count for logical volume %s.segment_count and actual number of segments disagree for logical volume %s.Couldn't read minor number for logical volume %s.Couldn't read major number for logical volume %s.Couldn't find status flags for volume group %s.Bad volume name in areas array for segment %s.Missing offset in areas array for segment %s.Bad offset in areas array for segment %s.Zero areas not allowed for segment %sCouldn't find volume '%s' for segment '%s'.Incorrect number of areas in area array for segment '%s'.format_text/tags.cCould not allocate memory for tag list buffer.Found a tag that is not a stringformat_text/text_label.cs, mda1 ( da1 ( ba1 ( mda2 (LVM2 001%s: PV header extension version %u foundIgnoring mda on device %s at offset %llu%s: Preparing PV label header %s size %llu with%s%.*llu%s%.*llu%s%s%.*llu%s%.*llu%s%s%.*llu%s%.*llu%s%s%.*llu%s%.*llu%sInternal error: %s label header currently requires a data area.struct data_area_list allocation failedstruct mda_list allocation failedCouldn't allocate labeller object.freeseg/freeseg.c%s: Failed to read label arealabel/label.cLABELONE%s: No label detectedUsing cached label for %sFailed to write label to %slabel allocaction failedIgnoring additional label on %s at sector %llu%s: Label for sector %llu found at sector %llu - ignoringLabel checksum incorrect on %s - ignoring%s: %s label detected at sector %lluCouldn't allocate memory for labeller list object.Scanning for labels to wipe from %sFailed to remove label from %s at sector %llu%s: Wiping label at sector %lluLabel handler does not support label writesLabel sector %llu beyond range (%ld)%s: Writing label to sector %llu with stored offset %u.locking for suspendlocking/locking.cunlocking on resume%s/lvm/VGs/%sNon-blocking External locking selected.Cluster locking selected.Unrecognised lock scope: %dFailed to suspend %sFailed to activate %s#sync_namesInternal error: Use of P_orphans is deprecated.Internal error: P_%s referencedOperation prohibited while global/metadata_read_only is set.LVM1 proc VG pathname too long for %s%s exists: Is the original LVM driver using this volume group?LVM_SUPPRESS_LOCKING_FAILURE_MESSAGESWARNING: Locking disabled. Be careful! This could corrupt your metadata.%sFile-based locking selected.File-based locking initialisation failed.External locking initialisation failed.Falling back to internal clustered locking.Internal cluster locking initialisation failed.Read-only locking selected. Only read operations permitted.Locking disabled for read-only access.Unknown locking type requested.Locking disabled - only read operations permitted.WARNING: Falling back to local file-based locking.Volume Groups with the clustered attribute will be inaccessible.Internal error: %s: LCK_NONE lock requestedā\Ԁ _lock_volLocking is disabled: Treating lock %s as not held.Read-only locking type set. Write locks are prohibited.locking/no_locking.c<|ܓactivate_log filefailed to write log file: %s failed to write log file Internal error: #%s:%d %s:%d %s%slog/log.cvsnprintf failed: skipping external logging functionFailed to activate temporary %sFailed to deactivate temporary %sChunk size must be in the range %s to %s.Chunk size must be a multiple of %s.WARNING: Maximum supported pool metadata size is %s.WARNING: Minimum supported pool metadata size is %s (needs extra %s).Internal error: %s is not a cache_pool LVCreating a cache LV from an existing cache LV isnot yet supported.Internal error: LV %s is not cached.Failed to active cache locally %s.%llu blocks must still be flushed.Cache pool cachemode "%s" is unknown.metadata/cache_manip.canother LV%s is already in use by %s_corigcleanerFlushing cache for %s.writethroughwritebackunassigneddm_pool_begin_object failedmetadata/lv.cdm_pool_grow_object failed%s%u%snot monitoredlvfullname snprintf faileddm_pool_alloc failedlvpath snprintf faileddm_build_dm_name failedlv_dmpath snprintf failedFailed to duplicate hostnameThin volume "%s" is active.remote exclusivelocal exclusive4E Internal error: Unknown area segtype.Extent number dm_snprintf failedmodules str_list allocation failedInternal error: Bad pvmove structureInternal error: Cannot find mirror segment.Internal error: %s is not a RAID imageFailed to find RAID segment for %s%s on %s is not a RAID segmentInternal error: sub-LV %s was not found in raid segmentInternal error: %s is not of RAID typeDeactivating logical volume "%s"Cannot deactivate remotely exclusive device locally.Deactivating logical volume "%s" locally.Activating logical volume "%s" exclusively locally.Activating logical volume "%s" locally.Activating logical volume "%s" exclusively.Activating logical volume "%s".metadata/lv_manip.cFailed to allocate memory %s/%s uses %sFailed to create new nameCannot rename locked LV %sChanging Consideringfsadm--dry-run%lluKpv_list allocation failedraid4raid5raid5_laraid5_raraid5_lsraid5_rsraid6raid6_zrraid6_nrraid6_ncsparsemultithinoriginthinsnapshotmultiextthinorigincacheoriginvirtualmultithickoriginthicksnapshotpublicprivateAdding %s:%u as an user of %sStack %s:%u[%u] on LV %s:%uInternal error: Meta le != 0up to contiguous Cling_to_allocated is %sset %u %s%s of %u extents eachSorting %u log areasSorting %u areas%s is %son %sphysicallogicalat most Can't resize locked LV %sExtending %u mirror images.New size of 0 not permittedCreating logical volume %sLV %s in VG %s is now hidden.Conflicting region_size and DISCARDCan't remove locked LV %sLogical volume %s not removedRemoving snapshot %sFailed to update pool %s.Releasing logical volume "%s"Failed to resume %s.external originLayer segment found: %s:%uLayer is not linear: %s:%uMissing error segtypelv_list alloc failedCan't move snapshot segment.Removing layer %s for %sFailed to find layer %s in %sCreation of layer LV failedInserting layer %s for %s_mimage_0Inserting %s:%u-%u of %s/%sanyNo meta_areas for RAID typeFailed to extend %s in %s.Failed to zero %s/%sFailed to deactivate %s/%srimagemimage%s_%s_%u%s_%s%s_rmeta_%uFailed to insert layer for %s and openReducExtendlv_info failed: abortingLogical volume %s NOT reducedFilesystem check failed.Filesystem resize failed.Failed to activate %s.Problem deactivating %s.%s_voriginmetadata lvol%dsnapshot exception storestart of new LVStripe size may not exceed %sSetting read ahead sectorsCache pool is prepared.Failed to activate thin %s.Failed to activate new LV.WARNING: "%s/%s" not zeroedAborting. Failed to wipe %s.Failed to suspend origin %sLogical volume "%s" createdCannot rename "%s": name format not recognized for internal LV "%s"Failed to allocate space for new nameCannot rename "%s". New logical volume name "%s" is invalid.Logical volume "%s" already exists in volume group "%s"Ignoring invalid string in config file entry allocation/cling_tag_listIgnoring empty string in config file entry allocation/cling_tag_listIgnoring string not starting with @ in config file entry allocation/cling_tag_list: %sIgnoring empty tag in config file entry allocation/cling_tag_listMatched allocation PV tag %s on existing %s with free space on %s.Memory reallocation for parallel areas failed.%s allocation area %u %s %s start PE %u length %u leaving %u.Couldn't create LV path for %sCouldn't generate new LV size stringFailed to find segment for %s extent %uLV layout list allocation failedLV role list allocation failedInternal error: Failed to properly detect layout and role for LV %s/%sOverriding default 'mirror_region_size' setting with 'raid_region_size' setting of %u kiBFailed to allocate segment list%s:%u is no longer a user of %sInternal error: Segment %s:%u is not a user of %s.Internal error: get_only_segment_using_this_lv() called with NULL LV.%s is expected to have only one segment using it, while it has %d%s is expected to have only one segment using it, while %s:%u uses it %d timesInternal error: alloc_lv_segment: Missing segtype.Internal error: Volume %s is not thin volume or thin poolFailed to find snapshot segtypeCouldn't allocate new snapshot segment.Unable to find existing pool LV %s in VG %s.Rounding size (%d extents) up to chunk boundary size (%d extents).Couldn't allocate new zero segment.allocate_extents does not handle virtual segmentsInternal error: Missing allocatable pvs.Metadata format (%s) does not support required LV segment type (%s).Consider changing the metadata format by running vgconvert.allocation handle allocation failedInternal error: _alloc_init called for non-virtual segment with no disk space.allocation pool creation failedInternal error: Bad metadata_area_countAdjusted allocation request to %u logical extents. Existing size %u. New size %u._allocate called with no work to do!Number of extents requested (%d) needs to be divisible by %d.Parallel PVs at LE %u length %u: %sNot enough PVs with free space available for parallel allocation.Consider --alloc anywhere if desperate.Couldn't allocate areas array.Trying allocation using %s policy.Insufficient free space: %u extents needed, but only %u available%u preferred area(s) to be filled positionally.Areas to be sorted and filled sequentially.Still need %s%u total extents from %u remaining: %u (%u data/%u parity) parallel areas of %u extents eachFound %u areas for %u parallel areas and %u log areas so far.Filled %u out of %u preferred areas so far.Internal error: _alloc_parallel_area called without any allocation to do.alloced_area allocation failedAllocating parallel metadata area %u on %s start PE %u length %u.Allocating parallel area %u on %s start PE %u length %u.Insufficient suitable %sallocatable extents for logical volume %s: %u more requiredInsufficient suitable %sallocatable extents found for logical volume %s.Found fewer %sallocatable extents for logical volume %s than requested: using %u extents (reduced by %u).Insufficient free space for log allocation for logical volume %s.Missing segtype in lv_add_segment().lv_add_segment cannot handle virtual segmentsLog segments can only be added to an empty LVCouldn't allocate new LV segment.Couldn't merge segments after extending logical volume.Internal error: for_each_sub_lv failure.Generating list of PVs that %s/%s uses:Cannot rename internal LV "%s".Cannot resize external origin "%s".Cannot resize a RAID %s directlyCannot resize %s while it is tracking a split imageVaried striping not supported. Ignoring.Mirrors not supported. Ignoring.Varied stripesize not supported. Ignoring.Reducing stripe size %s to maximum, physical extent size %sStripe size must be power of 2Policy-based resize is supported only for snapshot and thin pool volumes.Can't resize internal logical volume %sCan't resize %s while lvconvert in progress--poolmetadatasize can be used only with thin pools.Online metadata resize for %s/%s is not supported.Rounding size to boundary between physical extents: %sSpecified LV does not have an origin LV.Converted %u%%%s into %s%u %s extents.VolumeType does not match (%s)Cannot vary number of mirrors in LV yet.Please specify number of stripes (-i) and stripesize (-I)Unable to extend "%s" segment type with different number of stripes.Using stripesize of last segment %sIgnoring stripes, stripesize and mirrors arguments when reducingUnable to reduce %s below 1 extent.Stripesize for striped segment should not be 0!Unable to extend %s by %u logical extents: exceeds limit (%u).Reached maximum COW size %s (%u extents).New size (%d extents) matches existing size (%d extents)Rounding size (%d extents) up to stripe boundary size for segment (%d extents)Rounding size (%d extents) down to stripe boundary size for segment (%d extents)New size given (%d extents) not larger than existing size (%d extents)New size given (%d extents) not less than existing size (%d extents)New size for %s: %u. Existing logical extents: %u / physical extents: %u.Snapshot origin volumes cannot be reduced in size yet.Snapshot origin volumes can be resized only while inactive: try lvchange -anThin pool volumes cannot be reduced in size yet.Extension of reduced thin volume with external origin is unsupported.Thin target does not support external origin smaller then thin volume.Support for online metadata resize not detected.Rounding pool metadata size to boundary between physical extents: %sUnable to extend %s by %u extents, exceeds limit (%u).Rounding size to maximum supported size 16GiB for metadata volume %s.Metadata volume %s has already %s.Maximum number of logical volumes (%u) reached in volume group %sUnable to allocate logical volume structureparallel_areas allocation failedFailed to generate unique name for the new logical volumeUnable to create LV %s in Volume Group %s: name already in use.Dropping snapshot merge of %s to removed origin %s.Dropping snapshot merge of removed %s to origin %s.Segment extent reduction %u not divisible by #stripes %uUnable to reduce RAID LV - operation not implemented.Failed to remove RAID image %sFailed to remove RAID meta-device %sRemove %s:%u[%u] from the top of LV %s:%uCan't convert non-striped segment to mirrored.Can't convert striped segment with multiple areas to mirrored.Couldn't allocate converted LV segmentFailed to split segment at %s extent %uLV %s in VG %s is now visible.Mirror layer must be inserted before adding mirrorsFailed to allocate widened LV segment for %s.Can't remove logical volume "%s" under snapshotCan't remove external origin logical volume "%s".Can't remove logical volume %s used by a mirrorCan't remove logical volume %s used as mirror logCan't remove logical volume %s used as RAID deviceCan't remove logical volume %s used by a pool.Do you really want to remove%s active %slogical volume %s? [y/n]: Do you really want to remove and DISCARD logical volume %s? [y/n]: Unable to deactivate logical volume "%s"Ignoring update failure of pool %s.Error releasing logical volume "%s"WARNING: Support for snapshots with old LVM1-style metadata is deprecated.WARNING: Please use lvconvert to update to lvm2 metadata at your convenience.Failed to refresh %s without snapshot.Logical volume "%s" successfully removedFailed to obtain merging snapshot progress percentage for logical volume %s.Can't remove merging snapshot logical volume "%s"Removing snapshot "%s" that failed to merge may leave origin "%s" inconsistent. Proceed? [y/n]: Removing origin %s will also remove %u snapshots(s). Proceed? [y/n]: Unable to fully deactivate merging origin "%s".Unable to remove merging origin "%s".Unable to remove "%s", volume is merged to "%s".Removal of pool metadata spare logical volume "%s" disables automatic recovery attempts after damage to a thin or cache pool. Proceed? [y/n]: Logical volume "%s" not removed.Removing %s "%s" will remove %u dependent volume(s). Proceed? [y/n]: Incompatible layer boundary: %s:%u[%u] on %s:%ulayer segment for %s:%u not foundRemoving layer %s for segments of %sLayer status does not match: %s:%u status: 0x%llx/0x%llxLayer boundary mismatch: %s:%u-%u on %s:%u / %u-%u / Internal error: Wrong layer %s in %slayer name allocation failed. Remove new LV and retry.Creating transient LV %s for mirror conversion in VG %s.Creation of transient LV %s for mirror conversion in VG %s failed.Aborting. Unable to tag transient mirror layer.Failed to write intermediate VG %s metadata for mirror conversion.Failed to commit intermediate VG %s metadata for mirror conversion.Failed to resume transient LV %s for mirror conversion in VG %s.Internal error: Non-pvmove LV, %s, passed as argumentInternal error: Bad segment type for first segment areaFailed to build pvmove LV-type mirror, %sInserting layer %s for segments of %s on %sMatched PE range %s:%u-%u against %s %u len %uFailed to insert segment in layer LV %s under %s:%u-%uVolume "%s/%s" is not active locally.Name too long - device not cleared (%s)%s: not found: device not clearedWiping known signatures on logical volume "%s/%s"Initializing %s of logical volume "%s/%s" with value %d.Aborting. Failed to extend %s in %s.Failed to activate %s/%s for clearingClearing metadata area of %s/%sAdjusting RAID region_size from %uS to %uS to support large LV sizeAdding segment of type %s to LV %s.Internal error: Cannot lv_extend() the existing %s segment.Internal error: Non-empty LV passed to _lv_insert_empty_sublvFailed to create mapping segment for %s%s/%s is not active locally. Unable to get sync percent.Do full resync of extended portion of %s/%s? [y/n]: Failed to get sync percent for %s/%sSkipping initial resync for extended portion of %s/%s%s/%s cannot be extended while it is recovering.Unable to resize logical volumes of cache type.Thin pool volumes do not have filesystem.Ignoring PVs on command line when reducingLogical volume %s must be activated before resizing filesystemWARNING: Reducing active%s logical volume to %sTHIS MAY DESTROY YOUR DATA (filesystem etc.)Do you really want to reduce %s? [y/n]: %sing logical volume %s to %s%sSize of logical volume %s unchanged from %s (%u extents).Size of logical volume %s changed from %s (%u extents) to %s (%u extents).Logical volume %s successfully resizedExtending logical volume %s to %s.Zero segment type for virtual origin not foundVirtual origin name allocation failed.ACTIVATION_SKIP flag set for LV %s/%s, skipping activation.Metadata does not support %s segments.The extent size in volume group %s is too small to support striped RAID volumes.Reducing requested stripe size %s to maximum, physical extent size %s.Rounding size (%d extents) up to stripe boundary size (%d extents).Can't wipe start of new LV without using device-mapper kernel driverCaching locked devices is not supported.No size given for new cache origin LVOrigin size cannot be smaller than the cache_poolNo size given for new cache_pool LVcache-pool size cannot be larger than the originSnapshots of locked devices are not supported.Can't create snapshot without using device-mapper kernel driverCan't share virtual origins. Use --virtualsize.Snapshots of snapshots are not supported yet.Snapshots of locked devices are not supported yetSnapshots of an origin that has a merging snapshot is not supportedSnapshots of thin pool %sdevices are not supported.WARNING: Snapshots of mirrors can deadlock under rare device failures.WARNING: Consider using the raid1 mirror type to avoid this.WARNING: See global/mirror_segtype_default in lvm.conf.%s must be active exclusively to create snapshotUnable to create new logical volume with no extentsUnable to create %s smaller than 1 chunk.Volume group "%s" has insufficient free space (%u extents): %u required.Number of stripes (%u) must not exceed number of physical volumes (%d)Can't create %s without using device-mapper kernel driver.Volume group %s does not support tagsInternal error: Undefined pool for thin volume segment.WARNING: New %s won't be synchronised. Don't read what you didn't write!Setting device number to (%d, %d)Cannot use writable LV as the external origin.Cannot use active LV for the external origin.Test mode: Skipping activation, zeroing and signature wiping.Failed to suspend thin snapshot origin %s/%s.Failed to resume thin snapshot origin %s/%s.Aborting. Failed to activate snapshot exception store.Signature wiping on "%s/%s" not requestedAborting. Couldn't deactivate snapshot COW area. Manual intervention required.Problem reactivating origin %sUnable to deactivate failed new LV "%s/%s". Manual intervention required.Couldn't create virtual origin for LV %s8FEtGGF4GLV %s is thin volume without exactly one segment.LV %s is thin volume without first thin volume segment.LV %s is thin pool volume without exactly one segment.LV %s is thin pool without first thin pool segment.LV %s: segment 1 pool data LV does not point back to same LVLV %s: segment 1 pool metadata LV does not point back to same LVLV %s invalid: segment %u should begin at LE %u (found %u).LV %s: segment %u has inconsistent area_len %uLV %s: segment %u log LV %s is not a mirror log or a RAID imageLV %s: segment %u log LV %s is not a mirror logLV %s: segment %u log LV does not point back to mirror segmentLV %s: segment %u mirror image is not mirroredLV %s is missing thin pool flag for segment %uLV %s is a thin volume that must not contain thin pool segment %uLV %s: %s segment %u is missing a pool data LVLV %s: %s segment %u data LV does not refer back to pool LVLV %s: %s segment %u is missing a pool metadata LVLV %s: %s segment %u metadata LV does not refer back to pool LVLV %s: %s segment %u has chunk size %u out of range.LV %s: segment %u must not have thin pool metadata LV setLV %s is missing thin volume flag for segment %uLV %s is a thin pool that must not contain thin volume segment %uLV %s: segment %u is missing thin pool LVLV %s: thin volume segment %u pool LV is not flagged as a pool LVLV %s: thin volume segment %u has too large device id %uLV %s: external origin %s is writable.LV %s: thin volume segment %u merging LV %s is not flagged as a thin LVLV %s: merging LV %s is not flagged as merging.LV %s is missing cache flag for segment %uLV %s: segment %u is missing cache_pool LVLV %s: segment %u must not have thin pool LV setLV %s: segment %u has same LV %s for both origin and snapshotLV %s: segment %u has unassigned area %u.LV %s: segment %u has inconsistent PV area %uLV %s: segment %u has inconsistent LV area %uLV %s: segment %u mirror image %u missing mirror ptrLV %s segment %u uses LV %s, but missing ptr from %s to %sLV %s has duplicated links to LV %s segment %uLV %s: mirrored LV segment %u has wrong size %u (should be %u).LV %s is used by LV %s:%u-%u, but missing ptr from %s to %sReference count mismatch: LV %s has %u links to LV %s:%u-%u, which has %u linksLV %s: inconsistent LE count %u != %uLV segment %s:%u-%u is incorrectly listed as being used by LV %sSegment with extent %u in LV %s not foundUnable to split the %s segment at LE %u in LV %sCouldn't allocate cloned LV segment.LV segment tags duplication failedSplit %s:%u[%u] at %u: %s LE %uSplit %s:%u[%u] at %u: %s PE %uUnassigned area %u found in segmentmetadata/merge.cSkipping clustered volume group %sVolume group %s is not resizeable.Internal error: Referenced LV %s not listed in VG %s.Internal error: Referenced PV %s not listed in VG %s.Failed to allocate bitset for setting random bits.dm_pool_begin_object failed for random list of bits.Failed to generate list of random bits.Failed to finish list of random bits.Selected %u random bits from %u: %sFailed to allocate pv structure.Missing device %s reappeared, updating metadata for VG %s to version %u.Device still marked missing because of allocated data on it, remove volumes and consider vgreduce --removemissing.%s: Setting PE alignment to %lu sectors.%s: Setting PE alignment offset to %lu sectors.New volume group name "%s" is invalid.%s: already exists in filesystemNew volume group path exceeds maximum length of %d!Old and new volume group names must differvg->name allocation failed for '%s'pv->vg_name allocation failed for '%s'Physical extent size used for volume group %s is less than physical block size that %s uses.Logical volume %s/%s does not support tagsFailed to duplicate tag %s from %s/%sFailed to duplicate tag %s from %sFailed to add tag %s to volume group %sVolume Group allocation policy cannot inherit from anythingPhysical extent size may not be zeroNumber of volumes may not exceed 255Rounding up size to full physical extent %sVolume too large (%s) for extent size %s. Upper limit is %s.Physical volume %s not in volume group %s.Unable to remove physical volume '%s' from volume group '%s'.Internal error: Read ahead data missing.Logical volumes in "%s" must be inactiveExtent sizes differ: %d (%s) and %d (%s)Maximum number of physical volumes (%d) exceeded for "%s" and "%s"Maximum number of logical volumes (%d) exceeded for "%s" and "%s"Metadata types differ for "%s" and "%s"Clustered attribute differs for "%s" and "%s"Duplicate logical volume name "%s" in "%s" and "%s"Physical volume %s might be constructed from same volume group %s.Calculated readahead of LV %s is %uInternal error: VG %s allocation policy set to invalid cling_by_tags.Internal error: VG %s tag %s has invalid form.Internal error: PV list corruption detected in VG %s.Internal error: VG %s PV list entry points to different VG %s.Internal error: VG name for PV %s is corrupted.Internal error: Duplicate PV id %s detected for %s in %s.Internal error: PV %s tag %s has invalid form.Internal error: PV segments corrupted in %s.Internal error: LV name "%s/%s" length %zu is not supported.Internal error: LV %s has VG UUID %s but its VG %s has UUID %sInternal error: LV segments corrupted in %s.Internal error: LV %s allocation policy set to invalid cling_by_tags.Internal error: LV name %s has invalid form.Internal error: LV %s tag %s has invalid form.Internal error: #LVs (%u) != #visible LVs (%u) + #snapshots (%u) + #internal LVs (%u) in VG %sFailed to allocate lv_name hashInternal error: Duplicate LV name %s detected in %s.Internal error: Duplicate LV id %s detected for %s in %s.Internal error: LV %s is %u. pool metadata spare (>1).Internal error: LV %s is not vg pool metadata spare.Internal error: Segment in %s is not 2-way.Internal error: Segment in %s has wrong number of areas: %d.Internal error: Volume group %s has limited PV/LV count but limit is not set.Internal error: VG references non pool metadata spare LV %s.Attempt to drop cached metadata failed after reverted update for VG %s.Format does not support writing physical volumesAssertion failed: can't _pv_write non-orphan PV (in VG %s)%s not opened: device not zeroedFailed to clear metadata from physical volume "%s" after removal from "%s"Removing physical volume "%s" from volume group "%s"Failed to remove physical volume "%s" from volume group "%s"Volume group "%s" successfully removedVolume group "%s" not properly removedDevice %s not found (or ignored by filtering).Could not find LVM label on %sFound label on %s, sector %llu, type=%.8sAttempt to modify a read-only VGVolume group "%s" not found, is inconsistent or has PVs missing.Consider vgreduce --removemissing if metadata is inconsistent.Volume group "%s" still contains %u logical volume(s)Couldn't allocate format_instance object.Adding physical volume '%s' to volume group '%s'pv_list allocation for '%s' failedPhysical volume '%s' is already in volume group '%s'Physical volume %s is of different format type (%s)Physical volume %s might be constructed from same volume group %sFormat-specific setup of physical volume '%s' failed.Physical volume '%s (%s)' already in the VG.No space for '%s' - volume group '%s' holds max %d physical volume(s).Unable to add %s to %s: new extent count (%llu) exceeds limit (%u).pv_to_create allocation for '%s' failedFailed to create random uuid for %s.WARNING: %s: Overriding real size. You could lose data.%s: Pretending size is %llu sectors.%s: Size must exceed minimum of %llu sectors.pv_list allocation in pv_create failedFormat-specific initialisation of physical volume %s failed.Failed to add metadata area for new physical volume %sPhysical volume %s not in volume group %sLogical volume %s not in volume group %sNo physical volume found in lvmetad cache for %sNo cache info in lvmetad cache for %s.Failed to read existing physical volume '%s'metadata_area allocation failedInternal error: Attempt to write new VG metadata without locking %sAttempt to drop cached metadata failed after commit for VG %s.%s ignored flag for mda %s at offset %llu.Adjusting ignored mdas for %s: %u of %u mdas in use but %u required. Changing %u mda.Internal error: Unable to find %u metadata areas to unignore on volume group %sCannot update partial volume group %s.Cannot update volume group %s while physical volumes are missing.Cannot update volume group %s with unknown segments in it!Internal error: Unable to find %u metadata areas to ignore on volume group %sAborting vg_write: No metadata areas to write to!Unable to drop cached metadata for VG %s.Internal error: Writing metadata in critical section.Format does not support writing volumegroup metadata areasWARNING: Failed to write an MDA of VG %s.Automatic metadata correction failedAutomatic metadata correction commit failedInternal error: vg_read_internal requires vgname with pre-commit.Failed to create format instanceNot repairing VG %s metadata seqno (%d != %d) as global/metadata_read_only is set.Cached VG %s had incorrect PV listInconsistent pre-commit metadata copies for volume group %sInternal error: Too many inconsistent MDAs.Inconsistent metadata UUIDs found for volume group %sWARNING: Inconsistent metadata found for VG %s - updating to use version %uRemoving PV %s (%s) that no longer belongs to VG %sWARNING: Interrupted pvmove detected in volume group %sPlease restore the metadata by running vgcfgrestore.Updating cache for PVs without mdas in VG %s.get_pv_from_vg_by_id: vg_read_internal failed to read VG %sWARNING: Volume group %s is not consistentinternal PV duplication failedA volume group called '%s' already exists.Couldn't create uuid for volume group '%s'.Format specific setup of volume group '%s' failed.WARNING: Volume Group %s is not consistentVG list element allocation failedPhysical volume %s not in a volume groupuuid %s already in use on "%s"Can't initialize physical volume "%s" of volume group "%s" without -ffReally INITIALIZE physical volume "%s" of volume group "%s" [y/n]? %s: physical volume not initializedCan't open %s exclusively. Mounted filesystem?WARNING: Forcing physical volume creation on %s%s%s%sFailed to duplicate pv name %s.%s not identified as an existing physical volumeUnable to add physical volume '%s' to volume group '%s'.Rescan for PVs without metadata areas failed.Volume group name "%s" has invalid characters.Volume group "%s" inconsistent.Cannot change VG %s while PVs are missing.Consider vgreduce --removemissing.Cannot change VG %s with unknown segments in it!Recovery of volume group "%s" failed.Finding %svolume group for uuid %sVolume group %s metadata is inconsistentvg_read_by_vgid: get_vgnames failedCan't find logical volume id %sVolume group for uuid not found: %sMetadata areas on physical volume "%s" already ignored.Metadata areas on physical volume "%s" already marked as in-use.Physical volume "%s" has no metadata areas.Marking metadata areas on physical volume "%s" as %s.Internal error: LV %s/%s (UUID %s) not found in ondisk metadata.metadata/metadata.cVolume group %s is exportedVolume group %s is read-only%u snprintf random bit failed.Failed to add tag %s to %s/%sFailed to allocate pvid hash.Failed to hash pvid.Failed to allocate uuid hashFailed to hash lvname.Failed to hash lvid.vg_make_handleZeroing start of device %s%s not wiped: abortingvg_remove_mdas %s failedformat_instancepv allocation for '%s' failedFailed to hash mda.SettingClearingEmpty mda found for VG %s.Checking inconsistent MDA: %sInvalid vg name %svg_createget_pvs: get_vgids failedPV list allocation failedPhysical volume %s not found of volume group "Aborting pvcreate on %s.Volume group "%s" not foundprecommitted Found volume group "%s"in-useUnable to determine mirror sync status of remotely active LV, %s/%sUnable to determine mirror sync status of %s/%s.Intermediate VG commit for orphan volume failed.Test mode: Skipping mirror log initialisation.Aborting. Unable to create in-sync mirror log while activation is disabled.Aborting. Unable to deactivate mirror log.Aborting. Unable to tag mirror log.Aborting. Failed to activate mirror log.Aborting. Failed to wipe mirror log.Name allocation failed - log header not written (%s)Name too long - log header not written (%s)Writing log header to device, %s%s: not found: log header not writtenFailed to write log header to %sAborting. Failed to deactivate mirror log. Manual intervention required.Unable to deactivate mirror log LV. Manual intervention required.Manual intervention may be required to remove abandoned log LV before retrying.Manual intervention may be required to remove/restore abandoned log LV before retrying.Aborting. Failed to write mirror log header.img_name allocation failed. Remove new LV and retry.Aborting. Failed to create mirror image LV. Remove new LV and retry.Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror segment. Remove new LV and retry.Failed to initialise mirror log.Failed to find mirror_seg for %s%s on %s is not a mirror segmentsUsing reduced mirror region size of %u sectorsUnable to allocate mirror extents for %s.Failed to add mirror areas to %sInternal error: Unknown mirror flagInvalid index (%u) of mirror image supplied to shift_mirror_images()Reducing mirror set %s from %u to %u image(s)%s.Incompatible parameters to _remove_mirror_imagesInternal error: _remove_mirror_images called incorrectly with is_removable undefined.Unable to remove primary mirror image while mirror is not in-sync%s being removed due to failuresFailed error target substitution for %sProblem suspending temporary LV %sProblem resuming temporary LV, %sFailed to initialize log deviceNo mirror images found using specified PVs.%u images are removed out of requested %u.Failed to find mirrored LV for %sNot collapsing %s: out-of-syncFailed to release mirror imagesSegment is not mirrored: %s:%uSegment status does not match: %s:%u status:0x%llx/0x%llxMultiple-segment mirror is not supportedUnable to determine mirror sync status.Unable to determine sync status of remotely active mirror, %sUnable to convert the log of an inactive cluster mirror, %sFull resync required to convert inactive mirror %s to core log. Proceed? [y/n]: Logical volume %s NOT converted.Unable to convert the log of a mirror, %s, that is active remotely but not locallyUnable to allocate extents for mirror log.Unable to allocate extents for mirror(s).Persistent log is not supported on segment-by-segment mirroringStriped-mirroring is not supported on segment-by-segment mirroringUnsupported mirror conversion typeShared cluster mirrors are not available.Logical Volume "%s" already exists in volume group "%s"Unable to split mirror that is not in-sync.Unable to split non-mirrored LV, %sInternal error: split_count is zero!Detaching %d images from mirror, %sInsufficient removable PVs given to satisfy requestUnable to rename newly split LVFailed to build new mirror, %sFailed to build new image name.Failed to generate new image namesFailed to group split images into new mirrorIntermediate VG metadata write failed.Failed to rename newly split LV in the kernelRemoving more than existing: %d <= %dmetadata/mirror.cAborting. Unable to tag.log_name allocation failed._mimage_%d_mlogtmp_%d_mlogFailed to create mirror log.Failed to form mirrored log. and no log volumeFailed to add mirror imagesAll mimages of %s are goneintermediate VG write failed.Failed to resume %s%u image(s) removed from %slvs list alloc failedMirror already has a %s logFailed to convert mirror logNo conversion is requested%s assigned to be splitUnable to allocate memoryProblem resuming %sNot a mirror segmentInternal error: Unable to attach pool metadata LV to %s segtype.Internal error: Logical volume %s is not valid pool.Internal error: Unable to attach pool data LV to %s segtype.Internal error: Unable to attach pool to %s/%s that is not cache or thin volume.Internal error: No pool associated with %s LV, %s.Internal error: Cannot detach pool from LV %s.Internal error: Trying to delete %u again.Internal error: Unsupported message type %u.Failed to find pool_seg for %s%s on %s is not a %s pool segmentInternal error: %s is not a pool logical volume.No usable device hint found while recalculating pool chunk size for %s.Calculated chunk size %s for pool %s is out of allowed range (%s-%s).Chunk size %s is bigger then pool data size.Internal error: Pool %s already has extents.WARNING: Pool %s is created without initialization.Aborting. Failed to wipe pool metadata %s.Name is too long to be a pool name.Aborting. Could not deactivate pool %s.Internal error: LV %s is not pool metadata spare.Internal error: LV %s has no suffix for pool metadata spare.Failed to generate unique name for pool metadata spare logical volume.Renaming existing pool metadata spare logical volume "%s/%s" to "%s/%s".Can't create pool metadata spare. Name of pool LV %s is too long.WARNING: recovery of pools without pool metadata spare LV is not automated.Unable to deactivate pool metadata spare LV. Manual intervention required.metadata/pool_manip.cDiscarding message for LV %s.Using pool metadata size %s.%s_pmsparemetadata/pv.cCannot disable all metadata areas in volume group %s.Internal error: PV %s unexpectedly not in cache.pv_segment allocation failedmetadata/pv_manip.c%s %u: %6u %6u: %s(%u:%u)Gap in pvsegs: %u, %uWrong lvseg area typeInconsistent pvseg pointersInconsistent length: %u %uDevice %s not foundNo PV label found on %s.Segment with extent %u in PV %s not foundMissing PV segment on %s at %u.discard_pv_segment with unallocated segment: %s PE %uSkipping discard on missing device with uuid %s.Discarding %u extents offset %llu sectors on %s.release_pv_segment with unallocated segment: %s PE %uInternal error: _merge_free_pv_seg called on a segment that is not free.PV segment pe_count mismatch: %u != %uPV segment pe_alloc_count mismatch: %u != %uPV segment VG pv_count mismatch: %u != %uPV segment VG free_count mismatch: %u != %uPV segment VG extent_count mismatch: %u != %uUnable to read volume group "%s".Physical volume %s format does not support resizing.%s: Pretending size is %llu not %llu sectors.Resizing volume "%s" to %llu sectors.Size must exceed minimum of %llu sectors on PV %s.Size must exceed physical extent start of %llu sectors on PV %s.Format specific resize of PV %s failed.Size must leave space for at least one physical extent of %u sectors on PV %s.No change to size of physical volume %s.Resizing physical volume %s from %u to %u extents.%s: cannot resize to %u extents as there is only room for %llu.%s: cannot resize to %u extents as %u are allocated.%s: cannot resize to %u extents as later ones are allocated.Internal error: Physical Volume %s has a label, but is neither in a VG nor orphan.PV %s belongs to Volume Group %s so please use vgreduce first.(If you are certain you need pvremove, then confirm by using --force twice.)Really WIPE LABELS from physical volume "%s" of volume group "%s" [y/n]? %s: physical volume label not removedWARNING: Wiping physical volume label from %s%s%s%sCan't open %s exclusively - not removing. Mounted filesystem?Failed to wipe existing label(s) on %sLabels on physical volume "%s" successfully wipedReally WIPE LABELS from physical volume "%s" of volume group "%s" [y/n]? metadata/pv_map.ccreate_pv_maps alloc failedpvl->pv->devto_go <= pva->countAllowing allocation on %s start PE %u length %uCouldn't create physical volume maps in %sconsume_pv_area_create_mapsInternal error: Unable to remove RAID layer from segment type %sInternal error: Unable to remove RAID layer when there is more than one sub-lvInternal error: Empty list of LVs given for clearingInternal error: LVs must be set visible before clearingFailed to activate localy %s for clearingUnable to remove %d images: Only %d device%s given.%s has components with error targets that must be removed first: %sTry removing the PV list and rerun the command.LVs with error segments to be removed: %s %sUnable to extract %sRAID image while RAID array is not in-syncExtracting image components %s and %s from %sUnable handle arrays with more than 10 devicesInternal error: Metadata segment area #%d should be AREA_UNASSIGNEDUnable to extract enough images to satisfy requestFailed to shift and rename image componentsInternal error: Bad type provided to _alloc_raid_componentInternal error: Stand-alone %s area allocation not implementedFailed to allocate new raid component, %sFailed to add segment to LV, %sInternal error: Unable to allocate RAID metadata area for non-linear LV, %sFailed to build list of PVs for %s/%sAn entire mirror group has failed in %sAll components of raid LV %s have failedMore than %u components from %s %s have failed%s contains a segment incapable of degraded activation%s/%s already has image count of %d.%s/%s must be active exclusive locally to perform this operation.Failed to extract images from %s/%sFailed to remove RAID layer after linear conversionFailed to write changes to %s in %sFailed to suspend %s/%s before committing changesFailed to commit changes to %s in %sFailed to resume extracted LVsFailed to resume %s/%s after committing changesCan't add image to out-of-sync RAID LV: use 'lvchange --resync' first.Can't add image to RAID LV that is still initializing.Unable to add RAID images to %s of segment type %sFailed to allocate rimage name.Setting RAID1 region_size to %uSAllocation of new areas failed.Allocation of new meta areas failed.Failed to clear REBUILD flag for %s/%s componentsUnable to split more than one image from %s/%sUnable to split logical volume of segment type, %sLogical Volume "%s" already exists in %sUnable to split %s/%s while it is not in-sync.Unable to split additional image from %s while tracking changes for %sUnable to split images from non-mirrored RAIDUnable to split image from %s/%s while not in-syncCannot track more than one split image at a timeUnable to find image to satisfy request%s split from %s for read-only purposes.Use 'lvconvert --merge %s/%s' to merge back into %sUnable to merge non-mirror image %s/%s%s/%s is not read-only - refusing to mergeUnable to find containing RAID array for %s/%sFailed to deactivate %s/%s before merging%s/%s successfully merged back into %s/%sInternal error: New segtype not specifiedUnable to convert %s/%s while it is not in-syncClearing newly allocated metadata LVsAllocating new metadata LV for %sFailed to allocate metadata LV for %s in %sFailed to initialize metadata LVsFailed to rename mirror imagesConverting the segment type for %s/%s from %s to %s is not yet supported.%s/%s does not contain devices specified for replacementUnable to replace RAID images while the array has unassigned areasUnable to replace devices in %s/%s while it is not in-sync.Unable to remove all PVs from %s/%s at once.Unable to replace more than %u PVs from (%s) %s/%sUnable to replace all the devices in a RAID10 mirror group.Failed to replace %u devices. Attempting to replace %u instead.%u extents needed to repair %sFailed to allocate replacement images for %s/%sFailed to remove the specified images from %s/%sInternal error: %s/%s is not a partial LVAttempting to remove missing devices from %s LV, %sReplacing %s and %s segments with error targetFailed to replace %s/%s's extents with error targetmetadata/raid_manip.cMemory allocation failed.Failed to zero %sFailed to deactivate %sprimary Extracting %u %s from %s/%s%s_extractedShifting images in %sShifting %s and %s by %uFailed to extract %s from %s%s_rmeta_%%d%s_rimage_%%d_mimage_Memory allocation failed%s_rimage_%u_rimage_0Adding %s to %sFailed to add %s to %sRemoving mirror log, %sFailed to remove mirror logSetting new segtype for %s%s has enough space for %sNot enough space on %s for %smetadata/replicator_manip.cFIXME: not implemented.Allocation of cmd_vg failed.Allocation of vg_name failed.Allocation of vgid failed.Failed to vg_read %sVG: %s added as missing.Replicator device in site %s already has sync log.Sync log %s is already used by replicator %s.Replicator device in site %s does not have sync log.Replicator device %s is already part of replicator.Rlog device %s is already used.Replog segment %s does not have rlog.Volume Group %s of replicator %s is clusteredReplicator %s segment size %d != 1Defined fall_behind_timeout=%d for sync replicator %s/%s.Defined fall_behind_ios=%d for sync replicator %s/%s.Defined fall_behind_data=%llu for sync replicator %s/%s.Defined fall_behind_timeout and fall_behind_ios for async replicator %s/%s.Defined fall_behind_timeout and fall_behind_data for async replicator %s/%s.Defined fall_behind_ios and fall_behind_data for async replicator %s/%s.fall_behind_timeout, fall_behind_ios and fall_behind_data are undefined for async replicator %s/%s.Duplicate site name %s detected for replicator %s.Duplicate VG name %s detected for replicator %s.Duplicate site index %d detected for replicator site %s/%s.Site index %d > %d (too high) for replicator site %s/%s.Duplicate sync log %s detected for replicator %s.Duplicate device name %s detected for replicator %s.Duplicate device index %lld detected for replicator site %s/%s.Device index %llu > %llu (too high) for replicator site %s/%s.Logical volume %s is already part of other replicator.Logical volume %s can not be attached to an already defined replicator deviceEither vg_name or vgid must be set.Unable to read volume group %smetadata/segtype.cWARNING: Unrecognised segment type %smetadata/snapshot_manip.csnapshot%dsnapshot-mergeSnapshot volume cannot be smaller than 3 chunks (%u extents, %s).'%s' is already in use as a snapshot.Snapshot and origin LVs must differ.Failed to deactivate logical volume "%s"Failed to remove internal snapshot LV %sUnable to activate logical volume "%s"Internal error: LV "%s" already has external origin.Setting logical volume "%s" read-only.Internal error: Inconsitent external origin.Internal error: LV %s is not pool.Internal error: Cannot attach message to non-pool LV %s.Message referring LV %s already queued in pool %s.Delete for device %u already queued in pool %s.Failed to allocate memory for message.Internal error: pool_is_active called with non-pool LV %s.Internal error: LV %s is not thin pool.Pool %s needs to be locally active for threshold check.Free space in pool %s is above threshold, new volumes are not allowed.Can't use "%s/%s" as external origin with "%s/%s" pool. Size %s is not a multiple of pool's chunk size %s.Internal error: Segment in %s is not a thin pool segment.Internal error: Updated LV %s is not pool.Cannot activate thin pool %s, perhaps skipped in lvm.conf volume_list?Thin pool discards type "%s" is unknown.Internal error: Could not find configuration.Chunk size must be a power of 2 for this thin target version.Chunk size must be multiple of %s.WARNING: Chunk size is too small for pool, suggested minimum is %s.WARNING: Chunk size is smaller then suggested minimum size %s.WARNING: Minimum supported pool metadata size is %s.Internal error: Unknown discards type encountered.metadata/thin_manip.cdeleteAdded %s message.LV %s has no segmentCannot find free device_id.Found free pool device_id %u.nopassdownSetting chunk size %s.New size %llu for %s%s not an exact number of new extents.New extent count %llu for %s%s exceeds 32 bits.Internal error: global memory pool used for VG %sFailed to allocate VG hostname hashtable.Failed to allocate volume group structureSetting mda_copies to %u for VG %sVolume group "%s" must be resizeable to change PE sizePhysical extent size must be a power of 2.New extent size is not a perfect fitVolume group "%s" must be resizeable to change MaxLogicalVolumeMaxLogicalVolume is less than the current number %d of LVs for %sVolume group "%s" must be resizeable to change MaxPhysicalVolumesMaxPhysicalVolume limit is 255MaxPhysicalVolumes is less than the current number %d of PVs for "%s"%s logical volumes must be inactive when changing the cluster attribute.Volume group %s contains snapshots that are not yet supported.Snapshot logical volumes must be inactive when changing the cluster attribute.Physical volume "%s" still in useCan't remove final physical volume "%s" from volume group "%s"Removing "%s" from volume group "%s"Cannot remove final metadata area on "%s" from "%s"Removal of physical volume "%s" from "%s" failedRemoved "%s" from volume group "%s"metadata/vg.cFreeing VG %s at %p.Failed to allocate VG name.Allocated VG %s at %p. free space allocated space PV segment start PV segment length area length extents moved pvseg start pvseg length area startMaxLogicalVolume limit is 255MirrorInternal error: VG is NULL.0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-misc/lvm-exec.cExecuting:%sforkChild %u exited abnormally%s failed: %upipePiping:%spipe[0]STDOUTpipe[1]STDINwaitpidInternal error: Missing command.wait4 child process %u failed: %sgethostnamemisc/lvm-file.c%s/.lvm_%s_%d_%d%s: rename to %s failedsync_dir failed in strdupF_WRLCKF_RDLCKLocking %s (%s, %hd)fcntlUnlocking fd %d%s: write errorNot enough space to build temporary file string.fcntl_lock_file failed in strdup.TEST MODE: Metadata will NOT be updated and volumes will not be (de)activated.LVM activation checks disabledmisc/lvm-globals.cLVM udev checking enabledLVM udev checking disabledLVM activation checks enabledInterrupted...misc/lvm-signal.csigactionSIGINTsigprocmaskSIG_SETMASKSIGINT restoresigfillset_block_signalsNames starting "%s" are reserved. Please choose a different LV name.Names including "%s" are reserved. Please choose a different LV name.misc/lvm-string.c_cdata_cmeta_mimage_mlog_pmspare_rimage_rmeta_tdata_tmeta_voriginpvmovesnapshotFailed to create udev library context.misc/lvm-wrappers.cUdev library context not set.Could not get udev state.Assuming udev is not running.read_urandom: /dev/urandom/var/run/clvmd.pidmlockmunlockUnlmm/memlock.cmunlockalllseek%lx-%lx %c%c%c%c%nFailed to parse maps line: %s%socked %ld bytesUnlocking memorysetpriority %u failed: %s%s/self/mapsproc_dir too longLocking memorygetprioritysetpriority %d failed: %smemlock reset.locale/locale-archive/LC_MESSAGES/gconv/gconv-modules.cache/libblkid.so./liblzma.so./libncurses.so./libpcre.so./libreadline.so./libselinux.so./libsepol.so./libtinfo.so./libudev.so./libuuid.so./libdl-/etc/selinux[vdso][vsyscall][vectors]Allocation of maps buffer failed.%s area unreadable %s : Skipping.%s ignore filter '%s' matches '%s': Skipping.%s default filter '%s' matches '%s': Skipping.%s_filter '%s' matches '%s': Skipping.%s %10ldKiB %12lx - %12lx %c%c%c%c%sInternal error: Reserved memory (%ld) not enough: used %ld. Increase activation/reserved_memory?Suppressed internal error: Maps lock %ld < unlock %ld, a one-page difference.Lock: Memlock counters: locked:%d critical:%d daemon:%d suspended:%dUnlock: Memlock counters: locked:%d critical:%d daemon:%d suspended:%dEntering critical section (%s).Leaving critical section (%s).Internal error: _memlock_inc_daemon used in critical section.memlock_count_daemon inc to %dInternal error: _memlock_count_daemon has dropped below 0.memlock_count_daemon dec to %dUnlocking daemon memory in critical section.report/report.cdm_pool_strdup failedrefresh neededmismatches existskip activationFailed to get segtype.lvname snprintf failedlvm2_Description of Device Type.Unique identifier.LV layout.LV role.Set if LV is being converted.LV allocation policy.Set if snapshot merge failed.LV health status.Active state of the LV.Size of LV in current units.Number of segments in LV.Tags, if any.LV permissions.Set if LV is suspended.Set if LV device is open.Type of metadata.Name.Size of PV in current units.VG permissions.Set if VG is extendable.Set if VG is exported.Set if VG is partial.VG allocation policy.Set if VG is clustered.Number of PVs.Number of LVs.Number of snapshots.Type of LV segment.Number of extents in segment.Device Typesdevtype_vg_Logical Volumelv_Logical Volume DevicePhysical Volumepv_Physical Volume LabelLogical Volume SegmentPhysical Volume Segmentpvseg_read-only-overridero-overrider-overridewriteablerwread-writeinactive table presentinactive tableinactivelive table presentlive tablelivesnapshot invalidmerge failedactive exclusivelyactive remotelyactive locallyfixed minorfixedallocation lockedimage syncedinitial image syncextendableundefFailed to allocate buffer for host.Failed to allocate buffer for time.Failed to allocate buffer for active.Failed to display layout for LV %s/%s.Failed to display role for LV %s/%s.Name of Device Type exactly as it appears in /proc/devices.Maximum number of partitions. (How many device minor numbers get reserved for each device.)Name. LVs created for internal use are enclosed in brackets.Full name of LV including its VG, namely VG/LV.Full pathname for LV. Blank for internal LVs.Internal device-mapper pathname for LV (in /dev/mapper directory).For LVs that are components of another LV, the parent LV.Various attributes - see man page.Set if mirror/RAID images underwent initial resynchronization.Set if mirror/RAID image is synchronized.Set if snapshot LV is being merged to origin.Set if LV is locked against allocation changes.Set if LV has fixed minor number assigned.Set if snapshot LV is invalid.Set if LV is skipped on activation.Set if the LV is active locally.Set if the LV is active remotely.Set if the LV is active exclusively.Persistent major number or -1 if not persistent.Persistent minor number or -1 if not persistent.Read ahead setting in current units.For thin pools, the size of the LV that holds the metadata.For snapshots, the origin device of this LV.For snapshots, the size of the origin device of this LV.For snapshot and thin pools and volumes, the percentage full if LV is active.For snapshots, the percentage full if LV is active.For thin pools, the percentage of metadata full if LV is active.For RAID, mirrors and pvmove, current percentage in-sync.For RAID, number of mismatches found or repaired.For RAID, the current synchronization action being performed.For RAID1, the number of outstanding writes allowed to writemostly devices.For RAID1, the minimum recovery I/O load in kiB/sec/disk.For RAID1, the maximum recovery I/O load in kiB/sec/disk.For pvmove, Source PV of temporary LV created by pvmove.For lvconvert, Name of temporary LV created by lvconvert.For mirrors, the LV holding the synchronisation log.For thin pools, the LV holding the associated data.For thin pools, the LV holding the associated metadata.For thin volumes, the thin pool LV for this volume.Configuration profile attached to this LV.Creation time of the LV, if knownCreation host of the LV, if known.Kernel device-mapper modules required for this LV.Currently assigned major number or -1 if LV is not active.Currently assigned minor number or -1 if LV is not active.Currently-in-use read ahead setting in current units.Set if LV has live table present.Set if LV has inactive table present.Size of underlying device in current units.Free metadata area space on this device in current units.Size of smallest metadata area on this device in current units.Offset to the start of data on the underlying device.Total amount of unallocated space in current units.Total amount of allocated space in current units.Set if this device can be used for allocation.Set if this device is exported.Set if this device is missing in system.Total number of Physical Extents.Total number of allocated Physical Extents.Number of metadata areas on this device.Number of metadata areas in use on this device.Offset to the start of PV Bootloader Area on the underlying device in current units.Size of PV Bootloader Area in current units.Total size of VG in current units.Total amount of free space in current units.System ID indicating when and where it was created.Size of Physical Extents in current units.Total number of unallocated Physical Extents.Maximum number of LVs allowed in VG or 0 if unlimited.Maximum number of PVs allowed in VG or 0 if unlimited.Revision number of internal metadata. Incremented whenever it changes.Configuration profile attached to this VG.Number of metadata areas on this VG.Number of metadata areas in use on this VG.Free metadata area space for this VG in current units.Size of smallest metadata area for this VG in current units.Target number of in use metadata areas in the VG.Number of stripes or mirror legs.For stripes, amount of data placed on one device before switching to the next.For mirrors, the unit of data copied when synchronising devices.For snapshots, the unit of data used when tracking changes.For thin pools, the number of thin volumes in this pool.For thin pools, how discards are handled.For thin pools, if zeroing is enabled.For thin pools, the transaction id.For thin volume, the thin device id.Offset within the LV to the start of the segment in current units.Offset within the LV to the start of the segment in physical extents.Size of segment in current units.Size of segment in physical extents.Ranges of Physical Extents of underlying devices in command line format.Underlying devices used with starting extent numbers.Dmeventd monitoring status of the segment.Physical Extent number of start of segment.Reserved value for undefined numeric value.unknownyesno10striped/striped.cstripe_size Stripes %u Stripe size %s Stripe size %u KB Stripe %d:stripe_count# linearstripe_count = %ustripe_size = %ustripeInternal error: striped add_target_line called with no areas for %s.Couldn't read stripe_size for segment %s of logical volume %s.Couldn't find stripes array for segment %s of logical volume %s.Couldn't read 'stripe_count' for segment '%s'.UUID contains invalid characterCouldn't write uuid, buffer too small.Too many characters to be uuid.Couldn't read uuid: incorrect number of characters.uuid/uuid.c0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ!#zero/zero.czero module string list allocation failedExtent size must be between %s and %sExtent size must be multiple of %sPhysical volumes cannot be bigger than %sMetadata would overwrite physical extentsReading physical volume data %s from diskVG data differs between PVs %s and %sVG data on %s: %s %s %u %u %u %u %u %u %u %u %u %u %u %u %u %u %u%d PV(s) found for VG %s: expected %dPartial mode support for missing lvm1 PVs and partially available LVs is currently not implemented.%s: partial VG, allocated missing PV using %d extents.logical volumes cannot contain more than %d extents.logical volumes cannot be larger than %sUnable to allocate metadata area structure for lvm1 formatFailed to allocate format1 format type structure.Couldn't create lvm1 label handler.Couldn't register lvm1 label handler.Couldn't create lvm1 orphan VG.format1/format1.clvm1 pv_writelvm1 pv_readformat1_vg_readlvm1 vg_writeformat1_orphan%s%s%luGenerated system_id too longformat1/import-export.cPV_EXPPV_IMPCouldn't add snapshot.Volume Group name allocation failed.System ID %s on %s differs from %s for volume groupFixing up missing format1 size (%s) for PV %sVolume group name %s too long to exportNon-PV stripe found in LV %s: unsupported by format1Segment type %s in LV %s: unsupported by format1Logical volume number out of bounds.Couldn't find logical volume '%s'.Couldn't find origin logical volume for snapshot '%s'.PV %s not found.format1/import-extents.clvm1 import_extentsPhysical volume (%s) contains an unknown logical volume (%s).Invalid LV in extent map (PV %s, PE %u, LV %u, LE %u)logical extent number out of boundslogical extent (%u) already mapped.Unable to create hash table for holding extent maps.Couldn't fill logical volume maps.Logical volume (%s) contains an incomplete mapping table.Number of stripes (%u) incompatible with logical extent count (%u) for %sFailed to allocate striped segment.Failed to allocate linear segment.Couldn't allocate logical volume maps.Couldn't build extent segments.MaxLogicalVolumes of %d exceeds format limit of %d for VG '%s'MaxPhysicalVolumes of %d exceeds format limit of %d for VG '%s'Insufficient space for metadata and PE's.Too few extents on %s. Try smaller extent size.Metadata extent limit (%u) exceeded for %s - %u requiredformat1/layout.cformat1/lvm1-label.cThe '%s' operation is not supported for the lvm1 labeller.lvm1 vg_numberformat1/vg_number.cpool pv_readformat_pool/format_pool.cpool_vg_readMissing subpool %d in pool %spool_orphanUnable to allocate %d subpool structuresUnable to allocate %d pool_device structuresMissing device %u for subpool %d in pool %sUnable to allocate metadata area structure for pool formatUnable to allocate format type structure for pool formatCouldn't create pool label handler.Couldn't register pool label handler.Couldn't create pool orphan VG.gfs_journalgfs_dataformat_pool/import_export.cFound sptype %X and converted it to %sCalculated lv uuid for lv %s: %sUnable to duplicate vg_name stringUnable to allocate pv list structureUnable to allocate pv structureStripe size must be a power of 2Unable to allocate striped lv_segment structureUnable to allocate linear lv_segment structureformat_pool/pool_label.cThe '%s' operation is not supported for the pool labeller.locking/cluster_locking.cEOF reading CLVMDcluster request failed: %s^P_clvmd not running on node %sError locking on node %s: %sUNNLCRPRPWEX|REVERT|ORIGIN_ONLY|CACHE|REMOTE|LOCAL|CLUSTER|HOLD|NONBLOCKRequesting sync names.%c_%sLocking resource %s too long.Unrecognised lock type: %uError writing data to clvmd: %sError reading data from clvmd: %s%s: clvmd socket name too long.Local socket creation failed: %sconnect() failed on local socket: %sSkipping redundant local sync command.strlen(resource) < sizeof(lockname)Requesting backup of VG metadata for %sLocking %s %s %s (%s%s%s%s%s%s%s%s%s) (0x%x)Lock held for %s, node %s : %st\_lock_for_cluster_lock_resource/run/lvm/clvmd.socksnapshot-originsnapshot/snapshot.cmerging_storecow_storechunk_size = %ucow_store = "%s"merging_store = "%s"Target snapshot may leak metadata.Couldn't read chunk size for snapshot.Merging store must be a string in segment %s of logical volume %s.Both snapshot cow and merging storage were specified in segment %s of logical volume %s.Cow store must be a string in segment %s of logical volume %s.Snapshot origin not specified in segment %s of logical volume %s.Snapshot origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot cow store in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot origin in segment %s of logical volume %s.Snapshot cow storage not specified in segment %s of logical volume %s.snapshot string list allocation failedmirror/mirrored.cclogFound mirror log at %d:%dStatus of log (%s): %sFound mirror image at %d:%dFailed to find image %d (%s).Status of image %d: %cextents_movedmirror_logmirror_count = %uextents_moved = %umirror_log = "%s"region_size = %u Mirrors %u Mirror size %u Mirror log volume %s Mirror region size %s Mirror original: Mirror destinations:Mirror status: %s%u %n%*x:%*x %n%llu/%llu%nmirror_countcluster log string list allocation failedmirror string list allocation failedCluster mirror log daemon not included in build.Mirrored transient status: "%s"Unexpectedly many (%d) mirror images in %s.Unexpectedly many (%d) log arguments in %s.Active mirror has a wrong number of mirror images!Metadata says %d, kernel says %d.Check for existence of mirror log %s failed.Mirror log mismatch. Metadata says %s, kernel says %s.Check for existence of mirror image %s failed.Match: metadata image %d matches kernel image %dCouldn't read 'extents_moved' for segment %s of logical volume %s.Couldn't read 'region_size' for segment %s of logical volume %s.Unrecognised mirror log in segment %s of logical volume %s.Missing region size for mirror log for segment %s of logical volume %s.Couldn't find mirrors array for segment %s of logical volume %s.struct mirr_state allocation failedFailure parsing mirror status mirror count: %sFailure parsing mirror status devices: %sFailure parsing mirror status fraction: %sMissing region size for mirror segment.Failed to build uuid for log LV %s.Failed to build uuid for mirror LV %s.Couldn't read 'mirror_count' for segment '%s'.raid/raid.cmin_recovery_ratemax_recovery_rateraidsNo areas found for segment %sFailed to import RAID imagesdevice_count = %uwritebehind = %umin_recovery_rate = %umax_recovery_rate = %u Raid Data LV%2d Raid Metadata LV%2d %sdevice_countTarget raid does not support %s.Cannot read target version of RAID kernel module.Failed to parse %s status fraction: %sCouldn't read 'stripe_size' for segment %s of logical volume %s.Couldn't read 'writebehind' for segment %s of logical volume %s.Couldn't read 'min_recovery_rate' for segment %s of logical volume %s.Couldn't read 'max_recovery_rate' for segment %s of logical volume %s.Couldn't find RAID array for segment %s of logical volume %s.Missing data device in areas array for segment %s.raid module string list allocation failedInternal error: _raid_add_target_line called with no areas for %s.Unable to handle more than 64 devices in a single RAID arrayCouldn't read 'device_count' for segment '%s'.Failed to allocate memory for %s segtyperaid1raid10raid4raid5raid5_laraid5_lsraid5_raraid5_rsraid6raid6_ncraid6_nrraid6_zr Device ID %uthin/thin.cthin_pooltransaction_iddevice_idexternal_originThin pool delete %u.Thin pool create_%s %s.snap Chunk size %s Discards %s Thin count %u Transaction ID %llu Zero new blocks %sthin_pool = "%s"transaction_id = %lludevice_id = %dexternal_origin = "%s"merge = "%s"low_water_markzero_new_blocksmetadata = "%s"discards = "%s"low_water_mark = %lluzero_new_blocks = 1message%d {create = "%s"delete = %dblock_sizediscards_non_power_2metadata_resizeexternal_origin_extendCannot read %s target version.Target %s does not support %s.Ignoring invalid string in config file %s.Target %s %s support disabled by %sInternal error: Segment %s has no pool.Failed to build uuid for pool LV %s.Internal error: Failed to add merged segment of %s.Thin target does not support smaller size of external origin LV %s.Failed to build uuid for external origin LV %s.Thin pool must be a string in segment %s of logical volume %s.Unknown thin pool %s in segment %s of logical volume %s.Could not read transaction_id for segment %s of logical volume %s.Origin must be a string in segment %s of logical volume %s.Unknown origin %s in segment %s of logical volume %s.Merge lv must be a string in segment %s of logical volume %s.Unknown merge lv %s in segment %s of logical volume %s.Could not read device_id for segment %s of logical volume %s.Unsupported value %u for device_id segment %s of logical volume %s.External origin must be a string in segment %s of logical volume %s.Unknown external origin %s in segment %s of logical volume %s.Internal error: Thin pool is missing metadata device.Thin pool target does not support %uKiB chunk size (needs kernel >= 3.6).Failed to build uuid for metadata LV %s.WARNING: Thin pool target does not support discards (needs kernel >= 3.4).Can't create snapshot %s as origin %s is not suspended.Internal error: Unsupported message.Thin pool set transaction id %llu.String list allocation failed for thin_pool.String list allocation failed for thin.Metadata must be a string in segment %s of logical volume %s.Unknown metadata %s in segment %s of logical volume %s.Pool must be a string in segment %s of logical volume %s.Unknown pool %s in segment %s of logical volume %s.Could not read chunk_size segment %s of logical volume %s.Could not read discards for segment %s of logical volume %s.Discards option unsupported for segment %s of logical volume %s.Could not read low_water_mark segment %s of logical volume %s.Unsupported value %u for chunk_size segment %s of logical volume %s.Could not read zero_new_blocks for segment %s of logical volume %s.Unknown LV %s for create message in segment %s of logical volume %s.Unknown message in segment %s of logical volume %s.Internal error: Invalid discards value %d.Internal error: LV %s is not a thin volume.Internal error: Passed unsupported message.global/thin_disabled_featuresthinthin-poolcache_segtype/cache.ccache_modecore_argccore_argvpolicy_namepolicy_argcpolicy_argvcache_mode = "writethrough"cache_mode = "writeback"core_argc = %ucore_argv = "policy_name = "%s"policy_argc = %upolicy_argv = "%s"cache_poolcache_pool = "%s"Failed to determine version of cache kernel moduleThe cache kernel module is version %u.%u.%u. Version 1.3.0+ is required.Cache data not specified in segment %s of logical volume %s.Cache data must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache data in segment %s of logical volume %s.Cache metadata not specified in segment %s of logical volume %s.Cache metadata must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache metadata in segment %s of logical volume %s.Couldn't read cache chunk_size in segment %s of logical volume %s.cache_mode must be a string in segment %s of logical volume %s.Unknown cache_mode in segment %s of logical volume %s.not all core arguments defined in segment %s of logical volume %s.Unable to read core_argc in segment %s of logical volume %s.core_argc and core_argv do not match in segment %s of logical volume %s.not all policy arguments defined in segment %s of logical volume %s.policy_name must be a string in segment %s of logical volume %s.Unable to read policy_argc in segment %s of logical volume %s.policy_argc and policy_argv do not match in segment %s of logical volume %s.Internal error: Unknown feature flags in cache_pool segment for %sString list allocation failed for cache module.cache_pool not specified in segment %s of logical volume %s.cache_pool must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache_pool in segment %s of logical volume %s.Cache origin not specified in segment %s of logical volume %s.Cache origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache origin in segment %s of logical volume %s.Failed to allocate memory for cache_pool segtypeFailed to allocate memory for cache segtypeactivate/dev_manager.cFailed to disable open_countLV percent: %fFailed to duplicate defaults.cowFailed to build dlid for %s. block_on_error handle_errorsname build failed for %sdlid build failed for %sdev_managerFailed to disable open_count.frozenrecoverreshapeUnknown RAID message: %sCan't set no_flush.Getting device id for %s.%*u:%*u %umissing_%d_%dpartial dtree creation failedAllocation of log string failed.Failed to parse log's device number from %s.Allocation of images string failed.WARNING: Failed to disable open_count.Number of segments in active LV %s does not match metadataKernel driver has incomplete udev support so LVM will check and perform some operations itself.Invalid string in config file: global/%s_check_optionsToo many options for %s command.Failed to build pool metadata path.%s skipped, detect empty disk header on %s.Check of pool %s failed (status:%d). Manual repair required!WARNING: Integrity check of metadata for pool %s failed.Getting device info for %s [%s]Failed to get info for %s [%s].Volume %s (%u:%u) differs from already active device (%u:%u)The requested major:minor pair (%u:%u) is already usedFailed to add device (%u:%u) to dtreeFailed to allocated path for callback.Internal error: Registering unsupported pool callback.Failed to get info from tree node for %s.Failed to get state of mapped device%s: Empty device %s not usable.%s: Suspended device %s not usable.%s: Reserved uuid %s on internal LV device %s not usable.%s: Reserved internal LV device %s/%s%s%s not usable.%s: Scanning mirror devices is disabled.%s: Mirror image %d marked as failed%s: Mirror log device marked as failed%s: I/O blocked to mirror device%s: Mirror device %s not usable.%s: Snapshot-origin device %s not usable.%s: Error device %s not usable.WARNING: Using linear target for %s/%s: Striped requires extent size (%u sectors) >= page size (%u)._add_new_lv_to_dtree: pool alloc failed for %s %s.Internal error: LV %s is not merging snapshot.Couldn't find snapshot for '%s'.Checking kernel supports %s segment type for %s%s%sCan't process LV %s: %s target support missing from kernel?Adding external origin lv %s and all active users.Finished adding external origin lv %s and all active users.Internal error: _emit_target cannot handle segment type %sInternal error: Cannot create tree for %s.Partial dtree creation failed for %s.Lost dependency tree root node_clean_tree: Couldn't split up device name %s.Failed to remove all device symlinks associated with %s._create_lv_symlinks: Couldn't split up old device name %s_create_lv_symlinks: Couldn't split up new device name %sFailed to create symlinks for %s._tree_action: Action %u not supported.Getting device status percentage for %sGetting device %s status percentage for %sGetting raid device status for %s.Expected raid segment type but got %s insteadInternal error: %s/%s is not a RAID logical volumeGetting cache device status for %s.Expected cache segment type but got %s insteadGetting thin pool device status for %s.More then one table line found for %s.Unexpected target type %s found for thin %s.Cannot parse table like parameters %s for %s.Aborting. LV %s is now incomplete and '--activationmode partial' was not specified._add_error_device called with bad segmentInternal error: Unassigned area found in LV %s.Cannot activate %s%s: pool incomplete.Failed to add device %s (%u:%u) to dtreed$activate/fs.cRemoving link %s%s/groupCouldn't create path for %sRemoving %sLinking %s -> %ssymlinkCreating directory %smkdirRemoving directory %sSyncing device namesCouldn't determine link pathname.The link %s should have been removed by udev but it is still present. Falling back to direct link removal.%s not symbolic link - not removingCouldn't create path for volume group dir %sCouldn't create source pathname for logical volume link %sCouldn't create destination pathname for logical volume link for %sCouldn't create pathname for LVM1 group file for %sNon-LVM1 character device found at %sSymbolic link %s not created: file existsSymlink %s that should have been created by udev does not have correct target. Falling back to direct link creationSymlink %s that should have been created by udev could not be checked for its correctness. Falling back to direct link creation.The link %s should have been created by udev but it was not found. Falling back to direct link creation.Couldn't construct name of volume group directory.No space to stack fs operationlocking/external_locking.clocking_initlock_resourcereset_lockinglocking_endquery_resourceExternal locking already initialisedShared library %s does not contain locking functionsWARNING: %s: _query_resource() missing: Using inferior activation method.Loaded external locking library %smisc/sharedlib.cOpening shared %s library %sNot loading shared %s library %s in static mode.Unable to open external %s library %s: %s%s%doffset = %lldbadamda%dcache/lvmetad.cresponsereasonvgidvgnamelabel_sectorNo device found for PV %s.ba%d/var/run/lvmetad.pidLVM_LVMETAD_PIDFILElvmetad_socket_presentfilter:%uupdate in progresspv_clear_allclear info about all PVstoken = %stoken_mismatchexpectedname unknownAsking lvmetad for VG %s (%s)uuid = %svg_lookupAsking lvmetad for VG %slookup VGmetadata/formatmetadata/physical_volumesvg_removeremove VGAsking lvmetad for PV %spv_lookuplookup PVphysical_volumeAsking lvmetad for PV on %sdevice = %lldpv_listlist PVsvg_listlist VGsvolume_groupslabel_sector = %lldformat = %sdev_size = %lldmetadata = %tvgname = %spvmeta = %tpv_foundupdate PVseqno_afterseqno_beforevg_updateupdate VGpv_gonedrop PVtoken_updateRequest to %s %s%sin lvmetad gave response %s.Request to %s %s%sin lvmetad did not find any matching object.Request to %s %s%sin lvmetad gave response %s. Reason: %sPV %s not recognised. Is the device missing?Missing or ill-formatted PVID for PV: %s.WARNING: lvmetad is running but disabled. Restart lvmetad before enabling it!WARNING: Failed to connect to lvmetad. Falling back to internal scanning.Successfully connected to lvmetad on fd %d.WARNING: Failed to set lvmetad token. Out of memory?Telling lvmetad to clear its cacheInternal error: VG name required (VGID not available)Internal error: metadata config node not found.Internal error: We do not know the format (%s) reported by lvmetad.Telling lvmetad to remove VGID %s (%s)Asking lvmetad for complete list of known PVsAsking lvmetad for complete list of known VGsTelling lvmetad to store PV %s (%s) in VG %sTelling lvmetad to store PV %s (%s)WARNING: Inconsistent metadata found for VG %sRequest to %s %s in lvmetad gave status %s.Internal error: VG update without precommitedSending lvmetad updated metadata for VG %s (seqno %u)Telling lvmetad to forget any PV on %sWARNING: Ignoring obsolete format of metadata (%s) on device %s when using lvmetadUpdate of lvmetad failed. This is a serious problem. It is strongly recommended that you restart lvmetad immediately.Sending updated token to lvmetad: %sdatastruct/btree.c%s/dev/block/%d:%d/md/%sdm_snprintf md %s faileddevice/dev-md.c%s/block/md%d/md/%sdm_snprintf old md %s failedDevice %s %s is %s.raid%draid_disksDevice %s %s is %d.%s sysfs attr %s not in expected format: %sDevice %s has an unknown md raid level: %dDevice %s stripe-width is %lu bytes.W////T/T//////device/dev-swap.cSWAP-SPACESWAPSPACE2S1SUSPENDS2SUSPENDULSUSPENDV importing unknown segmentunknown/unknown.cFailed to allocate memory for unknown segtypeformat_text/archive.cFile: %sUnable to read archive file.VG name: %sDescription: %sBackup Time: %s%s/%s_%05u-%d.vgArchive file name too long.Expiring archive %sArchive rename failed for %sNo archives found in %s.Archive file %s not found.Couldn't create text instance object.Couldn't scan the archive directory (%s).Couldn't create new archive file.Couldn't create temporary archive name.Couldn't create FILE object for archive.%s/A_%slocking/file_locking.c%s/P_%s%s/V_%sUnlocking LV %s%s%sLocking LV %s (NL)Locking LV %s (R)Locking LV %s (PR) - ignoredLocking LV %s (W)%sLocking LV %s (EX)Too long locking filename %s/A_%s.Too long locking filename %s/P_%s.Too long locking filename %s/V_%s.Path for locking_dir %s is invalid.tFFGCE4EEE_undo_flock %smisc/lvm-flock.cUnlocking %sflock_drop_shared_flock %s._do_flock %s %c%cGiving up waiting for lock.Unrecognised lock type: %dLocking %s %c%cformat1/disk-rep.cDuplicate PV %s - using %s %sFound %s in %sVG %sFailed to read LV's from %sInvalid PV structure size.Failed to write VG data to %sToo many uuids to fit on %slv_number %d too largeFailed to write extents to %sSuccessfully wrote data to %sFailed to write LV's to %sIgnoring duplicate PV %s on %s%s does not have a valid LVM1 PV identifierformat1: Unknown metadata version %d found on %sFailed to read PV data from %s%s is not a member of any format1 VGFailed to read VG data from PV (%s)%s is not a member of the VG %sFailed to read PV uuid list from %sFailed to read extents from %sread_pvs_in_vg: dev_iter_create failedCouldn't allocate temporary PV buffer.Writing %s PV metadata to %s at %llu len %zuWriting %s VG metadata to %s at %llu len %zuWriting %s uuidlist to %s at %llu len %dCouldn't zero lv area on device '%s'Writing %s LV %s metadata to %s at %llu len %zuFailed to write PV structure onto %sFailed to write PV uuid list to %sWriting %s extents metadata to %s at %llu len %zuCalculated uuid %s for %sformat_pool/disk_rep.cpool read_vgNo devices for vg %s found in cacheUnable to allocate pool list structureInternal error: device is missingUnable to allocate %d 32-bit uintsInternal error: Bad format string '%s'Internal error: Bad format string at '%s'config-util.cFailed to duplicate node key.%.*s= %lld %.*s= "%s" %b%.*s%sdaemon-client.ch.socket_fd >= 0buffer.memrequest = %sconnectSending daemon %s: helloDaemon %s returned error %dprotocoldaemon_openrequest%s: Opening daemon socket to %s for protocol %s version %d.%s: Daemon socket path too long.Daemon %s: requested protocol %s != %sDaemon %s: requested protocol version %d != %ddaemon_send ## ;;oX=;HUP@VAI]C^lD^D)kklkms܎|X~;8x<<Ȇ,@Kehhxhسhxiصjljj`lPnto84ppXqxqr$sstzD{XX̒xt7h8d?jk8m@hmlmnp p HqdqqrxrDHsxsHt\ttwtXwwwxXy0y{|X}(~<X\pȆH8xdx(x0X؋(H8x8l8@ȑ(Hx(h    X  x 0H,(Th,l (#@$&()Ht*D+ , 0/ //d282 38'<=(>)x>8*,?h,@@X-@<@<$A=TAX=A?B@B8@B@$C@CCxEDEHEhFEF(FGFXG8GGG@HXHHQMRDM(RXMxRMRMRMRM(S(NXTNTLOhYPxYP8\Rx^S8_SaUfVXiXiXmZn0[Xx_x`zahfhxhhxxjxkȎlȐm,nxpqs|tuv$xxz {{تP|ث}4~ȭd~~(̀$|Hh$(hH(ܒܓܔ(8pp@xT|xH HP(<T( x8رXX@HL(LX h#$h'<'(4x)x**+,,dx.x./</P/|8012`34h66<(9948;8(<(=>>@hAdB(xEHxLdhM hNOtP48QXR(xR<HSSS8T(THThhUVWh_b@fn@o(phtxHuvPvXww@xx8xxx$8yTyzT{8|}Dh~((XHTx (8$|8P8|ȉh$pH$(8Ȗ hHL(ȝ8H(hإLHȨ<  X  ج0 | س  X 4\DHhظhPxdxȹx,Pغ|H(@xh(x ( X"8d#`$xX%(%4&&((,,H,h-x-8\..h8/P182hl6x6607h7 888(9t9:xX; |<X P=,>>D?8?XpAHABBCD84ExEE@F FX$H&I'J'K'(Kx+K.L.$MH1U?VBW(CWC@X(DXD(Y(ExYEYFDZFZ(G([G[HH\H\LL^O_HTaVPcXdh]lf]f]f(^fh_g`h8ai8bihbib jb jc4jcjcjd0kxhlhkDnXmpomonpXqqq rqHru@thututhv8u8{Dwh{pw{wx}x}xyx{x{|؅H|(||h}H}80~~x؍ԀxXhؗ48(܊أl8hȤЋxH،ثl(ԍXخȎ88hxTh8t8ȢpHXx(0X\hXHX `(Hĩx$XЮt8`x TXx8x|Ľ8D8 HhXx, @   x0lh8(p8LPH xH8 T#)0x184h99@=x>p?@HAA(XCDDEhEE E E4EXFHI|HKLMlXNxNRRR]h_LxbXghk$klloxpqv`vxw w w4xHy@}(8XL`|H<X(H؛ x ؤHxLh(8ȳxx4h "H#|$$%L&p&&X&x&'('(H)hH+t+x,H,|,(,(--,.@.d..008181(2x34(\6h47d778899:<<=L>`>>x?Ht@AX HCx \C8 Cx C $D 8D LD D hEEEEXFxFdFxF(FHFFXHGhGGGGXGxGH@H(lHJ(K L M!,NX*Q*pRh+R/0Th/pT/T/T/T0T80 U1U2V82VX2(V2`V3V4@W4W(5Xh58X6Xx6X64YH7tY7Y8Yx8,Z8dZX9Z:[:[;[<|\(=H]X=p]=]=]>8^@_B`8IHaK bKhbKbXSeSeTfUfV g(V gHV4gVdg8WghXDhZh\jH\(j\hj]j]k_k`lalbmbhmd,nhenHhoHi(p}x~Dy~ydzzhH{{(}}~؇~8 ȫxxس|x؏hț(|,h@(H(H(HhXx88hH(T l ضhh '(/?@hAAL`@Xbc\uyyz({~$Ȁ(h88ȇ`h DXDh$H@ؐhH(x0șTh8|(DXXțH$8h(xxl(l8h4(4H(`xpD8<  D h  h,8T(t(HhxlH(x8(hPH %%(&8((xl)H ) *X/H0h0HX11$48P4H 5 06"7#P8$8$8%9&|9'9):+L<h7A8A:A<B=HB=dBX>BX? C?hC@CxBEXC|ECEHSKXU@LV,MY(NxY\NYNZN[8O[O\LP]P^Ph`R`HRd0THgTjVw4Vx WxyWzW{X|Y(8[[\^hbhcHeegg(h8hxhii@iHhiX|iiiؙiiHjxjؚ\jpjjj8jXjhjxjk(XkH|kkkkH0ldllHlhlmHmȠTnhn oo`ppTrs@sةtsuyL| }hP}}h8(X4PhHȅD`|D ((#Ԛ#8x$H%D&М'PH''(0800`0(1(2X22X3\h5`6ؤ6@78H9:h;x;;\<=p=>>̩X>x>$x?@@LAAثBԬJKL,LpMPXQXR@HSдhTx8UUVZ[x8bbh8cd\dн8fԾf,f@gpHgxgggg$g8hLh`(ht8hHhXhhhxhh8i`xiiijjdj(kqrhssXuHvHz<ztX{8~X`h(T؋؍ȑ,Ȓ@8Xxؓ  84XHx\pؔ8X4ؕH\pHxȖ(,H@hTh|ȗ(HhȘ0DX8lXxؙ8 X x4Țlx@8x`ءx8HX4Ȥ@Tإt8P(8(H0Xx0ط H\ظ(8,H@xlعx$H`xHdhhhh<h,h|hdH(D(4(8,hX(lDX  4HX\h@xXLX PHX88 ((Lh@HX,X,((0X, p   ( ,  H d  <  (\x dX`@xT8D(p<t8X(Xp(HP|X4|X(X HlXx( l8x X  l! h"(&h&'''T()*X+8 ,(%-&.((.)X/H+/h,0-122H43X5L45`454x6496@9A :(D;8D;XD8;xDL;D;(FT<hFh<F<xH=H=H=H=J>hN@N@OHAQHBRBRBTCxVpDhW EX[ Gh[ G[DG[XG\GX\G\G\ HX]\H]H8^Hh`,J(bDKftKiK(nHMnMXpMp NHqDNXqXNqlNqNhs OtOtO(xQXxQxRyTR8zSzXSzS{T{(T{LT|(U8~UȄU(DWX؉YPYHYYZT\\H]h],]8]H]x]4^ؒX^^Xt__Hb$ccHcHdeeXeffff gHLghpg(Ph(hx$jlHlh4AhBCع8F8G$O8P,PHQQST$HTPTVW^HbfhfffLghhi(ihiii0Xjlxm@n,(opohpLp`ptqxsyhyLz({H{,{{8||d}8}h(hlhXX\h XȜPȝH8(Xȣ8DX|8h`hh ȸXH(lH(,,h 4hX(l( T $ ,@hhT(PH8dh (XDX(h\!!"88"xl""(#h# # 4$8 $ $ $zR|  F J tx?;*2$"@BAA AAN0YAA AAN0\ANH D$D(D,D0G4A8B[AA AAP`dBhElApJ`UdKhElIpH`glDpJ`_dDhBlApH`NdIhDlApX`QlApH`V AA AAD ~dGhFlDpH`TdEhElApH`elFpL`TlCpBtExD|BH`XlApBtExD|BH`VlApHtExA|BH`SlApBtExD|BH`?hAA AAN@z AA AAH cLAPH@KDEHELCPH@OLHPHDAHGLGPBTEXA\B`HLAPJ@ZLAPBTEXA\B`H@YLAPHTEXA\B`H@ZLBPX@N LAPOTAXG\G`BdEhAlBpHLAPH@ULAPBTEXE (p@ #ANBBBD HA(@ #ANBBBD HA@@ JAA AYBKA HIA HC AA, A TAA AN AA\AA AAN Y$B(A,H0H P$A(D,A0H$J(A,B0H S,n0B4B8AJAA NNAG H$B(A,B0HCA H AAp{>ANL FG CBD HLD FAAG B$B(G,B0HE AE CD FAAG B$B(d{>AA ANHAB HO` B$B(A,B0HC  AAI IA B$B(A,B0HD{?MAA NNAG H$E(A,B0HCA H AA@|?ZAA CASbdbybAbHbb AA AAK CbEbAbDbHbUbAbFbAb`bQbJbAbEbHbHbKbEbHbAbHbSbBbAbHbVbAbGbAbHbEbAbBbHbIbAbDbAbEbHbHbKbEbAbBbHbgbAbAbHbEbAbBbHbPbDbDbAbBbEbIbBbHbObAbFbAbBbAbHb{ bAbBbEbG CbAbHbobAbHb_bHbAbDbHbKbAbHbGbAbHbWbHbJbAbEbHbHbQbAbAbHbKbAbFbHbHbObAbHbMbEbGbAbHbRbAbAbBbBbMbBbHbCbAbBbEbAbBbHbtbAbHb\bBbHbYbAbGbGbAbAbHbEbAbBbHbTbAbBbEbAbBbHbNbAbBbBbGbBbHbI bAbBbEbB HbBbHbQbAbGbGbGbAbHbBbAbBbHbN bAbBbBbE ZbAbDbAbHbObBbHbYbAbGbGbAbAbHbBbAbBbHbMbBbHbYbGbGbGbAbAbBbBbAbBbHbNbAbBbBbGbBbHbH bAbGbK I bAbBbBbB I bAbBbBbE HbBbHbYbGbGbGbAbAbBbBbAbBbHbIbAbBbBbAbBbHbQbFbHb_bGbGbAbGbAbFbBbAbBbHbEbHbSbFbHbQbAbGbGbAbAbBbBbAbBbHbXbAbGbH$BgAN] CA CD FAAG H$E(A,B0HECpBAA A^EAB HO` B$E(A,B0HC  AAI IA H$E(A,B0HC  AAI IA B$E(A,B0HDBJAA NNAG H$B(A,B0HCA H AADBiAA AANLXPR@KHELAPH@MHALAPBTBXI\B`H@CLAPJ@^ AA AAE VHALAPM@MHDLAPHTBXA\B`H@YHALAPBTBXG\B`H@U HALAPBTBXI M LAPBTBXB dCAA ANHAB HO` B$B(A,B0HC  AAI IA B$B(A,B0HD|CJAA NNAG H$B(A,B0HCA H AApăCAA CAN,L0K ] FC AAE A$A(A,G0H4B8AAA NA  AAE CCFG H$E(A,B0HE  AAF CCFG H$E(A,B0HA HH AA>\AA A`A HW  AAK CA HAIA B$E(G,B0HC  AAD CA C$F(I,A0H4E8A GBEE i GBEE CGOoHABEAAKwDIDFAAAMINABOSEGBEAALA ACABEABNAFEE YAHGBEAAWg CADFAAGBEE wAADVCAJBEAAKF JAABEE dDKMDIDWOFGVW DAABEE A EAGBEE ABEEHHAAVCAJBEAAHH DKVE[AAMBEE A EAGBEE \_h9AA AAN@QDAHALFPH@eDAHDLEPK@T AA AAA \H`9aAA AW  CAB CA HMCCA H$E(A,B0HF AAP`9AA NED HYA @E  AAF IA H$E(A,B0H$`D:4AA AANLNPLLAHBLCPL@KLDPH@iLAPDTBXB\B`DdAhAlApL@aHALAPL@NLWPH@[HBLGPH@LLAPFLAHALDPH@TLAPHTEXA\B`H@E AA AAE Y AA AAA ILAPBTEXG\B`H@E AA AAA I DAHCLAPBTEXB ILAPBTEX$b\;AA AKL HGBC HJJA HF  AAE IA H$E(A,B0HOA H$E(A,B0HC AAb;3AA AAQLHUAAHIEAAHMAAHQAABEDBHCHOACLfAEHNBBAL`AEEC AA AAB ICAABEDBHVABEDBHRABEDBHGACHW ABEG I ABEG IABEDBHP ABEE M ABEE Pld=iANGC HGA HH AF IA H$E(A,B0HEAd =AA AANLIPH@XDCHFLJPBTEXA\B`HLCPH@JLAPH@RLAPH@jLAPH@KLAPO@lDAHALAPH@SLAPBTEXA\B`H@CLAPBTEXA\B`H@E AA AAE zHDLAPE@K FA AAH _DAHDLGPBTEXA\B`H@Q LCPH@ULAPBTEXB GLDPHDAHFLGPHTEXA\B`HLAPH@RLAPBTEXG\B`H@G AA AAA M LAPBTEXB M LAPBTEXB M LAPBTEXB CLEPH@YLAPBTEXpf0?fAA CN m,C0H P C AAH G,A0H G$B(A,G0H O,C0H4E8A=VAA AAN@_DBHALAPH@KHCLDPH@LDBHELAPH@WHCLDPH@PHBLAPT@KLAPFLAHALGPBTEXI\B`H@CLAPH@JDBHALAPH@ULAPHTEXA\B`H@W AA AAH CLAPHDBHBLAPL@JLAPL@fLGPL@QLAP\@YLAPDTAXD\A`HdEhAlEpH@qLCPJ@YLAPH@KLAPH@SHDLAPBTEXI\B`H@KLAPH@SLAPH@CHBLAPH@MLCPHTEXA\B`H@S HDLAPBTEXK XHDLAPKTEXA\A`H@RHDLAPHTEXA\B`H@MLAPLDAHJLAPH@UHDLAPBTEXJ\B`H@h HDLAPBTEXK I HDLAPBTEXE CLGPHDAHJLAPBTEXA\B`NLAPBTEXA\B`H@NLCPHTEXA\B`H@@@AA AAN0L4B8AAB C  AAA F p]0AA AANAA AANLNPH@PLGPH@HALAPH@NDAHGLAPHTEXA\B`H@@HCLAPH@KDGHGLDPBTEXA\B`K@pLAPHDAHGLGPBTEXG\B`H@E AA AAK CLCPGTAXA\G`HdEhAlBpJ@DGHGLAPATAXA\G`HdEhAlBpH@yHCLAPH@NDGHGLAPHTEXA\B`H@XDGHALGPHTEXA\B`H@\LGPGTAXA\G`HdEhAlBpL@uDGHCLJPBTEXA\B`H@k AA AAA |DGHGLJPBTEXA\B`H@XDGHGLGPHTEXA\B`K@ZLGPGTAXA\G`HdEhAlBpH@TDGHALGPHTEXA\B`H@TDGHALGPHTEXA\B`H@P DGHFLGPBTEXE CDGHGLGPHTEXA\B`H@VDGHGLGPHTEXA\B`K@e(He\AA NM  CAG IA HGA KF AAHe0\AA NM  CAG IA HGA KF AA,fD#@f`AA AN S,A0H \(C,A0H4B8AAA AND HK  JAE A CAn@nLAA AANLEPH@G AA AAF FLLPcTAXK\A`OP^TDXA\A`OHALAPR@a AA AAC h,oĔAA NSA PGA HGA HKA HM  AAI C  CAI C FA0ofAN{ AE CF HCATo4AA AAN,Z0Z h(A,A0H C(G,A0HAA AA0$plbAA NTC Nj AAXpCAA AAN,I0H W(C,B0B4E8DAA AND HK  JAE A CAxu`AA Ac  FAC A  CAK FCG H$E(A,B0HC  AAC CG HF DA(lvfAA AAN0T4D8AAA AN@]LCPH@LLAPJ@pLCPH@JHFLGPHTEXA\B`H@V A AAE CHBLBPETBXA\E`H@eHCLAPHTEXA\B`H@0xAA AN M,A0N R A AAF I(C,A0H4E8AAA CgBCA HA AA,(AB C AAA H AA CAPlBHa AA AAG GAAHPBBFHuCIFH[JEALbBAHlEEEEEEEDAHpAAHwAAHUADABEDBH` BOGAGBEL HBHXAGGAGBEDBHRBHXAJAAGBEDBHHBHMBOGAGBEGBHPAABEDBH`CFFFDIDJJABEDBHODDHPBHTAGGAABEDBHNADABEDBHHDDHPBHTAGGAABEDBHbAAGBEDBHRABEDBHcAAHkADABEDBHVADABEDBH HXAA CN,Y0B4E8ADAA AANPS\A`HTAXF\A`HPfXC\G`HdEhAlBpHPX AA AAF G\C`HPK\C`KPM\C`RPN\D`AdDhDlDpHPY\F`F\AXA\A`HPeTEXB\D`HP\\A`HTAXF\A`HPKXA\D`HP]XC\G`BdEhGlBpHP]\A`BdEhGlBpHPW \A`BdEhK M \A`BdEhK Y XC\G`BdEhF I XC\G`BdEhF I XC\G`BdEhE \.L@AA AAND_HALAPH@KHDLFPL@NDAHGLAPH@QHALEPH@]HALEPH@ODAHALAPH@KHDLFPL@Q DAHGLAPH@aHALEPH@ODAHALAPH@KHDLFPH@PLDPFTAXJ\A`BdEhK ILDPHDAHALGPBTEXG\B`H@Y AA AAE I LDPHDAHALGPBTEXC C DAHALAPH@GHDLFPL@NLDPFTAXJ\A`BdEhJ Y LDPHDAHALGPBTEXK FLDPFTAXL\A`BdEhGlBpH@P LDPFTAXJ\A`BdEhE I LDPHDAHALGPBTEXK FDDHDLAPH@GHALAPH@dLAPBTEXG\B`H@T LDPHDAHALGPBTEXK I LDPHDAHALGPBTEXK L LAPBTEXE F LDPFTAXJ\A`BdEhE 41|B:AA NXAAE H AA|<1BAA AANDeHDLDPH@SDCHCLCPm@P AA AAD MLAPHTEXA\B`H@MDCHCLCPm@1$CoAA AANbBAHkBAAHOBFAHUHFFCAACCDDDHmBBDHcCABEDBHDBDACDHXDHWCCABEABNAAGABDHUABEABHZABEGBHZ AA AAD eSBEAAKWCKKBBEBADHcEGHgCFGBEDBHRABEDBHZCABEGBHX ABEK ^GJABEDBHCSCAAAAADHUABEDBHTEGGBEDBHALCPP CGBEI F FGBEF M ABEK C JBDHUABEH I ABEE M ABEE RABED5 FAA CRDGH FAAG B$B(A,B0HF FAAG B$B(A,B0KF FAAG B$B(A,B0NCCA B$B(A,B0NSAG B$B(A,B0NA B$B(A,B0HA AAH68FgAN$G(D,D0H G FE M,A0H4E8A$M 0> MD>M X>MAND HAx|>MAA AN w A AAE I$B(A,A0P4E8EMAA AAN>&>6>F>V>f>v>>>>>>>>>??&?6?F?V?f?v?????????@@&@6@F@V@f@v@@@@@@@@@AA&A6AFAVAfAvAAAAAAAAABB&B6BFBVBfBvBBBBBBBBBCC&C6CFCVCfCvCCCCCCCCCDD&D6DFDVDfDvDDDDDDDDDEE&E6EFEVEfEvEEEEEEEEEFF&F6FFFVFfFvFFFFFFFFFGG&G6GFGVGfGvGGGGGGGGGHH&H6HFHVHfHvHHHHHHHHHII&I6IFIVIfIvIIIIIIIIIJJ&J6JFJVJfJvJJJJJJJJJKK&K6KFKVKfKvKKKKKKKKKLL&L6LFLVLfLvLLLLLLLLLMM&M6MFMVMfMvMMMMMMMMMNN&N6NFNVNfNvNNNNNNNNNOO&O6OFOVOfOvOOOOOOOOOPP&P6PFPVPfPvPPPPPPPPPQQ&Q6QFQVQfQvQQQQQQQQQRR&R6RFRVRfRvRRRRRRRRRSS&S6SFSVSfSvSSSSSSSSSTT&T6TFTVTfTvTTTTTTTTTUU@pRPR0 QqПQp @m0-pkPRp`?R` ` pq@m`xPУ q`| z 'P`% 0ܟ(PPPPPg g 6g Mg Yg lg g g g g g g g g h h h h -h 8h @h Kh [h lh th }h h h h  h h h h h h h h h i K i fL #i -i 6i Ci Ki Wi ci vi i i i i i i i i i j j (j 3j ;j Ej Oj Zj ij xj j j j j j j j j k k $k :k Lk bk sk k k k k k k k k k l l al a*l A0l A=l bRl bRl b_l cml cyl cl Cl Cl dl el El fl f3j fl hl ?rIl i;j il il lm lm l'm l1m l@m LGm LNm M^m jkm ksm Km mm Mm mm nm nm nm nm om Om pm pn Pn P%n q6n r>n rJn RUn R]n sjn sn sn sn Sn Tn tn un un Un vn Vn Vn Wn xn xo yo Zo -r ԝԝ</i cD<h l MDwc *d  <    EJ  c  F$ Vp <cDV=cDW= cD@Wo= = ="= $="@$.=UDK="B$QD"@ [="@bDl" i= $s= m$= d *@ = =YD= =0D =KD!>3D"=-D#hW2D$>$%3>hD&F>KD'`>ID(~>UD)>UD*>"@MD+>UD,>iD-WiD.WUD/WjD0>jD1XYD2>0cD3> q0cD4? <0eD5?cD6n  71?bD88? 9 @ :?? ;I? <O? =V? >~= no ? @d? @ Ar?"(XcDB*d  C? D E? F? G? H?d I?? Jn  K:h =`  L?6DM NDh  O? P [! Q?"@ R?"@ S @ @ T@ U@2DV+@*DWI@*DXc@ o@ Y}@4DZ@ @ [@ @ \@9D]xX`D^@KD_@ Y WD` A ^ cDaXYDb A]Dc,A BA^DdWA"jA`DeoA"cDfA AdDgA AdDhA"AdDiA BlDj B"jAlDk4B JBlDl_B wBlDmB"AlDn<VDoB3DpB9DqBVDrBYDsB j} tBYDu C@ vC w)C xJC"B y:C"BaDzVC"BYD{lC |CcD}@n iu ~C CYDC  $C K $C 9DCdKDDKDXd0YD.D0YDKD"@>DXD>Dki ?DeD?DvDcDD Ae lD [g  ng ED D DED l @ D"D DL DM DL L , L h  h  $h  h oo D DlD |i $D i 'D D ElD $E 2EeD ?E XeD ME XeD cE lE |E Y E Y E E E XZ E Z E E E Z E ([ F E (F h[ 4F [ F F" &F [" 2F 4\" FF \$ UF \WD bF \$ sF ]YD A FID F _ A $- B ttgomoooqozow~oo]oo'eoozoo,oߟ3}oooooKpoo;ooop_ pp2p"poooqozow~oo]oo'eoozoo,o'p3}o+po/p9p=p?pIpA 0p0P0gPb@_pR`R]PNvplЎpvj p`0`p}kEEDDD y@EEoE0NqIpH0NMq KpHpP@ @P0 _tdata_cdata_corig mm<<LLTTium%mP/o 0:=o xo tDxDtxtH_nxH_ntwxwtxt^ x^ t x txtˊҊxˊҊtۊxۊtxtxt8 x8 tC xC txt)x)t` P/o 0:={l x{l tn xn t, x, t.x.tdh xdh t, x, tn xn t[oF9 0 0   0  p  P 0 ` p  P @     F PD D F 0D D D H PH `H N pH @N I \ [ [ \ `[ 0[ @[ q 0q x t t @s q px `q 0x z `z `{ ` p Ќ ~ | { p{ @  ` 0 Г P P @ ` 0 p 0 @ @  p gI H H H I   Ъ .shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.jcr.data.rel.ro.dynamic.got.data.bss TThh !$4o@&> ''@aF,,dNo( [oj  6s B11  |==#w0=0= U U   @;\;\;@5@%D5D%H5H%5%B@wg xhHD1@Dd@D