08P]+f'&<  ']+f.{P''`'G. G.]+f'&P@@<@T 08P]+f'&<  ']+f.{P''`'G. G.]+f'&P@@<@TU ]+f`'G.yA]+f]+f]+fQA]+f]+f]+fGA]+f]+f]+f\A]+f]+f]+fA]+f]+f]+fA]+f]+f]+fA]+f]+f]+fA]+f]+f]+fA]+f]+f]+fA]+f]+f]+fC]+f]+f]+fA]+f]+f]+fA]+f]+f]+f$f ]+f]+f]+fRmKC#]+f]+f]+fX`hpx$]+f]+f]+f (08@HPXQ$)]+f]+f]+f`hpxYR$]+f]+f]+f[I$x]+f]+f]+f (08@OmM]+f]+f]+fHPX`hpx][$]+f]+f]+f$>]+f]+f]+f$]+f]+f]+f$s]+f]+f]+f$]+f]+f]+f$]+f]+f]+fA]+f]+f]+fm]+f]+f]+f$]+f]+f]+f $]+f]+f]+fA]+f]+f]+fA]+f]+f]+fA]+f]+f]+fA]+f]+f]+f$Q]+f]+f]+f (08@H$]+f]+f]+f $]+f]+f]+f$]+f]+f]+f$]+f]+f]+f$]+f]+f]+f$]+f]+f]+f$]+f]+f]+fA]+f]+f]+fA]+f]+f]+fA]+f]+f]+fA]+f]+f]+fA]+f]+f]+fA]+f]+f]+f!p(6g y{/dCL+6WC@>3A[~r{ug(3Hy{i=v,O_HrONY0N=͖,u٧/%^y¹\!L2qhXC%UG. . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4@#4 ((I"(I"W"'+'+ԣ ԀԀ,,W"'+'+NetBSDʚ;PaXUXSRffffUVSS&'+9s 9r[^]UWVSSǦ&}P PLt,1t&tuAt[^_]Yuڅtft 9s1u+r 9vu׃ 9wtt_ t1uC tuS u9rh39[Jt*tQ"UWVSR&E9s{*;9r[^_]UWVSARH&}u  ,05EF P+t/uut<$O'+E9s ;}r 1$'+E9s ;}r $kmED$D$F$$ P+QD$ D$ D$$D$ $^,$SW&Iu1ƃItЃtlz${_[SWÖ&HuYƃHt(|$lz<$_{t?t<$B{tЃ_[UWVSh4 h? h0, 1t:PhYxOvh0,j LXZ3hx$h0, h0,j Lj2UEU MsMU HE]<UVS1ۋ` tVP-ZYu d C܍e[^]USնPhH h0,h0,h μ  CtsPh h0,j|UWVSE tuh ;HURhc@5@, t5D,h ju8"-"M8"-"E8"-"WVSQRP5D,h ZE t8"-"RPh 5 u5D,h 1e[^_]U5@,TXUjhc 5@, t5D,h j1USRj EPSc xU:t Sh+ j]UPEU PhD  JtPhZ FEEEPhc5@,a t5D,hq jw1UWVSSuE H1ۃv>PWZYtC@ uދD Eh WZYuE FEEPhc5@, t5D,h j1e[^_]USu Sh j]UVS1 tSPZYtFSh j\$ e[^]UWVS ]u} ShD  } ~ShZ iE1}{EFE} t!vtt>uhM AEEEEEE먉t9Wuhh j4M9MuB}t }uEEE_ESEEDEEċ]9]}t#}tEЃ}t}uEEEԅu.u9uCE4 5D,h w )}t}uuu EEUU9~uuuh jCk]lS~E^u h j%1}EEuĉu܋uuUUuuMMPh c5@, uEX@EUu15D,h jEEPE4 h CE rh mYElU9U| ,h ,h#XZCtCPhı#_Xj ^CtCPCPh  CtC"PSh(  Cts؋C4 hK w C$PhY ^ZYuXEm1e[^_]UEd,]UE$,]UhL j$Uhb jUhy jUh jUE E EE]Uhjjjuh sx,|,Uhjjjuh H,,0,Uhjjjuh l,p,Ujjjjuh ,,Ujjjjuh#,,X,\,Ujjjjuh PP+uj UShjjjuh iӉ‰؉,, uj ],u(Ujjjjuh #,,,u(Ujjjjuh X,\,UWVSu,,X,\,>WXuWh j=SY_u ShJ jxxuSh] ]hjjh EP uu뺋,#H t uhw  P,WPZ_,t/#=t ,,tt h m;X,ƒt!uh QBu^,Lt>!t.t ,,^*,,Bh j,we[^_]UVSp,uXD,,H,L,, ,;,,rgj,D,, ,H,L,X=5P,uT,E D,)EU}t 13A}uke[^]ËH,L, t , ,Uh h#jUUh h#jUUSË@4URs(PZYts$h#jS4K(E%= u!HPhm8@QR @ C !jjjQR Bu@u8uK ]USQp9v S? ZSPEP ƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h; jC4WPs(Xe[^_]UWVS]uVh`,jC4uu s(P( 8jVj$8؍e[^_]UWVS,}t , , ,,EUEUEU}u*, t!11;E} yt㡀,, t(jRP5(,4,P Bu@u 5$,hD IuSh,Ɖ 19|4 u5$,hh 1 8t5$,h#jw11,E , tQE, ,5,5,QPq,,,,,,5,=,9}uA9uu& y# 0Ph"h0,%h* s5,I,,,Z5,VjuO9uyG,,0Ph"h0,hd @SI1-s,,CS S~5,,_X؍e[^_]UVS\,d,j?h!OY[{ tSZt|/uSh Sh h,VN ,ujxh 2@V YP+Yt(h Ps,YZt VfZ1/SX5,h#h ?V:e[^]U,tqPYy6:0P5,h&h0,9h ?P,,tP+5,,XZ,,,1U,t-Pz,YtP*5,O,XZu<Ujh,h, yj,,,,1,@=uUSUE ,, ,M,Ћ] Ӊ)~,@[]Ã06$ 1D@11D1H1H11 D1 H 1 H 1 H 1 H 1H 1H1HÃ1UWVSӃu]1$,28,$,@ujjh$,h$,蟒th h##=Y^$,(,8,<,`$,)0,+,1$,28,$,@ujjh$,h$,'th h#<XZSjjh$,讱e[^_]UWVSƉӀ:0B NyV_ H =`,9d d,X,؁}U|WQZYU=`,d, X,uD,tjbtj=d,u d,C9F `l{ `,9X,؁}ULQM5d,TZYMUuN0"Ph"h0,he& 2X,HX,u}D,;tl= `,d, X,uD, u d, QF @t030Ph"h0,8h ~1!uh=!FPWfY_Vu P]ƒ u$0-PVh&h0,hQ KuSRUǃ xq>!Uu7RhZy4}0PVh&h0,hi ,2R%ǃ=L,uWhu h0,Q tE)؍X؍e[^_]UWVSW11 ,yh,^(,P,s=t,9 x,X,؁}U|WQ#ZYUu`0Ph"h0,he&+X,HX,D,tjo jA =t,x, X,u D,uɨu١x,u d, t1f,9tlމ߉,x,0x,p,f,@t0Ph h0,h +f%,p,t x,x,p,e[^_]UWVSWp,C{ u)ÃEp,FTRP Y^tEl,9}\h,X,ށ}VRf_Zi5l,h, X,uD,tjtj h,5p,ljD s} usnExtx,M| th )Y1vEl,9~Vh,X,߁}WRYZ=l,h, X,uD,@Ch,25x,NjM}t/s2PR_Zth,D } )s!l,9 h,X,؁}tVQZYuVj0Ph"h0,ohe&(X,HX,D,jh5l,h, X,uD,=@h,Me[^_]UWVSQ]utuh XZ} 9EF95\P+}h,h$m|^XP^vs\;t.ˆUPh ZYUtF-   /B000CQ<\t빸 1e[^_]UEH!D,EPhht@j x$Efv`P+Efv\P+U= ,uE,E ,,,9~ 1; ,~h#%&XUWVS$,}t~} t 9 ,~[C ~K ,tISPZYtF=d,tj jvPjjjWu7u19$,uh &X؍e[^_]UWVSP]U u h#%%XS19 ,~BPJESAY_!{$,uSvPqx6;utV6Zuϸ1e[^_]UE  ,DBuh o%XP<,u,E,1UE ,DBt,EPh %XUWVS$, ,p,EDJ@t t E@p,޹p,0U?& } $ }^@p, ,p,8f|y@t t@p,܃tSj hp,5p,qǍ v8"uh A^t-u16UBQ@u^t -uօuh#%#[^j hp,5p,2qÍ v18"ult@p, ,.h$,]tP%1Ƀ/QPZYrp,M:)@p,DPp,@PX,t(@p, ,;u $, , ,9Et9 ,}؍e[^_]U ,$,,,x) ,,,,p, ;t(,t# ,у~ , ,JuJ p,:;u$,9t ,t1]UVS,11Å t]9,u,J@ԉt,[^]UVSujZu+G0Ph"h0,Lhe&!FV CS FC؍e[^]UMU 19tz\uBPQZYUWVS=@,ujEH!D, ,Pjh=!h ykh 跪^tZP*[=wJ@ PYt:WPYXZ|3/t 3/D3h Sl5 ,jh=!SjcUM=X,tI D,QU=@,uj+EH!D,jh,8CUWVSE$,1=`,u3t x,| t>f%,p,;u1p,Bp,: u)؃u ;.u{ tԍ<X,S|Zu# X,uoD,tj7t[j$,t PFXPPj0ƃ t9u\, X,D,u른e[^_]UWVSQu,X; ,|1ۋ,zX,9t9u%SFEW=á,$,XZUSWjc/ u X,t$195 ,~FPVj4/ u)ϋD,tj jSX95,M~WVVWYXMXABy ,19~,)@$,=`,t R3XZ\, X,uD,FM1e[^_]UWVS}5,ơ,,)C=$,Y9~9 )C)EE1X,VjYu' X,D,tjt|jPEZtEG$,PPj-ǃ t\, X,u D,uu6l$,@PX]EF1e[^_]UWVSQ] X,Suj!- u3 X,D,tjj19 ,~CPNjEpVYZ=`,tW0EDXZE8G+]C) ,5$,\, X,uD,t{1e[^_]UWVSu 195 ,~@PEuXZ1;]US_UCЋ=,9 ,X,=}UWQ=ZYUu[0Ph"h0,he&X,HX,FD,tj.j`=,, X,u D,uΨu١,ЋKS ,B9|^5,X,Ё}U\SVk^_U*,, X,uD,OV,f u u~Y[xhEH$,X,5,Zu X,$,PPj|* t\, X,uD,t1e[^_]UWVSu=,~ ,y,1X,W5,\XZuS0.Ph"h0,he&X,HX,ucD,tjtOj=,, X,_D,uͨNΊ<\uFFBDtF9D ؍e[^_]UWVSET, H,t h `jEP£p,XYJE ,95,X,=}U\SV5^_Uu[裿0Ph"h0,he&X,HX,D,tjjX,, X,u D,uΨu١,!L<% s=,9}u ,p,p,x=p,8\ux=p,@1s p,< uD,) ,9^=,X,؁}UtVW~Y_UE5,, X,uD,jqp,H p,s, x|,؋5,9~S,X,=}VR_Z5,, X,uD,,@ ,ދ|,,9@FPT1=@,u h Sh@,P蚼E؋5,ZY9~RX,=}V5,8ZY5,, X,uD,'.,)ߋEHMt FD7D2p,Bp,y ,9^=,X,؁}UtVWZYUe5,, X,uD,5,=,|,,Ѓ˃=`,u,HP8$,PRPX^_B1p, Bnt#ptltp,: tp,Ã=`,u9,,9 RP3Y[Pp,X=,1 p,Ant4pt%lt%p,9 NWSPNp,벡$,PPi_ZS1 p,Qnt+ptltp,9 p,뺡$,PP [^5,=,6= ,u h ,; ,5,=,9}9| h 1 p,Ant#ptltp,9 t%p,Ã=`,uS0$,PP9ZY#1 p,Qnt'ptltp,9 t^p,뾡$,PP^_1 p,Qnt8pt)lt)p,9 ZP5,5,5 p,뭃= ,\1p, Bnt#ptltp,: tp,1=,ul.5udP+,= ,p,Plp,w u݀8 =\,=L,zqq@DA@= ,u ,,Åk1 p,Ant#ptltp,9 tp,Ã=`,ub=@,u;!thSh@,r  @,,u@,RSeY[9 ,\,1ۡp,gt[B tL0 j hp,5p,T, vO*ptruR@p,î8"uh  , %,߃t ,p,8 tx u h 5,X,tt6ƅu+ X,D,tjLj#,9t'tP5,迿XZ5,, X,u D,uut,Ѓ=`,u!Ѓh,h,Y Y^yt,t,,p,nt5ptlt"$,PP_Z1y3 , , ,@p,밀pup,p, Bnultp,: tЃ˃=`,u5,5,5,f $,PP'[^=,5,R= ,,!; ,=,5,1 p,Ant#ptltp,9 tYp,Ã=`,uSO= ,U1p, Bnt,ptltp,: p,뺊X]ڃ1Qu p,p,DA@?Å , ,u,,PjZY p,Qtaj5,,(, X,u D,uѨu؋(,5p,ߋMEp,=d,tj jPS萿Ã؍e[^_]USp,< uh X< u=0,u$hS XJ p,R t8u Ӌ0,P8X0,t=,u P豹Y9j踮0,Zu( 0nPh"h0,he&VO,5P,S50, 0,t+h'h,SP\50,h0,1ۉ؋]UWVSVp,Pp,M1ۀx%u8Huzp,=D,h [s9}ep,Pp,D, p,\Pp,D,2< @,p,M8 uD,X,ف}|WR3ZY=@,D, X,TD,tje[^_]e[^_]UPEEjEP5T,'W U;h Ph h0,j菘UWVSÉ贔hW3X Å荔1ۃ8#)tSWVV ؍e[^_]USfX8u1ɀt []{[]UWVS} 5T,XfDž<XuJhPjUW u˓8轓8thG"-ÍjjP.W @u莓8th jrf8utSVWU yZ8#Oh$)?jWXjfDž=X,t fDž9DžjRjU fDž9fDž9T,jSVQV @u豒8fu ftR(@ufDž=X,uK"T,@uՃfDžft@u KfDžIe[^_]UWVSQ}u VW[ZÅuzjjZXZu hR jQp;s jEPW7ƃ ?tE8thh jo蔑8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}XHpz}z9zu};zu 9u{;Mtt9u ;MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEU HZ@9BD[]UWVS Ɖ׋EEE EE1;U}9xu90u,]9XuM9HtyB܋EEE9]}!9xu90uU9P uU9PtEE,Ck,RUQZYt&UTԉ2zur}z uE1ɉȍe[^_]Êt"tUWRPY_}ËBt1Uj角L$qUWSQ`,-,wh,ڞw ]]5t,5p,h jz5|,5x,h jb 5,5,h jG5,5,h. j/ 5d,5`,hF j5l,5h,h\ jE$hr jEPP$h jӤ =,t>u`,1 ujUeY[_]aÃ=,tUE Puj UWVS}u cPh jP3,B9tT,e[^_]UWVS$ ]5,t(V謌$V10Y^uuh j0Pu  ƒ W\p4$:0ZtWVPK uWh j腣 5 jj0։( y 0h jju ։ƃ R Wh V ƒ -jjW ‰  V h h_Xuh/ jƢ[^=jh h R( y RBY߉R+Z=t7w=bt%=bu;%=u&*! u hQ t u h] hjYu VWƅ/ t jZV8 jZVPW KjjP@& ,tS SQPR( &,kPߓƉ4PǓ8t t10hu 9vBFu h j 1e[^_]UWVS\]ƍ}ZE5 (,&x&044)8EPS9e[^_]UWVSĀ]p$tV:V:Y^㋃p tV:V:XZ㍅xPh1RPuuFt5P+9Ήt}"Q95P+VPh e[^_]UWVSP] -E41RPuuAƉ׊tC|1ׄtuju1RP=tuPh j1EtZ WVuuP?7VZ vWVuu,?kWVuu?k ËEe[^_]UWVSTE‹EJu E=EHEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉUEUE}t EșŰU9Uu‹E9uM] E} uWVE,# E =,EEIu EE1 t1҉ËM ʋUщe ʋ}t}\RPE,r$hZ%5,Ãt#ESjPVRHt h YS/xZ,,E1p,t,E<EEtEUE\EEEԋU+EUE܉UEs‹EmJu EE1 t1WVuuK=9E 5E01҉ t1ҋMԋ]+M]WVRP =9E EEEEuuԋE,"EЃ Et8ELۃ0EЋPatEhaRuuPh 3GPEЃP53‹EЋXX9t%ERQuuPhO j萚uЉu]Љ]EԋU؃E܉UEEEEE]$tSS;Ut ]K}O;MFt }_] 19](9Muu܋E,!EujP2EȃEEE$t }]Sd9Us"<瀁}}E= u+}}EE€KEFEMQRPuEPE]tXpXjub6XZ9u9]EE@]k,PuE^XEk,tԉExVEk,tFF E܋UFVE$EċEtP4@0P,@(FV}tGPGltȉF Ek,Dԉx(}҃ P$]E}ĉ8EPEXE1 t1u}]DEw;UnE];Et\]ԋu)։]uE‹EJu E?EJ1 t1WVuu8Puuh j&EtP @@1ҍMQRPuEPYE0juL41ۋE;pEEE9vhI9uEtpp EAuu܋E,PujP.EȋEe1 t1u}C<҃<DEE}k,Pu薍EZYu E]ĉ1ۋEEEĉƒE9 k,E}wt 10x}t7t |44px u܋}px}Єtw04w(,px}wp I9utGE@ E}k,}D$uu܋E,ujPw-EȋEk,Ur(Er$ t1u}Cȋ]E<҃<]DEEEN]ЄtKK9M}1ۄt_9]u 9M>Et\uԋ})׋EEIu EE EÉ1 t1RPWV5PuuSh jܓE}ĉ8GEЋP9Ut,EuRuuPh j襓E}8E]ĉE Eu,,EE܋UEԉU/Ee[^_]UWVS uEPF VM]_9EEr )ӉM܉]Fƒu >uFFFuEmE9v*Wu h jȒNFF1ۋE1)ډEUF@]t[ ][]E1ҋM])ӉM]E;Ev 1)EU1;EEFUUEEEeM1SQRP38FVe[^_]UWVS]E 8wEE 9MUS}HPH EU,hj,QWc}EEPhE ƒyEqRPh' j]hj,3W{c}t EECEEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ0΋QRPhB  EEǃ<EPURvSE܉EUjEPURSIMM܋E؉ẼEE19~k,ŰD$EUGm<EEm`,`,h,h,EЋUx,|,ẺEMEPh ǃ yNQWPhS 0FPh ǃ yNjQWPhy jU1eY[^_]aÍL$qUWVSQ9q,,,,,?,,,,1h VW-l ta#DtNJCl.5,뷃b$ ,,C,C,u5l.5,e5l.5m,R5l.5,@,/5l.5,,5l.5c,Yl.5,h0,h #XZ+)lj80h0,h S#^_=,x8th# 5,t hd jTtjj)h,F!͌h+jj`ZY@u h jj h,F!蠌hjbK00h @PG@ uh t|j/SJB[_Åu@`,׉hjJhjJj'%8,P~,1uph jUjy,؉8hDj藂803PyP3h; jW5,OG9=,=,tl95,~],4^FY烽 tgDž Dž,,9, ,4=,tj*x,xtP,0j,dhDžldPh , à t&s8:h[!jkRDž1ۃ=, 3,,,4@TGXRjPjj($tPh\ XB 0XHt&X HX8<@($H 8<@h RV'1p,t,0YZ9t4VZyPhq jPh j蔉 ‰Ju MYtH‰;R0<8Ph x tH;01 t1ҋ+8<9ȉ|;8<}3 ;8<Y08Dž<߭8ݝ8y11RPSQZ.1ډ߭ @ !ܝ8=,pݝt{\PSP ݅y+؉Ph j資 jjPh  \`+EU5,9Ɖ 9jS1[_@݅u؉]Ph ,ܝp H !ܝ8 ء,40,<0YDžDž8985pt_|OlLRjP811RP$8DžtGlL9 ;vukQ k4 JHJZH XH J HPW4 T0 T0VjQ'#XZtGl8hjP8W8P Pu|Ph [^DžDLJ<,8,0H8ȉ9w9rÉDž0Ph2 70Ph2 j螄 4Dž0Dž8Dž;U09048Zrى 89 +4im۶Ɖ2SQVPhr 'DPh,VW(~Q8D\`HP\Ph,Wi\DH0S, Y9Ѻ}uDž0Ph @19w=D\`j\Ph,W\D898}8SK t+4i۷m۶DQRSPh DPh,SW$~8E,]ZF(D0t#,1DžDž8Ph /90~k,D$Aۉ<Dž ߭߭`,`,h,h,x,|,DžXDžTDž1DžDž90ttk,N9Hu;V tyt_|TRXR01RP!1RP1FV 9|,PQpQRPjWI(k,Dž;P}VTQXQ0)Q t pb멋T=,t1p,k,D;$p+$9~t$DPSh% 0pPh Ãg0|g1SPh: js~0#tVf0:t&0Ph_ jD~,_Phq j$~,?$ʋ$(($(0411ۃ8t="k4dd081SQRP#d1)Ӌ$(+$(SQ840($Phw j|8G8904|Ph j| jh , ,jGX 9,/ Ph!j| 5,=,th$!hT hh.! SPhj!j{,5,;K؍eY[^_]aUE UMQ1]US]C Cs4SqjS1]UWVSPj mZ1ۅ'ƃ}kEPmÉF X1;}}lAAA AMu}mËMXu,kF t 48uYPvuVpuXZG@ EEFFE FVEFVj8 m_u/1~ tF ;}}k4uGYPuZVtX+P 1EsC4CH1C 31؍e[^_]UWVS]s$tVVnXZs tVVW^_{G 9w~k4ztFYPptWjt1XZe[^_]UE@H]UE@@]UWVSEXC9C@CPh!jTykCPs push!j1yFC ksFFF FskZush!jxK kKK E UAQMCSEUCSEURPuuE UMA Q}} EENjEe RPu13 yEsh!jQx EC1e[^_]UWVSQExGE19E~4kw N^9M U|V 9U UV} E )G@1Z[^_]UWVS]K4q{C,S0EU%EuuuQMg Mt)Es CrEC C C[EEF}~NjEfRPss 1 E9CuaCCV}~EFNjEfRPss 1 uh!uYEC$Cs4SXZEe[^_]t@Ë@ tËÊtBRtUWRPQY_}ËBht1UWVS ]L 1󫍅xP>Y^$,tSh[uЋ}ԉ t,t)ƀ,tC|)ƉDžDž 9 Dž4DP S8tGpBu`E,P+Xe[^_]ÍL$qUQ ,,5,5P+D !EM MuQQ$RPh!XMɍaUS]CtS P S tSPSCr s `ZS_ ,X]USEPsH) ,, ,H1҅u0,Z[9t ,u,u h8!j ,X4CXtYZ@]UWVSu EEE#P+,, ,M11ɅtJA9~ʳ9M}#t,hL!hx hh[!fx}9x4u }9x(u9p$t버t,e[^_]UWVS]uuu SO trNj@th}!hp h1GGWX9w&~6Gth!hp hh[!wwVw ;(G [^WY,P+;,V=,tGWu,P= ,t+GWu,WGtG4WPZWX,j@jQ'VjG'G _4E UG$W(G,W0wE #P+G8,tz8GC GtWP { _ Ge[^_]USEM Puh!hh h4h[!vP ʉPHPPP s E]XPs4H ,,,@ ,H,0@t ,H, ,H,P4JH8,9t!tXYX tAP]UWVS Mu }uWVQa‹EZMt ,1ZU,EEEPWVQQ EMUJ,B0xB BB4RPX r J1؍e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=P+Y,A0Éa,ڋyY I4 s RPWSQ  RPWSQ e[^_]US]C%CSjSN1]UE UMQ1]Uj#UU P,,PYtHJ ,,@ ,,UWVS] (,C0tS4P4S4C(tS,P,S,s$tBFtV P V V VY^׋FtV P V VVXZs uًCpdYCY${sY ]e[^_]YUWVS]E EEEE@,Etp9XH0udxu9w,uDu9w(ujGUWVSƉUMXC0E)ЉEE9}}t)ujRu uVlƃtjE0WMECdpx K1}t)Eus XC EUP 1׋MXZe[^_]UWSÃtDpTttRPBY[L(ștșe[_]UWSvhE!h h hV!RmÃttRPY[LXștșe[_]UWVSvhE!h h"hV!l؃t$t<%-DXe[^_]UWVS vh{!h hhV!{l؃tttp|t<%-D(e[^_]UWVSSËu} 9r4oE t19ur Y[^_]Ht#Et!Z[^_]UWVS(MEEЋEEԃ}t E]؋}1߉}]1É])EEtApE؋}EtEEUEUEUUM11 9EM|)EUNuӿEU+EU)ӉM]ڋ] S)CC [)E̾EHE؋M9MuU9UtLU)UEUM t#EFUMKCC MH)EU;uu}tE0([^_]UWVSTuU E X ;EEr[tMEƉ׋E t1 Et0x @1ruuuURU Vuuu uǃAU ENEEU1MVEUE EtE9Eu'E9Euuuu " ut jS%[XF EAPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEU't jSXZER]u t1ۉډ uMAe[^_]UEjjuuu PpUWVS}E EEEpt[ȃ<ۃ、ދUZ ttRP>YY Ct1N9Uu9Eu1ۉ؍e[^_]UWVS u}j8jiËEECCCDPCPC XC C$hj&EhjM쉁j`jMAdKAHA 19Et EXEMQjR t1WVEPEPPPuu uiƃ(u9juELEpdLuLSLDE싐E@u ju1^_}E UG(W,}x0xdEtFVtRPYYY Fht1҉GW EWW 111uE싐E tWVUEZYMQdMD u(,EE %@,S0tK0J4@,@,C4@&,C(tS(P,@&,C,@&,މe[^_]UWVS4]$EE tPPRD1ƉẺlj؃vmOu܅yh!h h8}u ҃0U }EeEǃEu++M 9EE }tN@;E~P2ù}t@BE؉FMMMyh!h hh!c@밋B 뾋EEPVEԉƊ_DE EM1 t1u}u}8u0E EEEEE t@@;EE tPPzƍD1;EEtP19U9EtXMQjRu} t1WVuEEP }ԋMTjPwEЃ tX1 t1u}}DEE t@@;E} tuuuU EE؋9MI;MuEtpp ƉsǍURjVEU t1RPuEEP }ԋMTjPh  t1u}EO<҃<DEEE tPPoƍD1;Evg}7t19}u 9uPuuuh!ȧ}t,EtP1uuRPh!薧]9]tSuuuh!wuux] SY[9tPRuuh@!KuF uFXEE܍e[^_]UWVSQ`MAEAEA EAEtCpStEU CHEEE܉UEUEUEE9EIu )Ẻ1ҊM t1҉EԉU؊$Et \EU)uuRPcMe;Uux;Eus 1ҊM t1҉EԉU9}u 9uuEU1}t M9ΉM|;}u;uu uԋ}u}@ uf‰FMQjRu} t1WVuZEp ~atju5_X}uW}tF 9uڋV(F,F9puNjV F$;UEr>PFPZY9뗁~atuuh!tF 9t/ Fp9t(1SQ1RPuuh!艤F(V,F V$;EUruPuuh!Wuuh!? }t2tF(V,F V$9Uu9EtPuh!! EUjuuuuVSǃujuY[}t%tF(F PuuhB!蠣hY!h hh!0\LEEE1ҊM t1EUEUĉEԉU؊$EtẺU\EEЋEU+EUЉEUIu r1ҊM t1҉EUEU+EUuuRPuuuu9uOE1ҊM t1҉EUEUă+EUEUuuRP9t"}tFVEԉUF EE }tFFuԋ}؉u} u}uEuEԋU؉EUEjuXZE9EEEEE Et EUEUEUeY[^_]UWVS ] }t$bƉ׋EVWVRPh`!^EbuE‰9u+ztE։9u 9u Tv9sE]Ã}thq!8h,AZYtCpStCHuRPuuEU}t h!ДXEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPh!D&,6EtM}`d)RPh! tCpStCH9Uu9Et]1ۉ؍e[^_]UWVS u }^j8j`E@EMAdLALA LA A$Y[}thjËE쉃PXZ u =P+ƉEE} t h!+XP+EPjh WVuhjËEp E쉃PEP P jP^_ts s@5P+} tURjh  t1WVu$hjEEp }E}쉸PEP P jP}ZYutCHSLC419|} tMhJ!ߑX@E?t} t#h!Xu uuS9u u<X S<X]tS<X1zSt ǃ ǃL7tX\+1tǃ`dǃt}uWjƉ_tCtP^tCtPFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjS;thlSXZ؍e[^_]UE PujP+ UWVS]FHlj1RPuu EU슋tC|1EUEUtURjW1EURPVtPu h!F u|1t$QPuu F P@EUE~ vQRuu kQRuu k NjGEEjV{XZ1;EE$Et\u})׉u}E‰@Ju 1 t1WVuu1€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et EEu } tu}}t EEETƉ׋E t1 9;uE|LEE Ɖ׋Es|| t19EMWVUE&ZY‹E9sE}u1PWVE| 6E|E||RPʋEuEH_X}t EP4PR^ ;EE:#] ]Et E!ËEU| t19r^EGމ}t(SuuuE}@,@0E@dpx E3uuUEZY9|C}t.EPjRuuu|E}Dž|E}u1PuuًE| }u뼍EPEPEPuuuuB|[EA}u}t1U9~|u@EiE@dpx }u}t<}uuUE~ZYPuuueE}s}~,EME uEMEM}~EMEtxuDžpp9EPEPvvuÉE~uP H1E@,@0I@u?ENjtx t1C,S0C CC4SP_N]{ E u$EtDNEtxC4SP[@p]M}tE@,@0Etu2EMEEMEXEURjPt5t5utt5t5h! LEP }tDP4PRF}xUB%|aE|;EZ,J0tB BB4RPX||e[^_]UWVS u_EUEU t1҉E܉UURPuuW EU1EURPKt1ҋM܋])ӉtF|1)ӉM]]eEU]8vfBH4MQjPjjRt Ph!$Y[MA tP@F(V,@F jQXZtF(V,EԉU؋EUF(V,F 1҉EԉU؋EF vkBHMQjPjjRPt Ph!~[_EP tM]JZ}zP4PR:Ylj1M]M܉]‰1 t1҉щ‰UtVR Ћ]9]]]}-@@EUM]HX Mԋ]؉L:\:sR v:]9]]]} @EU]XkEԉD:8]9]]]} @EU]X k EԉD:BHMQjPjjRt Ph!XZEP M܋]tJ Z$JP4PR:EP4PR1e[^_]UWVS}cvfBH_MQjPjjR!t Ph!O^XEP tJZO(_,RW jPY[$EtG(W,G 1҉EU苷FHE܉%1RPuuӀ}tG|1Ӏ}tURju1RPVJtPuh!u 1Ep tSQuuƋF FtZ< vSQuukSQuuk ƃ~t*uuh ! tFVG(W,FG vkBHMQjPjjR\t Ph!XZEP tN^JZNJP4PR:Xju ^XtG(W,G 1҉ W[Et UG(W,G 1BHMQjPjjRt Ph!ZYEP ]t uZrZP4PR:X17D&,t G0W4G(jjP0uu Wde[^_]UVSUE 9| 19[^]USPPh\ !h0,T&h0,h !P+CtsPh!h0, &jUSSE] tt %E!h !sZYu EeEPhvd5d*,  @u35`*,h!j ]UWVSQ}u t~^ḩ!S_YZu ELh(!SEYZu E2h=!S+YZu Eh !S[ZuEuho#vZYvMEPhud5d*,  @u65`*,h!j2e[^_]US}t?,Shzd@5d*,  @u5`*,h !jRPu P,=wP, P,UWVS5O,Ctt* t%Pσaw<w u;w]KAfw"k 1i 19u5 ,{$1TtDQt!@ u 9t1 [^_]UMU 9|]UWVSƉ׉MO,O,ÉEE1RPWVzE)Ɖ1UQh->%pXZ}UtO,H9uO,H9u u9wBRWh!: e[^_]U塸Q+=O,tvPh!5 P,5P,5P,5P,5P,h! 5O,5O,5O,5O,5P,h!5*,h*! Ph8!hB!nP,P,5Q+5 P,5P,QRP5P,hb!^,h!nO,O,5O,5O,QRP5P,h!" 5O,5O,h9!  UWVSQƉjEPV膭 >u#ËE8u~8"u w܉1e[^_]US(P$-"Ph-"Ph-"Ph-"PShq!h0,@,j UWVSEM Q+9uh!5Q+ h!j:MыEEUMj؉EE܉]]#]؋]#]SPWBuAtTQ+Q+=PuR 1P5.,R 9Q+uN#u5.,}e[^_]UWVSEUϋE E컬!t2!EUuESh7!蔨XZU&ff=Ut1=O,t fuuShU!Q>ff=u+2…h!>fLJ_J1f=U=*,u Sh!=Y^*,tSh!=XZ1bEj(VP ۋUx.pōH 2P,tLfLJᵃЍe[^_]UWVS9*,u*,5*,W1XƃQ,e[^_]UWVS@}EỦMЋEGWEĉUȋG WEUE!EEtEl#!11}=Q+EO,O,UEEEEM]ЋERPSQPE܋UEUuuRPRPuűE܋UEUuuRPRPE܋UEUuuRPRPuh! ,"uuuuuuuhJ!v  h,jdhS,; u hj!j`ES,h<"hS,vfY[S,US,< <$u z Ћ ,DQu<-5j EPhS,:Ɖ׋EEhX&PREԃEPhn!u tuh)"u t L =Q+Ήʋ5O,11WVRP3Ɖuhq!uX ug O,ω%O,Ɖω uEt5O,1Et O,1Et O,1)Et O,1)׋EEԉE]h<"SdYZÉ]; t,hS,ZƀS,uhS,hu!  9uE| ;uĉE}.uuuuWVh!S ű}u}e[^_]USE Puh! ,H, yh,Y,P,؃ t7@t( ,y h,Z㡀,P,hj!j1Y]UWVSEM Q+u h!jQ+u֋EEUu؉E䙉E܉UE#EƋE#EjPVQRBu @uQ+Q+uhuP lR5.,P 9Q+uTjWV5Q+Bu@t.,C#EйNju5Q+R5Q+ 9Q+ue[^_]UWVSRá*,u ƀA Mz΍*, S}8PR *, e[^_]UWVSEu} u1Ӏ O,1ۉ)ډEUE;*,E*,!u}u}E9*,*,E!=O,t Es*,Kf9]t 5*,tʅu+O,9UE}1;ME}t%}t}u Ɔ낸!%![^_]UWVS EӋEEh*,@Ph*,{E =*,t hI!jEG9E|E9}|础*,] +} WRP*,ڹ1󫡀*,<fLJU }u> O,5*,΋E)M艊CKSCsV{KSC CHSe*,Ee[^_]UWVSEUE E M] M]9 P, P, P,19EtTtK}E9ϋU}29}} }!!=O,}@uE2P,]Ã}!ډ˃|*, *,t#=O,2}X*,| }Bhj*,[^u ha!jfǀUE죘*,EU *,*,EU*,*,*,t_}t E*,Hu*,=O,h!YT!z6P,=*,d;*,X*,EU EUEUKx[ 5*,t;EU |9EE}=O,}t뢃}*,E 9*,u ;]*,H*,1+]9~ Fu%ud PPRZ *, HO,1RPEU *,+E*,XZ!9!2l!+!$EU *,*,EU*,*,1҉Ѝe[^_]UWVSË@S t15P,= P,9u9th^!-1Ysǹ󥉍1󫍍u0S! StT!Qh!ǚXZߋe[^_]Ã=O,u x t1UWVS|ÉסP,tP Yj/SR^ZuS5Q+h$hP,^ SP,YP,u ha!jjP(XZy5P,h#^XxPSZY@tϋuи 9E} 5P,h!5P,h!/Y^Xh h.,Sb 9t5P,h#~f=0,Ut 5P,h!SKZS4XtjYe[^_]UWVSÃ=.,u1Ҹ)6#.,f=Q,u1f=0,I؁=.,t#., P,.,󤡜0,fQ,fR,UtQ,1R,u[^_]UWVS áQ,fEO,O,P, P,11t#f}u&Q,t9r $uɡ*,E *,19E~+f:uzti 9t@Ћ O,tO,uf}u=Q,! 9'=O,t u)h!-Y .,uh!h%XZ=.,t_f=0,uq0,!9P,=O,tPh!1-Y_PhR!_Zt ., =.,uL)6#t $1d.,trq0,!9tSP5P,h!,=O,t1f=Q,u3 q0,5P,h!ZYuQ, $te[^_]UWVS(ÉEU EUE؉u=O,E8!e[^_]Y11ɉt<u ȉh'jhh !P~i&tPQRhA! fu1k t Ph-"hP!WVh-"he! =Q+RPSQ)Ph!4Y[=O,u" O,9u1ۉ)11ɉ:j-j)XZttAM]EĉUȋEUM];EĉE|F1EUȋN1G묡*,*,)9E}|h"!`M]y;u 1ɉ uT1Q,Q,FuE;P,E P,|/=O,u&h1"!O^E@(u}=O,}uEEjhjjjщ¸?"!_E O,u,EEEEEE}t#*,*,EU*,*,P, P,EU11ҹuuRPQUMp$EĉU+EU;E}EE}]u)։]u}tc*,E*,E}9}}9}t&>t!9Eċ}}e;E}}EUE븹 P,19]t0t'19Eċ}ȃ;E}}EUCu(N1ڋN19Eċ}}EċUȉEUEU+EUȉƉ׉ u hE"!E9ƉE|E Euu}O,O,1RPuu蟢u 9u ۃ}u ;]uWVjjPUM,#&EUEPuhd"!hm"!h,jdhS,?u hj!jhS,[vSHƀS,t'S, t;E|EHPhS,h"!c uhS,EP$ EUEĉUȃ}tjuuuuċUEjuuuuċUEnO,t'uu=O,}t Ph#jYP6LY$uN}tjuuuuċUEjuuuuċUEt Ph#j}uk}E EU U u }̋EEfukE } 1E}t }te}tE} O,1 *,*,;]u1;MtuuEċU_Z *,UׁǾ}`EU}̊EG]ĉ+EG}Ẻx HPP2E̍HPD;}̍_S[^E}t fǀ fu uEPkE }P 2=O,t h"!YuEft=O,=O,h"!Z`E̊@EċE̊XE%}WЙ=P,w1WVjjjщ¸#!1ҋ5O,N1SQjjjщ¸)#!ƃ(Eă?1ҋ O,1SQjjjщ¸8#!eM̉YY? AAEĊYE%QЙ=P,w1WVjjjщ¸I#!ǃ(1ҋ5O,N1SQjjjщ¸Y#!ƋEă?1ҋ O,1SQjjjщ¸e#!M̉YY? A(}u E=O,*,tKx *,u19EċuUw}E9*,~: *,EE̋EEUE$E+$E$E+$EEEEEE$E+$EEEE}Q,t2Q,1҉EĉU;uĉ|Q,1EU9Ɖ}112Q,1ҋI19M}39EE$M]11Ee[^_]UVSáO,u hs#!FX1ۃ=O,u Sh eY^jjڸ P,CXZu҃=O,u=*,th#!FX1P=*,h#!u Sh#!Y^ *,RP1҉jXZ=O,tCO,9*,=O,A=O,~h#!^5*,j5*,5*,RPwf=Q,th$!E^h#!J[Q,t=h.P"6Q,Y=uh#!"k Ph#!XZ hB6!Xh@%PEX=O,nPh$!Y[=O,Q,PPh6$! j=O,t>u ShX$!XZ9*,} hq$!DX;/ *,RP1҉u Sh{$!UY^jjڸ P,XZe[^]UWVS ˋDž! t DžT!@uh$!1XZߍDžjh$!S1 t 1/9Cu苅9Cus Pj ;Cuă=O,t.{ t(s$s sh$!-e[^_]UVSPEQ+;Q+u*=O,u!URhmdP y h"?^ P,119@uh$!B=.,u111H.,~ ف.,@uh %!~[E*,01C;*,}. *,*,*,@uSh%!~ZYEQ+;Q+u*=O,u!URhmdP y h"Z~Xe[^]ËUnPh;!h0,jNUWVS|E|xhT,wSh$@!؂|\us11t\Uhx&SUB 9}Sh|L$蘂XZ]e[^_]{UWVSu} EU MahG8lG,p1pd1ld1pPQhJ@!j@tPC1w,pC1w8p1w,PQhJ@!j@UR0URtPhhS@!sQhha@!VC tCpStC`Sd CHC@h _u jj@1󫋃@ƒ<ftf<%GXf<%GdytDtSP1G4Y^tT$1RPiƒXZDžDžtpxpx t WV9Y^Ɖ׉ t19sB‹@@dT Xj, Ɖ_P _P FYBHqQjPjjRt Ph!>XZ@ fGt~O@@~J@Ht G G$GC8S 5F t)C8S< p)C$F FFFF F <@4PG^jjXjjS(Nj@tK KS1P1ZYƒ<f%Tf-fGHdAf@jtK K11Ҋ t1ҋAQ jhWfBjtffFBdp pXZ1ɉƍ19vG@dtA uى=v4ts sG@d1ƋD tC CRjPjjW@ DžI!Dž1p菣_<҃| ;vhU!5 V,h!E Ft)P$t8tGpBu舡 EZ,Q+Xe[^_]ÍL$qUQ Z,Z,5Z,5Q+D !EM MuQQ$RPh!覙MɍaUS]CtS P S tSPSCr s ݠ ZS֠ Z,X]USEPsH) Z,Z, xZ,H1҅u0Z,Z[9t Z,uZ,u h8!jlX4CXtYZ@]UWVSu EEE#Q+Z,Z, Z,M11ɅtJA9~ʳ9M}#tZ,hL!hhO!hh[!A}9x4u }9x(u9p$t버tZ,e[^_]UWVS]uuu SO trNj@th}!h`O!h1GGWX9w&~6Gth!h`O!hh[!袸wVw iG [^WYxZ,Q+;Z,V=Z,tGWuZ,P=Z,t+GWuZ,WGtG4WPZWXZ,j@j,hVj"hG _4E UG$W(G,W0wE #Q+G8Z,tz8GC GtWP { _ Ge[^_]USEM Puh!hXO!h4h[!iP ʉPHPPP s E]XPs4H Z,Z,xZ,@ Z,HZ,0@t Z,HZ, Z,HZ,P4JH8Z,9t!tXYX tAP]UWVS Mu }uWVQa‹EZMt Z,1ZUZ,EEEPWVQQ EMUJ,B0xB BB4RPX r J1؍e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=Q+Y,A0Éa,ڋyY I4 s RPWSQP! RPWSQP!e[^_]US]C%CSjSN1]UE UMQ1]UjdUU PZ,PYtHJ Z,@ Z,UWVS] Z,C0tS4P4S4C(tS,P,S,s$tBFtV P V V VY^׋FtV P V VVXZs uًCpd蚚 C茚 ${sx ]e[^_]f UWVS]E EEEEZ,Etp9XH0udxu9w,uDu9w(u-Me;Uux;Eus 1ҊM t1҉EԉU9}u 9uuEU1}t M9ΉM|;}u;uu uԋ}u}@ uf‰FMQjRu} t1WVuZEp ~atju5_X}uW}tF 9uڋV(F,F9puNjV F$;UEr>PFPZY9뗁~atuuh!tF 9t/ Fp9t(1SQ1RPuuh!F(V,F V$;EUruPuuh!uuh! }t2tF(V,F V$9Uu9EtPuh!! EUjuuuuVSǃujuY[}t%tF(F PuuhB!1hY!hO!hh! LEEE1ҊM t1EUEUĉEԉU؊$EtẺU\EEЋEU+EUЉEUIu r1ҊM t1҉EUEU+EUuuRP)uuuu)9uOE1ҊM t1҉EUEUă+EUEUuuRP\)9t"}tFVEԉUF EE }tFFuԋ}؉u} u}uEuEԋU؉EUEjuXZE9EEEEE Et EUEUEUeY[^_]UWVS ] }t$bƉ׋EVWVRPh`!EbuE‰9u+ztE։9u 9u Tv9sE]Ã}thq!yh,DZYtCpStCHuRPuuEU}t h!XEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPh!j,6EtM}`d)RPh!r tCpStCH9Uu9Et]1ۉ؍e[^_]UWVS u }^j8j;IE@EMA A A A A$Y[}thjHËE쉃PXZ u =Q+ƉEE} t h!XQ+EPjh WVuhj{HËEp E쉃PEP P jP^_ts s@5Q+} tURjh  t1WVu$hjGEEp }E}쉸PEP P jP}ZYutCHSLC419|} tMhJ!X@E?t} t#h!Xu uuS9u u} X S} X]tSw} X1zSt ǃ ǃL7tX\+1tǃ`dǃt}uWjEƉ_tCtPE^tCtPEFY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjS;th+SXZ؍e[^_]UE PujQ+ UWVS]FHlj1RPuu "EU슋tC|1EUEUtURjW1EURPVtPu h!F u|1t$QPuu F P@EUE~ vQRuu kQRuu k NjGEEjV{XZ1;EE$Et\u})׉u}E‰@Ju 1 t1WVuu !€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et EEu } tu}}t EEETƉ׋E t1 9;uE|LEE Ɖ׋Es|| t19EMWVUE&ZY‹E9sE}u1PWVE| 6E|E||RPʋEuEH_X}t EP4PR^ ;EE:#] ]Et E!ËEU| t19r^EGމ}t(SuuuE}@,@0E@dpx E3uuUEZY9|C}t.EPjRuuu|E}Dž|E}u1PuuًE| }u뼍EPEPEPuuuuB|[EA}u}t1U9~|u@EiE@dpx }u}t<}uuUE~ZYPuuueE}s}~,EME uEMEM}~EMEtxuDžpp9EPEPvvuÉE~uP H1E@,@0I@u?ENjtx t1C,S0C CC4SP_N]{ E u$EtDNEtxC4SP[@p]M}tE@,@0Etu2EMEEMEXEURjPt5t5utt5t5h! LEP }tDP4PRF}xUB%|aE|;EZ,J0tB BB4RPX||e[^_]UWVS u_EUEU t1҉E܉UURPuuW EU1EURPKt1ҋM܋])ӉtF|1)ӉM]]eEU]8vfBH4MQjPjjRt Ph!$Y[MA tP@F(V,@F jQXZtF(V,EԉU؋EUF(V,F 1҉EԉU؋EF vkBHMQjPjjRPt Ph!~[_EP tM]JZ}zP4PR:Ylj1M]M܉]‰1 t1҉щ‰UtVR Ћ]9]]]}-@@EUM]HX Mԋ]؉L:\:sR v:]9]]]} @EU]XkEԉD:8]9]]]} @EU]X k EԉD:BHMQjPjjRt Ph!XZEP M܋]tJ Z$JP4PR:EP4PR1e[^_]UWVS}cvfBH_MQjPjjR!t Ph!O^XEP tJZO(_,RW jPY[$EtG(W,G 1҉EU苷FHE܉%1RPuuӀ}tG|1Ӏ}tURju1RPVJtPuh!u 1Ep tSQuuƋF FtZ< vSQuukSQuuk ƃ~t*uuh ! tFVG(W,FG vkBHMQjPjjR\t Ph!XZEP tN^JZNJP4PR:Xju ^XtG(W,G 1҉ W[Et UG(W,G 1BHMQjPjjRt Ph!ZYEP ]t uZrZP4PR:X17j,t G0W4G(jjP0uu Wde[^_]Ë@t@Ë@ t@Ë@UStPpXtPH[]tË@dtË@htË@ltË@|tËtËtËttËLtËXt Ë\UE @(]UVSuE H$X(1y6)tNp1SQRP e[^]UWtBRBR t RPY_}ÊtBRtUWRPkY_}ËBht1UWVSӋEU ΃tt RP*Y^CSljtȉlj{he[^_]UVSuE H$X(1y9)tNp1SQRP e[^]UVSuE H$X(1y9)tNp1SQRPU e[^]UWVSE8X@ɃLȋu+F4utE4 1ۃ}( ;]}>E@ uuSh[!;a ]BD1H)EC뽉tpE@ EDžtQ+ttHt_kh1ҍ 9E~ىlE0u4xux[$9^$wBʋx0u4h)ly1ҋE9UE@lDžxDž|Džtht9l~Mux|N$^(uv4ht Ɖ\ @ptx|BS]D@Ht!@uNtAA EHllSE@ $Et_pwtwHi t1ۉZ,r0Bx}t !! 8l+h@P!h[!j3ÃpkTtDpt RP\Y[Bf]p]ptSQp[XEЃ_tuuYYEUEUDpTtM]19N ;EErEPdEx4X]G\)Ɖxx%x\9wxxXE@4t"p]uuF4GpWtEU UUuF4GHEEEXCEEPEPEPuuSWtuuPh,P!h[!j1UM9}#ƉЉʉ t1҉EUhxhtEtuEp h{!hP!hL(șșE@d]S1Ҋh t1҉Ëp*Mpt)ىRPuEtȉD(UEvhE!h P!h hV!|ƃtt%RP,Y^DXpt pșBu3u.ډnutSQ[^]EvhE!hO!h"SЃt0tuuYYEUEUEtȉDXHpURjPpT5ht5t5Shtr2h,P!h\!j.T5E@ t ЋRBu:u5E@utRPUY[pLEP t]uʉtu4P4PRZ!)ӉM] ‰Ju 1 t1VSuupE ;EErE@duVtFHÉE1URjS1SQVOt0Pp`Dždd`hU![‹MnJY u N#u E1kӋ+tA r:s uC <uA4QPX#E@ le[^_]UWVS$}FHnEtO`_dO@<)ӉM]% Iu gÉ1 t1RPuu1JURju1RPVƃtO`_dO@)ӉM]xsIu V1 t1RPuuV1RPhU!guHV UtO`_d G@EU‰eE؉rEЉ)E+M]M]ЊM1ҊM t1RPuu]K!]~tO`_d G@`EUQ‰EԉE+M]M]1ҊM t1RPuu)1uk]CC EC <EtO`_dO@)ӉM؉]܉‰Ju &1 t1RPuu{U]F4VPBHIMQjPjjR%t Ph!S[^EEp H]VB}Vt4G8WuЃuűuF <u v0E@4uPu EE pEHEXZEE}t=1ɋ9H~@ UE|P¯AAMX뽉Ej,j,Iu"h\!hO!hXhV!it5G0W4G(W,G 3G(W,PTPTG W$pGE @0E @BBEPuK G>PGP1^Zu|O 5‰E1 t1҉Ɖ׉1 t1Yt)C8S<)C$}u h\!jE p}9}tpE MAP9y4uj,j, y(xk, k, k,k,A%AQwE@k,k,EY눋Ej,SZ} 1e[^_]UWVS4E@(E؃} G,uEE xEE xE} 9G(rG,}t/wu u^_EtEPt@pE؉UvыE@HEE܋EtƋE%1 t1EEDE }P} _swQu؋}܉ t1WVR藭‰E PBB1ɋE:9vHEEЉÃB tǀǀ@A묋E @ EƋE<1 t1E$EЋEt)p@xD)p,EI] )C(}Ƀ)K,{ E€}\EfƋE @$1)ߋE؀}t U܉WEEj,j,EUE@(EЃ} G,u0E@(EċE@,EEEЉEă EudE@ tčEPPPugE @t9}t@ ljE]KdQ1E X]C ÈEЃeЀEE @$EȋEFƋE1UЋEЋ}t@ ljER}OdQEăM uEE1UŰE P}tZCr{<uxZ,CZ,Z,C@CC sh\!hlP!hCh\!cjS8Y[E P EE؉ÀtfBfB@tfBfBE @$E؍PE P$E+1u E @EP,@(E؉U܋E؃ E܋Eu\tPL@HEЉU @4EEԋEPUr,z0 t1EtpHxLp4j,[AM̃HEVEЋE1RPuuGƉ׋E1׋EۋMtURju1RPQtPuh! EEЃE̋]E1ɀ}t&QPuuS ‹rzuЉ}FEvs vQRuuPkQRuu;k BEEԋEMq,y0 t1}trzrC4SPZ1ۋE EE]Ћu)։]ЉuԋE‹EJu ELEW1 t1WVuuljEЋECHEEƉ1ƋEURjQ1RPSAtP1RWhU!kEƋME|Nq u P#U E1kEẼ<ۃ、)؉u؃1ۋ} uq r]:z ur E<}}Љ4A4QPX؍e[^_]UWVS(]EE @EEZED1EԋE<E9C,rE;C(~tSCxSuSE z$KqN(v,Jtr K tQQBtfQfQ<)C,E @} GCPS8EEEE}9}CEHM}tu}M} U؋MW$O(ỦMЀ}uT>9Ewh\!h\P!hhV!^ù}t }Љ4‰|4EUX<E)C,E)C(1e[^_]UWVSS] EC1Ex$tPGEGuh]!hPP!hh\!]GuWuUZYtWSZYuF}S&Ce[^_]UWVS u} EX9G(r <҃<D 9G,s WVXZE<)G,G E}t@E@@}t UfBMfAE@t*E}t@@}t UfBMfAGE}uEC(S,]}CtS E@H6E؋EH1ۀ}tX ]1RPSQӉl1Ӏ}tURju1RPu輥tE@QPh! EEE1ۀ}t EP @SQRPV]C QRE@E؉U܋E@ EvSQuukSQuuk EԋUBjuhu<uWV>h<uWV/(h=uWVh=uWVW  t%<<ۃӉ_މw4.<҃W,}tWWJEtfPfPe[^_]UWVS] t@ U f P8jǃ jDr Ɖ<WV FZYuWh]!1=@Z,P E fF8FF<S^X1e[^_]UWVS5j,1ۅtb~ uTF%}uu@u<~G!u~$t*O( O,tVu u( Wu u C v(뚉؍e[^_]UWVSuE UEU j,j,IutFPt `dV诗Z1;]E|h9]!hO!hh\!,YPh EU t1RPP¹x @ Ue[^_]0UWVSu {;{tp‰1 t1t)FpVt)FH?W2G"GG$Gw4WXGGjW褠 hC]!E7Ys> S> dždž4XZtRPV" tRPV dž u h_]!j H e[^_]UWVSP]E PSjVS'jVSV tBBtfBfB:AEy$utCHSLC419| QVS: uVSVShNJ:uS1e[^_]t@P@0UWVS}w0GEE P]芎]ttMRPY[M]C S$ tȋ]CE @}ttȋUBDtȋUB~VE@H}tFFEO(_,}tFh1RPSQUӀ}tF|1Ӏ}tURju1RPutPw(h! EE@ EG(W,]t1SQRP.~NhvSQRPqkSQRP`k EU ] K}tPH P U R}tPPE@4uP:XEuOGE / EP]芎]ttMRP Y[M]C(S, tȋUBE@UttȋUB@ tȋUBG@WDE tiEPރ]ttMRP脸Y[MA0Q4 tȉA E@}t tȉAH tȉA$EtEuG0OG suG0Oge[^_]UWVSu]tVhXuVhp]!jU`DžPhd@u 5 usRhedAu ƃ u'8tuh]!_X$B<CB(CB,C B0CB4CJ8KCB@C BBC$BDC({hӈ$ƹ ߋSh]!Vy9CPh]!Vk; C Ph]!VY;CPh]!VJ;CPh]!V;;$tP1^}=uhzd@u  @RhedAu  @uuh]!j41}󫍅Pu跜ZY@4ȋ9 9t8Ћ}LJLJ(Eǀǀ [Eƀ*P^j PEP"1e[^_]UWVS,}jhPjWtGjPjVWVu$U ʋMQ؍e[^_]UE ǀoǀo1]Ê u@ t utUWVSSÉ։WhV9] tX1҉jhg"PE Muʊt< tA1҉ES#$SUR ue[^_]UWVSSÉ׉WhS\ t?1҉7< u<#tSl#Y9t3PH u ttEVh#&\XZE1e[^_]UWVS0Ea!UMúh(!P0XZuRha!VhW[ uRh!b!z[V9PPPPPPhab!W(2 u Džthsb![VD[^tNb!URt VYP!ZvjWhb!ƅM oPi+ YuVZ #E o1ҋЉt B߸)Љ1Ɂ11€tjhhb!YVGGG GGPhW,"V  Hu GGV+XE ;ot$PWh/c!6Y ؍e[^_]UWVS 1} h(!u-ZYuuhwc!X_X\ڸNq!^t uhc!c!WVPh$Sc/tWVh$SN/t hd!} G1} Ƅa2=u.\&Yu\E ao1ɋ?u61ҍjhg"P tj2WS2 9u[E ]hhTd!PE ƀar!;tWuhYd!EW 1ɋu׍PShd!V-uSZ;v1Phhd!VE aPWhd!V?AE ƀa} a9tRPShd!VE ƀaZlq!KXu E Juh5e!6VhV uVShe!&V pc!j2PWMC2 E 9~1ɋVtShbe!Yxq!_E ZtC@fVhP uVSh4f!U j2PWC2 E 9X~$1ɋtShe!2RYڸq!^t uhf!1ɋgthf!xE ]PPPPhg!S+M \\\\\]t hg!{T[jE ]`^!tH8tp u Pà nYy}Rh1g!TXZÉ؍e[^_]UWVS]CjP( ^_1uh@^!hLg!ȽY[ F9~?{jW~( YZu Vh@^!hig!:19~DBh(!u I(XZuu h@^!hg!R zg!WW5_t uƄshg!hPJ#shg!hP1# %R$RW  …uƋ{{9VhQR u WRhh!CPPPPh$Q)BtWRhMh!R ; ȋC AEV [6V X19s~4* FY* ZDže[^_]USRÍEPjhjjj jSU tShli!Rj]UStPh|i!h0,%Shi!h0,%Shi!h0,%$Shi!h0,|%Shj!h0,l%Sh2j!h0,\%$ShSj!h0,I%Shtj!h0,9%Shj!h0,)%$Shj!h0,%Shj!h0,%Shj!h0,$$Shk!h0,$Sh.k!h0,$ShEk!h0,$$Sh\k!h0,$Sh}k!h0,$Shk!h0,$$Shk!h0,}$Shk!h0,m$Shk!h0,]$$Shl!h0,J$jUSRhP u Sh#jZ]Uuu u@  @uuhl!jZUWVS(`؟ԟh0l!Rh*rPEܟП119П~7̟hW؟  ̟u ԟ0F`ܟv1ܟܟ9}J̟hW؟  ̟u ПԟEܟF`벅u؟hCl!je[^_]UWVSÉ֍hPdb1l󫋅dhx|hol!lPhrS*Vhl!c|xhl!A0tplhl!"ll!thl!RPhm!h+m!DRPhYm!0Phm!XZhl!4ull!Phm!84a!hm!kv,G$=v,uuu V`ǃfO=tk,WTNjEWVPhX!h, {tk,twVPh܁!h,1Uuu Vh!h0,5EaVPh!h0,ECVPh6!U e[^_]UWVS=pk,th,hQ!,^_1;5Hk,Lk,sxWVY[uۀxtVTk, s؋X tf{u0=tk,tS"Phk!h,SYSXZ[5v,t[^ tO{uDf{t h!SUY_=tk,tSPhk!h,S?YS/XZ[뭋v$롍e[^_]UWVS=pk,th,h!^_v,1v,t#{ t{$C$SCXSFY[مuȋv,th‚!SGU[$XZe[^_]UWVSPpk,=`k,Rut6h,hۂ!芠#th,h!u^_5\k,uY[jjQƉס\k,EXZHk,9o,o,Lk,WVNQƉXZo,o,9ƉsIWVYXuWVh!]S SMPh#!h0,fcWVPƉ׃9u9tRPWVh:!h0,CRWVOXZu h[!RYCu hq!SSXZCt S`WfcXSPCfcY[\k,;EPusCe[^_]UWVS=pk,th,h!Y[fo,j,.C jjPEUHk,Lk,RP3PEU5o,5o,OƉXZuuOEUuuOEUE9EEEZE;o,Eo,sffo,j+Bq [E;o,Eo,rj9\k,u1B95o,o,rBB1 \k,S9u\k,9(o,o,9։sQWV|XYuUh!QXURUPh#!h0,UfbWVNƉ׃9uM11 WVXYuUh!PYURUPAUfbXZ9\k,t ]A_WVde[^_]UWVSjjY[t<Ã=pk,th,h!՜XZCtS(PrMfc_X[u=pk,th,h!蛜[^1;5Hk,Lk,WV+ZYuыXtCtNPPV xu SjSzjPPOfc[룍e[^_]UWVS=pk,th,h!כXZ1;5Hk,Lk,sJWVkYXt3fCƒfS{ufCf{t hՃ!S PXZ[Ƀ릍e[^_]UVS]S^uSh!h0,~ 1Ouu Y[19Åt 9t@uu h!wN ~u}t h!V{OXZ؍e[^]UWVƉjhRPq{,t9xu9pte^_]UPh.!cZY8u"hR!h!5(k,h!h0,jLz,t#UPju uHt @R+UVS@fCv,=~Ev,)fv,5z,jhhv,膺Ht @V+-v,5v,CPSv,Pِ5v,Cv, e[^]USjjj0+CC]UWVSƉӉ9tR)yShÄ!h0, j%RP6^thF P6误F e[^_]UWVS=xk,uu 9uEfftfB1ƒ=,tf‰jEPWٸWiYf= E19]  }ߋ,tȉGffG=,t?tuGGG%)Wu9rG9=pk,th,h!XZGt=pk,th,h!ŗYXGW9s=pk,t+PRh!h,=pk,th,j &XZӃ?!e[^_]UVSjh@V+Y[1ۃt%h  Zu VϮX 0@؍e[^]UWVSX=pk,th,h=!Y[5FXe[^_]áo, o,uU塤o,%=@u6o, o,u]UWVSu^ ~u:hS6F #=tk,h0,hN!R[^F;F| FSft)9~=tk,tnRhg!h0,= YF;uChW%PZYt:;=Hk,Lk,r'=tk,4Wh!h0, 1ۉ؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃjShP$hV2V^NjP ѡz,5z,_ƃt$@h@%PZYu5z,7YSh!h0, t$Fh!PžYZu5z,ZShՆ!h0, z,Ƅ=FVvhPSh!h0,c:hPS赟1RPSmH z,p5z,Mơz,8Xae[^_]UWVSuS_X8/u @1Ҿ1hW%PXZۋtm;thgu1WP ѡz,S^5z,Yt@9uVSBP uȋ2lЍe[^_]UVSuIAY1ۉ tÅtnƋS 4؍e[^]US]3KX]]n UWVST=pk,th,h!o[^`k,hhu觡ƃ yBuh|!h0,h0,訲0+ Ph!h0, 1S ѡz,z,0aNj[Yځ~RQWР @u55o,5o,5o,h!h0,D#0 Phو!J=dk,uURQV8 @uG5o,5o,5o,h!h0,0: Ph!h0,$j|%W:V4XZe[^_]UEU ]U=@R+#tjjh@R+Τh@R+t =@V+#tjjh@V+誤h@V+P UWVSƉ׉ˉ t;5Hk,Lk,rWVh!G< ,RPWVkĐ,s{ S$=tk,t [$t9{ u9suh!S=XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh !P<XZUWVu} 1 tC;5Hk,Lk,s.,RPWV賒Đ,t;x u;pt@$e^_]UWVu} t;5Hk,Lk,rWVh-!*; ,RPWVNĐ,t&H$9x u9pu@@ P$WVhJ!: e^_]UWVSujj[_Åt>NJ/t tF@PW35ZYt [u1 Ft[ 밉؍e[^_]UVSSj/PZ^Zu1,SeY/txtEShd!:XZEe[^]UVSu,F,9v%)P6S}jj$9tC/vKSh{!9XZ؍e[^]UWVS}u h!9[uYƉ<,uE50k, Zu h!d9X)0k, ,9w ,,,uS؍e[^_]UWVSu=,uF50k,J Xu h!8X0k,Lء,19w C$؃(t,,C$, 1ECCDžuPE  EujjY_t Vhى!l8XZVV_C[ٸ1Xj/VO^Z@PPC{G C_ Y^Et5uu RZYƅu h!7_E UCS FC^1E E t)uu ZYt h !7XًE U6؍e[^_]US]SZ,,]UWVS]f{t h!S~8Y^{u&{t h1!Se8XZ{ t hN!SR8^_s{ t]WVkZYuhj!S,8Y^49uWVKXZt-x"t‹@9uCB h{!S7XZ3,C$,e[^_]UWVS]} >ƅu h!S7XZ9stsF C^ j/WuZYx3WƉWC$q8VPfCu fCe[^_]UWVSd=pk,th,h!艂_Xdk,E2h=!uY^u,v0 Ph!h0,{uh!5fc EEE9Hk,Lk,ErFuu^Zƅt)GE~SFPj6sv}ӃEU1EEE9Hk,Lk,EuuGZYDžttj$GPEPxuGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP踡눃EUUĐ,Mt@ESjjEP耡E ,;M̋E E̡Hk,Lk,EUMԉuС@k,Dk,E؉Uܡ8k,3Yjjjh@%fHjjW|ƃ y*0 Ph!h0,WhR!2xPVL[Zy*|0 Pht!h0,Wh~!2EЍXjS LZYu h!2YSLV蚕 y,0| Phو!h0,Whȋ!F2j(PPVX xVk`k,Z!h0,h(!h $_,k,u(0, Ph $h>!h0,jl,Sh,XZe[^]US o,$o,EU]SPhh!h,w(o, ,o,UM ѸR!tSeZPhy!h,B n,=n,u]!hn,PhXn,5Tn,h!h0, hDn,h>#h0,$= k, o,$o,EUSPhg!5 k,(o, ,o,UMR! tSYPhx!5 k, n,=n,u]!hn,PhXn,5Tn,h!5 k,ShDn,h!5 k,>$5 k,h!uXZ k,@ @t hю!jz]UWVS} u=pk,tWhQ!h, EE];9ru4=tk,-";]t!Phh!h, {CPCPhd!hR4=pk,t R3C4LZ+hv!h,'t}t?SHK))PDPPCPW>!uSHK))PDPPCPu%!<SHK))PDPPCPW讷!贙@:{Nh!P-ZYt h!PZYtJt%uCDPjWB D!?CDPuZY)!CDPjW 4!@{atNt)CDPjW D!?CDPuDZY)!CDPjW  4!@t=tk,t/Rh!h,  =pk,th,h!rYX=pk,th,j XZe[^_]áXZ+x=,t0UP XUWVS }uԕ,,=,t1}t hӏ!%Y=\k,%1Dž1fܕ,,tj`k,t#=pk,tPRUh!h,U ,]Ӆh0,h!ko,ZYftCftfHth0,hג! h0,h!Rk[_85o,h!h0,n 5o,5o,h!h0,N=lk,uh!YujXk, 1=,=,t1jS*_Zy>߽0B Ph.!h0,jjؙRS5XZ+$Bu@t…]=pk,th,hG!jjZY=,u&\k,@\k,,PXNtXk, PSh! hh,,Sa ,h5,V`ܕ,ؕ, e[^_]UWVSÃ=xk,FC=TtP=ltIʁlt=Tt1$=,u$=pk,th,h`!\i^_,pt=,3ȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRPK_ZChs,s(KY^C(S,C0ȉC0C4ȉC4C8ȉC8C<ȉC=tk,t5ܕ,5o,hX!h,聼5o,h!XZ=k,t k,V,!o,t19@l,~ҍCe[^_]Ufo,hhh ák,ttUk,tt]UWVSx]o,fo,o,o,EU o,M5o,=o,u}5o,u=o,}=o,} }tEUMEEEEo,Eċ=o,wEuo,Eo,Eo,Eo,EE%=`w= =@tp===t+=uSh!h0,賺=pk,tSh!h,荺 jX=R+t SYt@tShҕ! XZ̓=pk,tSh!h,> 5o,5o,Sƃ ,|,|h:hh@ =|,u%=pk,Sh!h,Ĺ =k,tSXjSh, ƃ pE Et EPS(YXEPS(uuSruSr~jW|Sj9= k,tuuuuh&SuSrXZ=pk,tSh&!h, 5dk,W=k,tSXE%`|o,RP| PSby聫0 PSh?!uuSwsuSsuN,hhh jWVSj1 E Et EPS2'Y^EPS&'XZ= k,"%|`te6"uuuuP=pk,tShc!h,ͷ 5dk,2=k,tSXhSpZYyz0 PSht! uuSpruSruG,hhhjWVSj* E Et EPS+&Y^EPS&XZ= k,tuuuuhTd!SuSr_X=pk,tSh!h,ö =k,tS^5dk,uFhhS/m, y*i0̿ PSh!h0,mMA=hk,th ,,PYuu5,qpu5,phhh ~jWVS5,=hk,u=dk,tNEPh ,,P S.ƃ tVURP,0h!h,蛵vӋE EtEP5,uoXZEP5,do^_= k,tuuuuhq Su5,oZY5,lX1e[^_]UVS Ek,EEEfo,=k,t=k,Tt h ![h!!Y=,uh,"Z4,EP ËEXE8t185o,h!Y^Uv"6E-EF@l,9ӋU9uuk,0HtW5o,h̖!MXZ݃=k,u:@l, EEUPE0W M]ËUEЉEY^BHk,Lk, uEHk,Lk,$M u9t5o,h!XZ,e[^]US|=pk,th,h!S[X=,tjjh, #=,t XZ+Ejjh,iXZ+ =XZ+y&ޥ0A Ph,h&h0,޲\k,LXk,B,, |k, ,9~ D@, =,t RQZYRQ5XZ+h ;0螻 Ph!Yt!hh3!PhX!h0,$jǨ Xk,,=pk,tPhx!h, k,uF , ܕ, ؕ,xk,k,uh0,h!vh0,h!mQ[X=,tB=xk,%Sk,,11,=uI)У,=pk,u =`k,tu(o,,o,@k,Dk, o,$o,8k,hܥ!h,^Y[1ۍ>1ʍuEfEEE'E0VhQ`5`,| @u h!jgE<u 5@,h!<u5@,h!h0,$ ~<tP5@,h#!h0,_Pu󥀽_y-`9!CShD!h,|] j RZ<hL!ÒXe[^_]UWVSEu h Zu h~!jfù1󪍕 1;}T jQh!{ u jQh!{ uGu;}O{ ƅtIjWh!({ u'jWh!{ uWƅ7fDžjh0uhSj P5`, ƅ{9t h!V҉YX$t h!VVXZt/th!PVYXh!PVXZh!VVYXu h!VVXZV5P,5L,5H,5@,h!聐Ct4tMuhf{fh3!VYXaBf{fhP!VۈXZ f{fh!V蹈YX{u hʧ!IZQWhSm!ӏVh#ȏs<V҃X9u]e[^_] e[^_]UVS ] }tM3hĮ"V%@ZYth}$V@ZYu E'j EPV*E U:uy 3hѧ!TshĮ"V?ZYth}$V?ZYu E-j EPV*E U:uysh!jbEPhU5`,w t h!jbe[^]UVS ] }tZ3hĮ"V2?ZYth}$V!?ZYu E'j EPV)E U:uy 3hѧ!TshĮ"V>ZYth}$V>ZYu E-j EPV)E U:uysh!jaEPhU5`,v t h!jae[^]UP}nE 0EEPhQ5`,vt h!jaU}t*jhQ 5`,Mv t h!jiaU}tjhU 5`,v t h$!j4aUWVS$EEԋ] h0 E^u h1!j`U1E1;}}3VhO!]=ZYuE]VhV!F=ZYuEFVh}$/=ZYuE/jEPVQ U:u=v3h`!jK`EG|EEjh0uhuj EP5`,TET=vhP5@,h{!ۋE1;ut^FE \ˉɉʉMЉىf1 ω} EЉEuu5@,h!m띋EEe[^_]Ӓ UWVSEEu EBU܉EPx XۋUu h!j_1ߋMEfEfS1j EP6ճ U:t6h̨!j^TTdDG9}ujh0uuSjEP5`,]e[^_] USUBBPJ R Ph!> uE!]Sh!XZ]UWVSE}EEU@!stE8uE8Ct;uڀ}@tSVh!WQs!tSh!WQ] WVQ0u e[^_]UWVS@EU u}JvEXuW4@!Vt +uP @ W"Xu1MP @ j@MQ4@!h[%WV豇xPw,f@Ph!vу@f@t*@!u3!RPSh>!WV!J@!u3!PRh]!WV$f@Pht!WV J1e[^_]UWVS]hpVjS`Ph!CtTh!ՇY {yj hĪ!轇XZ,C@tPh٪!襇Y_,C t Ph!荇XZCȅt Ph !wY_{w j 艆MCȅtPPh!N S C h#Vh8!,C t PhK!XZhpPjSmƃt Ph`!_Xj Y}i;} }0<;t'Vhs!赆XZujh!袆YXGtVh!臆XZ>);U }Q~MuRlh!WZY1ɋlhlPh#2hAlBXXh!xXe[^_]UWVS] }uh!^X1C9~D3Phȫ!؅FZYj X}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`u_n @u h!j|YEtU@,<uRh! <uRh!h0, #<u jSRPRh!h0,ja~e[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUMEEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuXe[^_]UWVSUE]0{u@tK uugtƊ{_v3m tO\0Z0Z0Z\um tf\\M tB@9u[^_]UPh@!h0,j|Uh~!zUWVSÉ֡,P,uhh,XZ,h!h!hWxh=!W Y_u.h!Ph!j] 6,-" u!h,RPh!41X9ډ}Dh,*q $h! ,tPjh,GEg;9}4ڃ<8" u-"P<ؙPh!褄 t h7! hY!I$XZxh,_u=hjLXZjGaYM $/a$jL[^e[^_]Ujh,mU=,u hy!XjzUShy!hj2Lhj&LhjLhjL$hhhy!:: xVj"h!P8h,oj PS8jh|L$S8(h,u$h,Sf8S:]UPh!h0,'jyUWVSQU ,8ƍ@Dz@u1ҍBuHEt9v ,DZ@tH@X[^_]ÅttUVSËHu^s8tWS8kC4`9s `R7 C0C4C8Z{XuCXCXtP XCXe[^]UVSu] EPu36}x9s)e[^]UWVShEUUP 1;]؃Eu*E|fE|Sh@!j uV}EEPhɫ!j EP}kEUfTE ȃ ,DJu.}D=uuVP ^C]} t EPYuhE!h~XZe[^_]UWVSSE11sAEtSWhR!PTSh"PC @u h\!hY!5W} }YCu}u#h-"EZuh\!h^!jREe[^_]U>hc!Phw!Ph!Ph!Ph!Ph!Ph!h0,X8jvUPh|!5[+58, t5<,Ph!5[+E Pu5[+,, USÅtPrtw<t.`, 4,tar0 Ph,h!O@`, 4,tjr0͈ Ph,h&!u=8,ujv]UWVSEEEEujj}WjVP#'@u(e[^_]ËEƒUt Ph4!j`PPt{ ZtjjWPVu&@u ]=P,u5[+uha${ ms-"M9Mv"VvvPhR!{E ]B"j zX]e[^_] UWVSEE]ujjEPjVS1&@u6uz XtjjEPWVS%@t̃=P,uuh|!{[^GEv9t'v vvv vvvh_!z ՋE썟 kT؋U19th,hu!&ZYeTF;utESjhd!z :19KvۋTMM4Ph!\zMA ,j hyX}e[^_]鴁 e[^_]UWVSNj]E E=L,΃=P,u=H,z)}x=H,tEh,jSV =Y}u5[+Rha$y }u Rh|!yXZ@,EH~}tj xYډe[^_],ƒttt4U׉}tu+U r2s4RhYf&2U׉}Ut RSh!` sRh_#RhW,"xXZKU׉}tuuSh!x$M] s SQh #SQh^=#x }uE!e[^_]xE e[^_]w}e[^_]Ã=L,t,,URh,4[+h!UWVS=D,uh!jqj=PX:Y^Xd 1Dž\ Dž`hj`Ph,\PVS""@u!ڋ\==8,jqDž`1Dž\YdX@DŽdj`R`PPQV!@u!l02 Ph,h!Buh,h !iXZ&L, P,uPh,h&v e[^_]UWVSEEE} 5L,,˃=P,u=H, * =H,tDh,juS9u5[+Rha$5v u Rh|! vXZ@,~tj )uXU؍e[^_]uHE1 r;@=@,t3Phɫ!uYX3t/=@,u Ph$!uXZF;u|Suhd!u OuE!e[^_]|uE e[^_]tOe[^_]US]=8,t Eh,!S%ZYuEE[jjEPSdGEUE 9u%Suh6!\ =8,j=n8umj8u̸]1PSEPMQuu\@Mu1\t =L,1H, @,u}u}tPjUEPj ,!UElYXtFH, @,u}u}tjjMUEjj ,!UE"XZ]UWVS]=8,t \EEEijjEPEPuu=@uuhU!ljVSkWV u%Suhg! =8,zjljVuV|WVh8u|1PSEPxPuu@u1 t =L,|t1pH, @,tpjxUE-Y^FxURV9EPVh!jdMQppPMUEd$tlH, @,tjj|UEXZFURt8EPth!jdMQhpjPMUE$e[^_]UWVS([+8,t f,/,,SV3ZYuVh,@7e[^_]É)@E̍EӉljDPh,7hW%h,7uUWVS`Eh,hfZE!1]U9>w2jPRUm Utj@uVRPmV3h!WGjEPjh,RU! UuE Eu1}u+E9Eu#1tj@uVRPlV3h!j]DGSEEe[^_]UWVSVUu=L,ˋ H, @,u'`, 4,h,h!jY[=P,u %tDh,jSu2u5[+Pha$o u Ph|!{oXZ=@,~tj nXڋEe[^_] 1vs9}E8Phɫ!-oGYXt Vh!oXZE e[^_]%nN@e[^_]US]EjjEPURuu@u f}t Sh!jB@, H,tUjYY2=P,u Sh|!snXZuuuuuh!Xn]UWVS]uEEE U$U`, 4,=T,H@, H,t}jjEPjuV@tdMt]QM,m XtMMMjjEPWuV@tM;Mt W u _j,aY}e[^_]t }tuh,hB! = t)tu*Sh! uSh!Shi!Sh!XZe[^_]UVS]E jjEPuVuu@u} t Sh!j@EUEU @, H,tj tXP P,u EPu[P5[+ShI&}l&IuRPh#il uRPh !Ule[^]US ]EjjEPURuu@u}t Sh!j @@, H,tUjC=P,u5[+Sha$k =P, h uu t PXuuh!k ]UWVS(EE̋}uu@=`,t7EjjEPEPh !E@Ek(EEE(URU_j XۋUuxU1}H(jjURPVW@uU1H(M);Mtuh!j>uߋuE 1C(9~؋0x3{px s{ pxs{pxs{p x$s {$A(뼃}t EHPh[+uh(!juVh@, H,t7j(Y(}tEЋE;E@t]e[^_]7q =P,u Vh|!iXZw$w wwwww ww7h/!}i,똍e[^_]UWVS]EhEpEl}󥃽puBDžtjjtP|Ph !y|tDž|DžttW%h XuCxjjxPVphc@uht9xt Sh!jw<l%EpujjڍE _X=`,t=19|Wh[+Sh(!jURf jjUEG ŋ=@, =H,t jL=P,u4Sh|!gY[%t h]B"gZt4Who!gG9|j fXue[^_]n e[^_]ÍL$qUSQ A IEjjURURQP@u }t Sh!j#;@, H,tUjYd=P,u Sh|!fXZEE1҉E܉Um\$E1҉E܉Um\$E1҉E܉Um$hy!feY[]aUWVS@u]=8,t Dž StXuhl!h#jh:1hT]%R,Y_t}[jPSǃ t 9u [8"uSh!8uv Sh!j9 hT]%jv 1PSPWuu.@u11t =L,1҅¡H, @,tR Z4PkZ$PE7W_l tTH, @,tj X0NPZ$PىESl e[^_]UWVStx|h,Yp,$`,YYl`,+l+p`,u,u|uF1;xt苅t@%u-"RPh%PP1C} t~|P[+xw-"RPha$PP|P@%xw-"RPh%PP Dž|\+|\+Ã=T,=P,th`,h|!bXZh`,h,h!b EPjr#wD!Ph!b_X}uC|@0|?hsPh!zbY^P|p4h!bb |p@h!Lb|0,XZpu hh-"h,Whh!0pt -"6hh-"h,%hh!h,T]%ƀt2hWh,hh!h,T]%s2hWh,hh!h,T]% s2hWh,{hh!h,gT]% s2hWh,Chh!h,/T]% s2hWh, hh"!h,T]% s2hWh,hh,!h,T]% s2hWh,hh!h,T]%s2hWh,chh0!h,OT]%s2hWh,+hh:!h,T]%s2hWh,hh%h,T]%t7VhPE"j V4^hWh,hVh,(h,|h%PhA!<_|@H t PhR!!__X|p(h\! _j &^ }N=X,=`,u }y|xXDž1DžtxThj`SPPWt! @hu\t|@9uߋ|@(9uΉdQhZ] ^dtNjh󤋅|@XPwPEe Y|XX=`,uE t|@XhHw9=P,uh,h|!]XZ|@XPvhe!PĹX}|hs E UEÃ}tm@uj--i Ph,hv!jrVs u|xtjh`,h,Ћlƀ`,pƀ, |x@u^jjPjxtO@u<`, 4,=T,h,h!|@@EH|$@!|xt|@8d uq=X,;t.s j|xtjh`,h,S `, 4,=T,h,h![tx`=X,X|@4h`Z _jjPRhx@Pt@hu!Rfb ^KP8 ]똋|u R:b YЉ\|@4XDžhh9Xtkh`|X89\vV9Ct FHt F9C(u:Nu*PQTY ZPtރ NjTCXhw4,d1|9p4<C`s`, 4,t%xWuujPًt$F`jjPQxtD@jj+jjPQxt@YjjDžjjVSxt@uIN8 u30X XjjVSxt@u jٺ,|^_9S_ [DžjjPQxt@tejj,|ulW Yuh,h!5[+Z KjjPSxt@u jڸ,S)_ XZlƀ`,pƀ,e[^_]UWVSÉLH4,j=PY^ƅPt9sx?u @ƅPGh"S_^Z°.t[+[+8 8C tG=sjhh#VU@ T C<=t:[+  4=D,u h! 41Dž8Džh DžtDžpƅYDžDžj,VY[DžtGDžLDžPDžHDž<1ۅ\j=W>[ZÅu Džl@llh<"W}ZYDtj,SZYDt @Dh%%W@ZYLKjlPSA~5 WC <=t:[+D  ؉T=D,uh!jE 1Dž| DžxhjxSh,|PVT@uT|U}1E|H}DŽDžx`j`RSRPV@u@0V PTh!vL, P,u+EHjr#wD!Rh,h!J 0,jh!V3 uWC <=t :[+uC j=RT} ZYDžTtЍe[^_]1=X,Sh!_X1=0,t T\+0,TDž\\+Dž` Dždh\PdPh,`PPR@uPڋ`.\uKt X,HLjS`t X,,=8,t =D,u h!C5HLƅtX@uj-T Ph,h=!jBv S\`RWh`,h,, wCk`D\$!HLjj\`=8,t Džƅ[ƅZ=jPW: Bu@uh=8"u ^=0V9t8t WhT!t_Hwj"iS PWh& DžN ZDž[ZDžU11PVPRDPy@u$Pu 1xD<8utRt+jj,%jj?jj[,jjZjjM,jj,W\;^@TC@t9TvWhf!MY[PE Zuh,h!*j?TWPVDPI@u%Pu 1H ;8uVL Xqj񺠲,jT,tVL :HLjjًDxH_=e[^_]UE u@ t]US1]  t=U}tuZv!Zw t Yw 9u@뻃[]US]y̵,̵,,j`48X=,t=,t 诵jS=Uu u0G ZYujh$ "rjvUVSuVC9$@PVP|<؍e[^]U,E]UVSh "T^tu5h,8tjtSv4ZYuFp6j jRSsFS8$P1FShg$Ph,5h,F h "uV;SVV_Te[^]USBtP6=,uStZ]UVSÉu=,u VS蠇ZYe[^]UWVS׉΋]Uu E E!UuU$t-"[^_]USt01!1=,uSkZ]U=,thj5, hj5,{ UWVSÉ֊;uuY,MtI,hM\5,Sz=,,hM\5,Vz9=,؍e[^_]UWVS,E9,^$,]S5$,Y^=,u, ,SZ=X=&wAKw2iff4[nRff4D=,w$==!ff4=Xff4=KwJ=w$==` ff4 =%ff4 ===ff4wff4lff4aff4Vff4Kff4@ff4 5ff4 *ff4 ff4ff4 ff4Eۣ(,Eݣ ,Eܣ,eẼEfEEE, 5$,Sj5$,=E,e[^_]USEPhht@j' 1ۅu E]u+h " PZtP,Y<$~,=, ,t,Eh "OZtP詴,X"L~,=, ,P]UPUE@, 1~}BUw$!1(udf@, T"" F """"ݸ"ָ"ϸ"uf@,@,UShe%N[u~i&,PP~ZYHt , "t ,B脶l!0,#",,&",X&, !,8 x, ,,, ,,,,,,~ |,Dž@,1$td4b"tк, к,-"%"`t̺, ̺,-"=,t>=,u5)")Ⱥ,u&ĺ,=Ⱥ,u ĺ,Ⱥ,-"=ĺ,u ĺ,-"#,t8u,,-"#o&,=,tt8u,,-","`,t8u,,|L$,".,t8u,-", ,Ph-"h-"h,,_$/"P5,5,h,,A&! P5,5,h,,$^+$P5,5,hܺ,,$)"z "*uRFWZPÃ$!%VF%  V?F % ~? VvF% ~? ~  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=@,tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE ]U:=@,u~ 9sQGK9vGGO@~P^49w'WyY 9vG%OtW[Z1M9e[^_]U幈 k+E]bU]+E]LUE=@,t],]US]uh"h`,zY[wDS@Zt9؃@P0Yu@Sh"S5,j h`,'SYZt S5,؅x>v>v1v$v ƀ`,u`,5J)`,Htڃ?ʀ`,`,`,]U\+E]UU 1}DuЃ=%" ]UWVSE֋}] IuREPY^+RiEVYZutVx $W8hW"Vh$WP؍e[^_]UVSƉh`"q-Yud PUZtV19~z u2RAF tPhm"S6 e[^]Ut tm!Rhؼ,"2 Rhؼ,M2ZYUWVSÉ׋0V$jS‹ )jWe[^_]UWVSSÉ׉΋Eh ,jS‹M)VWe[^_]U,9,~/MU,EPU~SE),ġ, ,,á,= ,UVSEMUEJE } ,w,;,~d, ,E1ۋM,+,9} ,v1ɍUE]́ , ,,E E1E,E),EPU~g1[^]1US{,8t^EUE:U,;,}?U,PAE,Z뼉EUE}U,PX,8u9,v]US, ,tPt,)Êt@r+,)м,t1=, ,u 1= ,[]UVS, ,E1ۋE,+,9~.t*UE ]ЉEUE }EEE8uދE- ,,,EPEw[^]á,8USEUEËU,,9|2H9u ,xuE,E,S蒊X,8t!UEU}PpE,1]1á,8tUSR1]1UVSÉh , Z0 , ,v 79w0H,09s CCAr+Q1e[^]UVSP Yuu>t,SjEP_U)U tىEPE1e[^]À= ,t8U,,r+,м,]ø, , ,,,,ļ,r+,,ļ,r+UWVS]S ^؉E1;tw]ujEPRƃ 9]vCCPÇY=@,u,,3VZu(VWY_uVZ,,넍e[^_]UVSPE ,h , Z ,1ۋE8tVjEPC ؍e[^]UEԼ,U м,t@]UWVSu} ?tB^9tWs ZYt'jjWC 3FCF^ Fe[^_]áԼ,tUh ,PԼ,@XZUWVS}=@,uȼ,ļ,uW,ȼ,ǀuļ,%=uf%=tXW_ļ,^1<%uH ,A,ȼ,19hȼ,[u-ļ,<ļ,#A5ļ,ļ,,t , uuȼ,e[^_]Լ,t1r+PW'EZYHH>$!}e<(,,/,,t},8 h,,= ,vx ux ,= ,w,,K,pt,,8\,F,,.Ã{,,,= ,v6x u0,= ,x M߀x <,= ,w,f,,8 u,8 td,Vs,@,Լ,=r+y,- ,r+r r+v} t9U~ QMWh ,1 MUuɉrCWh ,\ , ,^_,8 =,t },tP ,YC0EPZE,u , , ,uH׀? u G9wr+Er+E1E ,9v~ub}t6E9v-U؉MuuV- M܋UuEt1}t8EE18Et < u~ 1EF눅ω=,,tP Xj,)@P4,,)RWP,Mr+8tWwV/XuV4,YW4,W^ XZ,M,}t6,Phؼ,z$1ҋE,^_,E,,9,v,u),,#tk,Z u5,6YtA,= ,v r+8Huhr"bZuW%,`؍e[^_]UWVSQMEE ,EEEX8OЀ w%k} e׉u}]ʋ}]8.uEPjEPvz}܉ EUeY[^_]ø ,áԼ,t @@@ UWVS|aƍxPVey[_%=h(!VVR ShVE; jh"V  1u{ShV; tht t u@h"VZYt/h"V ZYt%"utPWZY듿r+댿q+SXe[^_]1=r+ q+UVS|*ƅh=!PVH fSft|RP ^Zx,E%=ufSfthPZYh"h"S5h"h"S%ڸr+!h"h"S $ڸq+SXe[^]UX, s \,7t \, \,Y,t h"XY,t h"XY,t h"sXX,t h"_XY,t h"KXX, sh"thW%hm!#Xj5l!ZYUWVS<,ƃ@࿉ÿ"u %\,/WX=8,tW_t h"^t uh+$hb6!YjjrXZe[^_]UVS։ˣ\,vFViuSA e[^]UWVSQEc ơX,ǁt#tf&&ur%X,Su5X,AáX,ƒX, t;x- st j%j&Ztjh"l}XZtVg&VYe[^_]U莎]GzUS`á\,#1 te tR |/$%9Z7QX,X,PSP,؋]<+u C< uȵ,tPr X;uȵ,Sȵ,X5<,S5@,5D,lrD,5P,jCP5P,jPCP=,S]%X]];!t`,tP XS7*`,Y=,uJ`,uh"h-"|^XZ.h"P=,uS(,Pmajh"r{]UVSt/,,u ujjj5,RP= I,t@5,,,,u @%@j@5,,e[^]UWVS&t enY@Ɖׅu‰,,,=,u0t;5,,}Fjjj3 ,,ia8e[^_]Ë\,1!UE}+EPh"yZYUVS= ,t2 ,t(@~t\,tCtEu >$,u e[^]鰡X05$,Px X1 , g e[^]UjjUP$,$, ,XZUVSuVZ\9r PKXe[^]UWVSX,,@,e\,rP,T,D,=,t藖=,tj]i=$, j{0,4,q_u) .t u5,2Yuj9=,t"+.tmu5,2Zt΃=,uG,=d,t"jh"ud,@]t h/"uXt?u j:tXjWWu_X=,eu"xj1ɺ9"Ye=,[e\,t!/t`7$CЃ ".jSZYdhH,XP,T,\,I_=D,uezu\<,ƒu_uK8,s +tt#!u+1D-1@@<,7 =8,D,  t);(, ;$,; ,SYHEa<@,jEPEPoD, SrEEE5=@,u Pw P-Z{EʅuwEEPh." 8,`;(,O;$,C; ,7=D,*SnD,_uSfEEPhF"t <,Ht+5<,h-"CP5D,j5D,fYt5D,fj1ɸ/+ F~~C wv$p!]*t@t%!tIR=,uS=\,7t@.=,u:=\,7t'=\,7t1X,Q t0 t+SZH\,#^ HR R=\,t"SK_H[ ]EEEURPƋEZYtP_ Fc $!P,19T,},1;P,T,|cP,T,=,t54,50,4Y^jP,19T,},1;P,T,|cP,T,$j1;P,T,|P,T,=,u+;P,T,}54,50,94XZjj1;P,T,|P,T,jj1;P,T,|P,T,\=,u+;P,T,}54,50,3_Xjj5P,1;P,T,|P,T,jj5P,1;P,T,|bP,T,=,uq1P,19T,},|=,u54,50,2Y^jj5,*P,19T,},1jj5,*tZM35h1;P,T,|P,T,5T,5P,P,T,y P,d9Ѻ}P,dT,H,n5H,5P,96SP,T,19| +5RP14%=T,yP,T,5,5T,5P,m5eQC|EEPh#"=,uE܅P3t,,,jiZX, X,1;P,T,| P,T, X, , X,1;P,T,|P,T,P,1"F5X,Ѓt'Ѓ 5X,ЃtЃX,1;P,T,|P,T,bP,15X,e),,,,hq "!t=,vj h!r" =,Rue:5,)h"P4 u jh|"z=x,tjh"l^_j d!+$Lbj5,MtjPwO[t jh";P,T,|P,T,5P,Yelet!t ;P,T,"|-"EEPh"'蹓t jh";P,T,|P,T,5P,QZe;P,T,"|-"EEPh"1;P,T,|P,T,5P,g_uLjh"d1;P,T,|P,T,5P,y^u jh"$PYeɐu 5,RPh- 1;P,T,|P,T,5P,OZejh"jj_Xey=,W4%Yu ^P Zt W,?W%4<, <,8,/j1ɺb6! =,j d!+$wej1ɺ0"X_9(,9$,9 , ue w nPP]j1ɺ+"A^e9(,:9$,.9 ," t SQY=,tjh\"hXZj1ɺ7"%u_9(,9$,9 , t u.SP^(,j d!+$% j1ɺ?"NP,19T,},#, ,P,T,,;P, T,} P,=T,+P,,FP,19T,},#, ,P,T,P,,,=\,t ?j1ɺ$SXZW=,td,@6UE=@,t@]UWS]Sj\XY1ɅxЍe[_]UWVSu} }t M W[E}uEE܋EE;EEEujEPEƒ EtEu@9uv;EPU9@%=uՉ%=trEt*$u!EE;EsXPUP2YuBEtRU" ZUt R YREPoXZ}tE)U)ME9 Et 9v{ uK}t)Ee[^_]UWVSÉU΅CEC}9Evv8u&uUP@uBgtLt>B$7tKuxgt3@xu@tyA9uEx@G떃dt fud dZY[^_]USJ ZB[]UWVSEUMj j( E[^]EE9ߊWtL< tC?CP蝱SӉUYtPZU9}J"1 t @C19w)ЉC{y@xunu}~FEE0EEEe[^_]UM Ut,yE EL"]|c]UM Up,yE El"]Oc]UM Ut,]UM Up,]UQMUl,Ht,unEZt8uMUh,s1JuEUWVS5,t uCjP薧ES }xuljUX9}jW% YXu u1YjjjuBu@uSB u XZ*WSu٦EuMș9Uu9t S X;u{Mu {+u{Gt |;t |;WS1_X|;E|;n|;d]l,} th,EPU\S0 S% X]UWVSE9,蚺pƃ=,t1HÃ=,ttVX_H V5,[}u VKquP>DžllPhPSl dDžuW`Ylh"W脗YZu,hh"W^YZuDžhchq "W9YZuDžh>WZpZpPh#Zp dt lSd d u`o Si 9uujmVcXj`,hY_y0SAVppPh#Zp U=,tOuWZuh _t܉ppPh"ZZYYthwXt\5,V$_\\E,dx,l,uh,5,ĵ,\Pdhdui,t=,tP^xP`PZYu(EU,,x|,,ȵ,tPX` 5,U,X=,tC`\5]kS5h!_Xu"=,~ppPh#LXZYS< X1e[^_]UEu E5,PZYEU5,BZtjh"Wjh"UWVSSÉ։M}uSySYNxuSZu,uƸe[^_]UU,]U,jUU,]nU,jUVSu1SYtP6Z9u]e[^]e[^]UWVS}W{WWWt5uu$1҉u1҉tj裝e[^_]UWVSuEPY[11VEP`^ZƅtYVTEPEP 1REP6ZY…t$RUZ ؋Uu5,%XUu Y땅uWY/5,SP^Z9,u Wf[1WSZYe[^_]USÃ=,t>SX]Ã=,u*Uh"ZZt, ,-",á,US1j%RZYtPxsuC؋]UWVS jjd舜ZYEdNyVZXu ]P tN)EH9|=MMMju5WPEW URU׋M Ce[^_]UhF"\Zu UWVS]SK$@PÛ_Xr+8u"CtZ r+8u:KuKCBBCPZ;t*tUQMWS MUuBBCe[^_]UWVSu9EP[E1EtJC8r+t8r+uMUURP@ZYMt}t]EG밃}tEurV+YXjS襚E_Zǃ}tIr+PVr+PhU"SW:1nSPĠY[tuW%}XZFFGuEe[^_]UWVSRh"Ytuƀ8tnWXtaVlj$xT$RUSh\"Vhy%URP SS h(!WdEW? E h(!WdZYe[^_]UWVSh Yu1vƀ8tP[u|$W XZtuhW%VhI&WSSPjP裖$y S Y1PkZV X؍e[^_]UWVS}1ۊtEP݀u9;}v8Gt/8Gt+<%t <#u",,tPZ P-Y^CGjCS蠘XZutQH݀uC;uv8Ft98Ft7<%t ,<#u& ,tQ PSSÃCFe[^_]UWVS]S8^u1jjjS@Bu@thVS% 19sUSjW* =,u+€u!SjW 9sPMYuP螼Z1e[^_]UWVS u`Y=,BPfEEZ8u"PXhh"Xt:u_"RU{Ɖ$qYPckL$QMҖWr+Pr+PURhq"MQVk$W- XUV ZUtRh"PwG Sho"Pw&V u u X9Wd_>uV u Y^u S XZ؍e[^_]UWVS}1ۃ=,u\WcX$SٕWh"SPVTPǃ VPzZYu S. Y1W% V XZ؍e[^_]UWVS=,P,Bjh"Y^'4|uC-uFh"u_ZLH~jh"MY[VtZuiL$QM۔uVMQPWF tufFftjEPWˑ Ht/Vlb_u]KtZEE h"芔^;EPE0E 8h"gZYVbX;u1ۉ؍e[^_]UWVS}E EE=,tPa[h"MY~E"e[^_]JLS,ZEu Ɖ<$UL2$QM胓WuSMQP11V t]e[^_]4ae[^_]USĀuSÍEPSCƒ 1xE%=@|S |]UVS|uX=,u1V[t&VB$P踒VPyh u+\|PVCZYy V0GXG1ۃ=,u,H9~:WVmƉXZut#C;uE|jjuuSE|#=,ux&,WV ?jjWV,HPe[^_]UWVEU EURPƉXYBut1WV*ZYu$=,t WV/YX5,WV f;EE|8u/5,ԘVRPr E E"e^_]:EUEUEPh&":XZe^_]U EP ?J>uuuUWVštjhD"E:^_g(">9ƉRPYY ,uuIQjj +IQRP,HP =9u9t e^_]Te^_]UWVSu} ]WVʘYZu臚 t3@u謗Ɖ׃=,t WVXZ]u} e[^_]'貗UWVSQEE] ZBu@ujh_":贙XZ<Ɖ׃uuE Ez"e[^_]9SuWV59| 5,RP e[^_]UP茎Yt,t ,t,t,UPSYt,t,t,t,UWVSÉϡ@,u"uQ Zփvu,P4_uSڥ[ۃ(,~K1|SRYuSWƥ_ZV0,DP蜎ZYu0,(,DVk_t,(,u V0,DPNZYt݉؍e[^_]UWVS ,UEjP Eju Ã}tTUtT4,}ƉEߋ50,50, EP E4,0,E,ZY1t Su Xe[^_]Uh",Yt8u ,!h"},Zt8u ,"jh}4,jh}0,,U1}](,$,,, ,,,,,,=,t ,UWVS8u} EE=,uWVHEԉUXZ=,tY(,4, p\+MЋ t\+0,‹]!Ct;uЉ|;5h\+=l\+}@@(,$,=,uluVuu3VÃ}VSh#(,4,P]S(,50,1Ӊ(,$,,,Eԡ4,E̋(,=0,5$,uȋE)EE9u|EЋE؍UU̍ M9U9u#؉)ىMЋM;M}7U @1}M }M1M9M}Eȉ19u|Mčt (, $,e[^_]UU1wR5,证ZYUS]1w%SZ1uS5,zZY]UWVS‹5, (,)$,)9~ȉE9~U܉uEE (,]9]-9d4,3=,ustuiE=0,VUE79MEMM EEuD7EEDPYMuyv=@,RUEZ;(,t4,P(EP؞ËE+EEYXuduuuZƅ1=,u=}uZEEEEEU=,HE$:1=$,O;=,~EP蹗EY (,E,9})4,E0,E܉E}U؋U)ʉUMGMt딋U)…~U}}܈@Eދ}y1π}t=(,5$,1^u[»(,4,EU54,jEPE4, Ut9w)أ(,Ѝe[^_]UVSUMPP׮^$,N1ɋ`o+ eơ`o+X;5,~ "uu1ɺ ZYuCu1e[^]UWVSƉ19,~ ,Zt ,)C1[^_]UWVSƉU,(,,9~;$,} 0,D0tUM uu u11ҸX 4,ȉERj}W菘ƃ (, ,9}f; $,}^0,D0uQ4,U)‰(,PjWK0,(,M)$, M뒸1 , ,1=@,أ ,(,4,P裕Nj(,0,Y9u._u$t, ӅI> _u4,UM_uH@t>PZt,+(,4,PVPDà u , ,x 1=$,,,+,Lu+ ,~9|5Hu+)ș);,}s4,)1ɉڸ a|7lj;=,~6Nou u$ڸ Y_t΃=@,tv=,\PnZtA,tu$uu uM1҉UM =@,t|Wt^toW蟖PܪZ$,N1ɋ`o+ jơ`o+Y;5,|u u1ɺ ^_Cu uMډZY1ۅÉ؍e[^_]UWVSEEu },t*5 ,5,1ZYt ,} uX=,uO=,, 5,= ,,,X@,,뺃=@,Mt ,up,E,xWV1҉=^_%=u(%=tQ ,5,=,Y7%uv,C,M,9~1h,,Z5,=,th,芑WV,à Dã,,2M,,Í@,,ۋM ,,; ,}0,;$,}4,(,,)-=@,,e[^_]Ã=,~U,,,]1UWVSW},tt< t5 ,5,1z[^,,,9})54,0,=,uAjm5,YtZYt.(,E" t B@E}t(,,9$,(,|=0,tt =,,u =,u @(,*=,,t!} t DP(,D(,e[^_]UU4,0,@]UEU =,t+=,tu ~'H  0,  4,],,,UWVSQSMQyq uu RP8ZYu]ƒt1ۃt t ,t8,H9UpUt 4,C뮋 4,tteY[^_]UWVSQMQyq 19| RP|ZYu,X4,D&E t(,u}tbP,UUt #@4,ED,M\9Ew HK,)K4,U11҅t 4,ىt ,eY[^_]=,t&,tUSJZ P+JZ HX[]U=,u ,,jh"U#XZáD,xH@dD,USD,@,X9}jh"#D,XZ]ø`, @= ,u ,`,`,H,@,,,,,,,,,,,UWVS ME E}EE,,t C 9{E}E9Cu 9K؋s`,t `,H,H,px}x HMHC@92H,ue,puXEM,t(xp9}} Ћ}E‰}Eˀ}tH,H,HJ@ [^_]UWVSQMQEU=,*E#E@1;EE=,,tG U9WE}?E;G uE;Gu O_@,,wt:GW M]+N^ M]+M]M؉]܋]9]]]v v[_ujD,N^~ vtVM] M];uE}-uF"Xsh+$Vh! REj#pjfjb:jeEjybjh5!ay ueXh"f_u>h& ~8t>u Pc_EV[t̋URU.É<$$L$QMcWPURhy%MQS9 W YusVcZSqSܮ jauduajf9je}t&uh"dj  o,uXEe[^_]8UWVS}EEEEuu OzZYt jh"h=!W-YXujh2"XZUqh+$ Wh!2njdjq8jj mq}uV}uPxǃu8V/jj @qj48jdn,j7W@uAE UM;M MM|'E U뎃 twxǃt@{uq؍e[^_]UWVS] uEUX}u }t]jƉXu u11jY}.uRP&;uM| RPuuBu @ujjuuWVS(e[^_]Ƀaw ,ÍBw P,UjhE"NXZ1U.t|$t5,'z^uu,,,-jyt jhD"av,,,H,,,,>h,P,,Y$txuxujhY"XZ11ǀ,ǀ,=PuUE]UWVS EtÍuV{󥡼,Xe[^_]UWV ]|u.uVX}u}t,󥡼,,e^_]UWVSExtl,=,u8=,u/=,u&,,, , ,pxX 9u SWV P.Zte[^_]USQM˅t&¡,9tjhf"XZJZȉڍeY[]UU19,uǀ,ǀ,=Pu]USE] =,tE E"tmt,ztE E"S=`\+xE E":S\PI,P ]n=`\+yE E"],EEPh"XZ],}+x,@B,USEtzE 8.MU u4@E Qh1&R%}+ }t jh"Qh1&R }t jh"i,}+_}+y,EEPh"~EUu7uxLà U~_E ȃ߃A<vM-tH}u;]t);]~27lZ9E]uEEEFt}t Es\$H}tE}t'EEEM} t tE Ee[^_]Uh@,Zt@ ,EEEEjEPjlH  ,uu u"I =,u+t $, $,Q$,~jNK ,yc8AU8#3Ujh@,=UEP'EUWVS0| u轄É4$賄|$W(KVuh!WPՍ؍e[^_]Um D !m@ !|$fD$ fD$ l$ |$l$D$USEi]'dt>mL$L$50jj WV?Ɖ׉ Mu˅y C-E؍XSu蒅XZe[^_]zUWVS]1)EM I0uyA-OQu =XZe[^_]UWVS 1%t@ER,VYHM؊@9EtA@9Mut>:G131} PEPjWu% 1ɅuEUe$s )ȉȍe[^_]UEt$tu ,H,,H,‹R]UVS5,,1~PCPS!EU DT e[^]US,H,~DTˉTIEU S[]UW ,y1=,_]UWVSM] ,; B|#5,9~; ‰|}H@[^_]UWVSE,1;E  ‹\9Ήr @޸1[^_]U,HPjZYUWVSU=, ,19~4\@utB2Z B[^_]US EEE,9,~o,tEP{S׍ ZYEEj5,.B£,,,]MXXutE‰L]UE,yЅ9|BH]USXH:t! t%.t?t \uXBJuÉ[]UWVSPzZË=,=,r,)SVWL<:^]<%<.uY;uM}+9EM|!@uWV膪SpB| E]똃}t e[^_]Ae[^_]U,ujh9*"ZY1=,,jXUVS]t 0PS X,,, ,e[^]Uhp}+XUh\}+XUVS]u GQ\}+ut;ru;Zt1[^]UWVS<Ɖ׋EEE EEERV/EԉU[XEE,E#E@t ;uE}u}to~MEUEt*RPWVE܉Uủ}ЋE Et2EU(RPWV{E܉UẺUЋE EtEU}u}u} 1E 0x$=,t%E)1)=~uuuu6uuZYt u܋} ,,ut $u t t=,uRUu'Pj2W*EċUREPuuSA(EEti,:t[5,jEPEPuS5,5,. t/jj.2‹ű}Љpxu܋}p x\}+Y^_,ujEPEPuS5,5, }tuuuuًE̋Un`Mȃ}W=|,u!uuuuًE̋U9S| u| Y[E}t,ME̋UЉQS| u| XZ"EEȍe[^_]UWVSEEu UM}t=,u@p\+Et\+u}t(];h\+l\+}9U|!@uWp}+t8];X X}ut9PX|ׅt=|,u1}u1=,ZY[^_]Ã=,u ,,U,tP{ Z,h,XUUt:u',tP{{ Z,h,X M ,,ULu ,]|1]UWVS(u}, ,E܉U,EС,E̸,>t$EE}x>EU EU1~u;]tjjuuWEUC,Eء ,E@u}t&;u؉E}!@u,,;E] },BMu k,׋EU Zu #9.k ,ߋ]9]] ]}9|ы]9]M Mk}9}} }ԋu؋}e[^_]U EPVX}u}t jjRPuufj:Uh,=|,u]]UWVS}U ut :@,uLj5l!b[dcY[t),|x=|,u=,u. jh9*",1 sjhX*"XZ=|,ujfX=|,u=,t,,B,=|,t%j,@[=|,uEt411҃}(=2)D =,u E؃#u%@u }u,MMPGPYYMtjjRPS}t2u2u-C;,|SY݃uKxSYtEUuu rojhw*"ojMQjVWjjsƃt=|,u>~:"u5,uu蹥 =|,ujX 1ve[^_]Uh1jv9 ,XZ= ,tUh1jM9 ,XZ= ,t|Ud7h1j9 ,XZ= ,tNU}t(h1j8h1j8h1j8jjj8jj8jj8jj8 UWVS,,tkjj8'85j+jj`8jjW8jP&$h1j;8j+5, tH=,5,W/9=,u95,t',@,RX,t=,tj!(e[^_]UWVSSE։jje(ua$@PM(CuP es {E C}u C%ua$@P (CuPd؍e[^_]U塄}+=}+tPQ P_s X,, ,UWVS5}+貋h(!Pns n ,`[ÍVhWʙ Y!tSWT ů< t< u#&Y8tPt u%Z8gPjP u DžoPx^u 8tt\u@1ɀx$uH11Qщ‹s}+}+P}+ ,ZYV`RX= ,t}+,,1e[^_]UWVS ÉJt5 ,u}+ ,Eh*"z_8 "SʉYuQo^Z]^lj4$S^$|9P$VQh*"P9tV"p Xh(!WWp :f;?SYSjjщ‰}+}+P}+ , VhP虖 tn=,t,lVX`P@]_t uƄ t VHb[u ,u ,uAYDP@ubVSZt(,, ,}+=}+,,1tfTP@tCu* fLHt@u C@tC fLHuDP6)yDP@u DP@tGDP@Ae[^_]US}+h*"SZYuwh*"SZY¸t_h*"SZY¸tGh*"SZY¸t/h"SZY¸tjSXZYxP, X1]UZu E ‹EttHu jh*"jh*"jh*"XZUWVSQ , p x tWV診ƉjjbE܉UXZ,jEPWVNEUE EtEU}u}ujh*"yY[u}=,tuuuuԶ,KQM%ZE؋U$RUԋMQN t u}Q{UuWV蛷C SXZE؊< tu߃eY[^_]UWVS, ,]11~1t2}+t AFKމt , ,[^_]UWVS, ,]11~1tr}+t IFK݉t , ,[^_]á ,á,Ë,tUrZøUjh5!ZYx$, $,UPjEP5$, tyj}uEHuEUju>.jh@,5UE=t,t&uf=+tEl+"]bx,@]]UVS,Dž=,u,1 h<j-[^h<j-XZh@,ZYtVjj-^Xjj~-XZh+"誾Yx,u  +=t,t j[P ԋ5,}+tPVZYt1ۉx,+"g8@8t|8t8,t@ۋ8tH5,Rx,PZYt,@SIXh(!5,^d^Xuc5,h|! aY[+"SdV$S5,y& FP5+Py^ZtbShV1 NhX&P$^Zu @׀8 uSHY+"h<"P#ZYt @׀8 u SHX8t%8,t8 t@Ћ8tH5,Rx,PY^t,t S4HZ@x,P "u94"e[^]U,jj*XZUh@jm*,XZU!,jh,D ,Q,y ;,| t,J ,Uh,P4dXZUWVSPEƈEj}W5,D$ f=L+tn,5+O>jW5,j:>=,t.V"Ph+"U^ Ktjh,5,# 뜍e[^_]USQh+"胺jjB)jj9) Åt4EPZ9um h+"8jj(jj(]jj(jj(,+j/SWڅtPjRSܟh0,h1"h+"j1h0,h1"h,"j1USQjh^#5,* f=+t#܁+;tSR$S5, jh!5,jEP5,}nu5܁+h,"\XZ]USPjP]Sh%,"l t=,u)<+SCZy Sh+,"\ZYh+"ݸX]US]j5,SS t Sh?,"I\XZhD,"蟸jUUS\+t$;tSQ$S5,j8jUS,+j/SVZYPujuh\"RS]UVSUu 1ۊt< uB< tЊt( t t@9tCt@8ủ[^]9uW|$wUWVSE؋O_}+uVRPSQ M܉M }+VSQRP u܉u }+SQRPx ÉEuh#ZXZrCLuu us 1HsP4}+UQhM,"ZU+"e[^_]g_UWVS]SO$S5, ,jh 5, jh,5,J ƅ jP5, jP5, =,!Ѓ uh ,jjEX h,$@j$XZjY1=,u?jP5,ƒ =,H"=,u)uPY_uՊ< t{J< uf=+tFVhV,"XXZ)9=|+4WPu  9thZ,"_,VPu c 9t hZ,"Ǵ^f=+t$j+$Phi," h,jjV jh,5, Sj2#XZu KYe[^_]UVS hVh," PJ?[th,"}Åyh,"YhVh,"9 t&j Sh@j f"5+Vjj K" PZ~<9u6j'><j5Vh,":jOPe[^]UWVS]ujh 5,,h@j!Eh ,jjU jh,5, t@t PFX,f=L+tjURPg Poj^^_jEUY1E1Ky S?Z PE=,$u f=+t\EI+ ufu9E 0 u&fu&f= +tj XGuE ft EPY} tf=+Pf=+tFVhV,"JUXZf=L+(,5+4XjEP5,@ =,=,t j4X,=,#E+9uj4_} tf=+uj Y} u*j)ƉS"=ujf=+u>E tPE Z+u}f=+t WVh,"WVhi," jh,5, h,jjRe[^_]h,"nX UWVSEhVh," 'jh 5, jjjjh ,jj+R(jh,5, Uà yh,"ӯX11ft#jƉXPY~G9uAj5,e:j2jjRjjIV! Vh -" SjLf=+tj})RPh-"{jh,5, h,jjMQjj jjXZe[^_]UWVSEuhVh,"/ 4jh 5,F jjzjjqh ,jjP(jh,5,Q à yh,"nX11st#jƉXPY~T9uNj5,9j5,8j0jjjj$VVh -"QjKf=+tj )RPh-" jh,5,I h,jjOjjo jjcXZe[^_]US,]S5,&h u,u M e,Sj5,dOh,jjVO]US,]S5,H&h u[Eu %ESj5,O ]UShSh)-" S+[t+jho#5, +t+Ձ+tՁ+Ձ+tՁ+f=+t|e+t$e+f=l+th h"uYł+tł+̂+,Ղ+tՂ+jZ+t$+f=+th h"X]Ujh{t 5,38jUjhzt 5,8US]1ujPXZ]jUS]CStu R^ZYt1]UVSEh0-"P^ZtP6[yh"YPh;-"hPL5ƅun,+u1j$f$ZX ZB$6$Ph\"SS!jRu*hr!XXX1$h,à XPY9u tth0,hC-"XZ댅yhG"{xuPhR-"uPhb-"h0,O Cƃ,,8 u =,vH@,e[^]USEjPh,h-"I uxh,hhP,yh,h-"TLZY?hSh," t h,X5+5,S ]UVSjPh,h-" h,h,PY[vE-"e[^]Hu ,,5,hhPÃy5,h-"yKXZ+5,h-"hV Jh-"SVe[^]UE jPh`,h-" uXh`,eh(!PGN uh`,h-"JXZ)j5,+P f=L+u,EUVSjPh,h-"b h,h,PY[vE-"e[^]զ,Hu,Rh(!PMà uVh-"=JXZ@,f=L+tPh ."Ph."hVHVh/."S2 e[^]Uh0,hu/"jWCUWVS}F,,,%E~1Ejh~+h2"u u/,=,uh0,h/"jBt%`'FtqD95/ kU DЉE죸,뉃a$+"1oEtPt=l.5WL>Yvh72"Z?:5l.5jh,p!V$2 jh1p!V 2 ḩ!VF^ZƅhY2"jl.5hc%SZYlhe"SZYMḩ!SY[Åhj2"뫡l.5,l.5,En=,t h}2"sl.5j/RU' YZUt ,6Rh>$h, EPjhjjjj5l.5,U P5l.5h2"Rܸ,tfh2"tN,,,=,vldZR+E)t8HuR}t h3"JE h$RUkYZUt,",,,hajhajhajhaju 5,h33"j h,Dh,5u h83"@u hG3"jh,7XZtKthc% he"ḩ!V [tNu+l++)=,u l+ l++=L++=,t ̂+=,t5,H Yu.}t hg3"j=,u"5, Zt5,hQ3"j$e[^_]U ,jh@,U4hZj EXZu5EZt ,=,u!ujYX= ,h@,zZu(j I$=,$uZY,j!$Y,yuh#XZ ,V= ,IjPXY,tPVY,URPXZ=,uM@EPj5,YB jh t 5,, jjYX1}UWVSS]=x,uh3"fYu h3"jwh3"IZt8/t P X++3"Sh+EPZ ƃ 1=,t9,,,,,=,u',%;/u%,jSHY_t,t t u!h3"Sh3"pXZ h3"pXj;+9u QRPb  +Euڃ=,u h,h*6#P @u ,%h,hk$ul @u ,=,y ,j:h4"u[ ,,uSh4"&=,t$=,u,=,u Sh54"jj:ht$u ,=,u3,t,tR5,^_,,j:ho&u t +j:h&u} t L+j:h!u] t +j:h^"u= t +j:h^i#u t +j:hA"u t  +j:h"u t +j:h %u t +j:h%u t l+j:hZ$u} t l+j:h !u] t +j:ht$u= t +j:h`"u t,j:hj"u t +=,u ,+=,u ,+,t Phil!Y[,t PhVd!XZ,t Ph&{_X,t PhX$e[^h,h3%u< @u ,h,h,"u @u ,h,h!u @u , ,t,x,t,t/j,SZYu,t,,@t,؍e[^_]USPhW4"h0,@Sh|4"h0,@j7U=,th,htj& ju U ,yh,'Zuj,P,=,҃ !Ujj,h!jh`,蠮Uh,jj; Uh`,jj; U E E,hdbjOEYXjjAEXZuh#=YXh`,ZtlE qujYXujXZ=,uVE ;EHh,&ZtU < tU EE9sE @E ,xˡ,P,UE Mtt @8u1]UWVSu,,FVtI)~@4" 8u\Qu ^@P u f^?봈@,[^_]UEP^v,^?<tP@,, ,,,]UVSEPh4"~;XZ}+;t[Ct =,uGL+PPh4"K;sC <Ƀ*PZVQPh4"; 렍e[^]UVS,u]S5,VSuVS~EԀ€Uԃ=,t̃Ef=+tMẼeewfEf=l+t %‰USj5,9e[^]UVSuU ]=,tSRV= y@19t , @/8u h4"E$e[^]ie[^]UVSPL+EÉ,}+t68u-Fu#EPPh#9SV1%tك 8]tjEP5, Íe[^]UVS܂+t8u#,tP@ [u,܂+Y܂+ḩ!S^Zu,,he"SZY…t]hw"SY^tXh5$S^ZtPhc%SZY1҅tBSh4"h0,;h0,L1Ҿ11Ҿ 1Ɋ+1 !,Aue[^]Uf=+t,tP Xj1Ujh,5,jh,5,JUWVSjW5,% ފ< uf=+u"0U)څ~CCjW5, ǡ,tP2 _9u+ƅy0h!V:,ZYu ƅnƅy+jP5,6 e[^_]1f=++UWVSjj@jj7hgj+hgj,fDž,fDž 1jjP ~Ft=jh,5, ~$,!S 9]<u^8C Q{ tUVWZYUt@PuW; YVwC Zu h5"藐Xc9s ts tC Ke[^_]É¡,H,y;,|,H ,Uh,R89XZUVSá,H!vB3V*)Y,,Swt^t2,P," Uf{ u@,!<3h#A3XZ{Vh|"23,C [^taP;,s Vh5"3>Vh|"2,C ZYt'PPE(,$h#2 =,"~,h!Xe[^]UWVSUu EЍX]:MB\t!^Ht E@yB^vx}HyЉwˊX{ЉwP&5"n8u@B98u( x0vE E ψJEB8t1ZY[^_]UWVSS]h}$S_^_ug+; CtE$ƅUB@t+YC<w3$T+"h %h!h7" h7"h7"+ZSSh7"* h7"*X1e[^]Ujh!5, JUVSht:"Y8"Xx&1tlRPha$h0,\-CttHu)h0,h:"h0,h:" h0,h:"YXp:"t]B"Fh0,j \XZe[^]UWVSf>,fuURhht@P Pu fEfth:"%X9"[ x&tIt>UQMY9MU~ p:"QRha$h0,O,Ã]B"h0,j W[XZe[^_]UPPPh:"h0,,w$,t@th ,Xj"Uh;"h8"hqh;"IUWVSSt Éֺ9""h;"h|8"hh;"Iu :u!USPgZYUu=$,e[^_]VSh;"Vjj!UEuh@"hp8"hh;"C{ uh4C"h:"h:߃uhC"h:"h;ŋuhC"h:"h<몋1ɿ 9lj} PRhD"%9|- tPRh@D"P Džjjh PV;= tS h fUt#ts hD"Q!^_1jjP;u;t/uRhOC">Y[$PRhnD" @ u hD"u hE"m󥍵ѶxԶx9t PRh(E"Q2Phɫ!HGXZVhG"5XZ먍e[^_]Ë ,Q,y ;,|< t,J ,Uh,PDZYUWVSu E1NeUVYU\ =-t u'1=-tk=-t t&Euh(Q"h,( ,@t< =-h-"h-Q"h, ,@t u$ =-$@u| u=-ti^@t|IW=-tLvM@tZ-s@tM ,DXt^W@t1?t ؃@<@tHF @t!5-h#薧-ff XZ,@t h jLe[^_]UWVSVu-f$,tfh"RU蘿Y[~tA1["=-Uu(!PRXZu!6h#-Y^.,-SZ,t SXf%,>ke[^_]UWVS|5,ftz=-u8=-tt-=-u--,5-5-uà 1S-PV yah jxPV&ZYuE=g-]S -_xSh2Q";Y[I)u[t5-h#褥-XZe[^_]UWVSĀuf,fu-f$h"Rt誽[_~tu,fp=-tTjjR"à xTxPSZY@u SX9E%=tFS6hKQ": !jjRà y6h#謤Y^-:-y hf$j]S,Zft9tSPX>e[^_]UpPPh R"h0,jO-W|$wUWSˉ-U]m D !h}fU fUm]mURp pSQp0hwU"h0,2$e[_]g_UWVS]E }܍p(}p4EPS4}Y^tShU"lXZe[^_]UWVSP]u CM% CSCt RPV RPh+ 1t)_18th+hU"_XcCt5PVZYh+hU"輢_X}uPh+ZYuˁ}tk=-u^SlUUtRVRZY@uc8-tRh+ZY@u"{lth+hU"-_Xu%Sh+gZYt }pe[^_]UWVS=-t.h+QCh+Epà oh+!jjEp\ @Euph#腡[^1xP=(-t,- 0-t 1ۃ=$-Ã}  =-h+hU"h0, ,H, yh,Y,P,0 t+@t( ,y h,XZ㡀,P,Ѓ߃Yt\_jۍxt6Ph+uY^@u8h+h$膠\h E *Ph+at^Z@uȋE%=t[jh] GPhh+4ƃ uT  -u"h+h#\ h+fAGPhh+ƃtOGXW\`du;`dE@hDžl+`dpt;`d‹` d)`Tjj\jjPjsXjwXPM `Dž`DždځvRPT)XPV% P9th+h#|Y[:)Ӊ1`d=-t`dhvTXErYZEph#XZDž`Dždu61Й`d=-t`dhhh`-\lƒ ~&RXh`-V X9th+tEph#^YX=-t#V\YZth+hU"2XZ\Xu VY-tVW[Z1ۅÃ=-uh} tbG tY4-9GuOxPVZYth+h#赜Y[$E9Gu-#G%PV[YZuVoZth+h#n[^=-tWh+ZYt؍e[^_]UVS]hVsɼ u shV"'Ƅ} t'h+o=Zth+h V"ޛ[^.h+V藾ZYtVhV"١-t jsPLZYe[^]US]} th+=Yt h+h V"sh+YZth+h$V"VXZ-tE ]]]US]} th+<Yt h+h V"$s$s sh+th+h/V"ۚXZ-tE ]]Y]UОPPh9V"h0, jU谞PPhW"h0,jUWVS|Ӊ΃=l.ua =p.u` R|Y_u%=@u'k|h#XZ>t#h|V =vQZVS:nY_u%=@t=x.u^VSm_ZuQ%=@u?V"^u?SPSh$hS=΃=l.=d.|8/uVP mZYti|hW"UhSWWt=|Ph$hWVWlt|hW"蟘_XVSmpY^ l.iS|Ӱ_ZuS|hW"Y. \j/|Y^|tpj/S_Zxt@xxVqZY+|x)؉t=9|u fDž.Nj|ƄPRk^_u~;xuf.׉ދt󤋅tƄxPRXkZYu<|9u(;xu 9 u ;p=.t=t.h,ShX"h0,C,H,yh,0X,P,0t- t( ,y h,_ᡀ,P,΃߃Yth0,hX"葠P=|.t%=@uSS7^ul.tS|׸ZYt*S=p.uPSj|j茹ҡh.t|`.PSh)X"X1e[^_]UE TET]UE MQTU TE]ܭUWVS EEU ZPs4s8MIPy4}y8}}9Nj}|1NjE9u|,A<9C<|"TU ETE [^_]p [^_]UWVS UE EXPs4s8JPy4}y8}}9Nj}|1NjE9u|*A<9C<| TU ETE [^_] [^_]UWVS EEU ZPs(s,MIPy(}y,}}9Nj}|1NjE9u|,A09C0|"TU ETE [^_]w [^_]UWVS UE EXPs(s,JPy(}y,}}9Nj}|1NjE9u|*A09C0| TU ETE [^_] [^_]UWVS EEU ZPs@sDMIPy@}yD}}9Nj}|1NjE9u|,AH9CH|"TU ETE [^_]~ [^_]UWVS UE EXPs@sDJPy@}yD}}9Nj}|1NjE9u|*AH9CH| TU ETE [^_] [^_]UWVSSEEU JPyXI\XPsX[\9|9| TU ETEY[^_]騪Z[^_]UWVSSUE EHPyXI\ZPsX[\9|9|TU ETEY[^_]OZ[^_]USU EAHtWSHtL t u u? uA] M[]9t=.uyDutJt] M[]%.1 []UWVSUv. . .0DžTDž4Dž8Dž<Dž@DžDDžDžHDžLDžPDžxDž|DžXDž\Dž`DždDž Dž$Dž(Dž,GHf tfu7w  PGTPh!;&G G.u fHu+=. T.u=.uG GG,98s80wPF`Vdptp9X\t}ptX\V F9x|s x|F9HsHFXV\hlh9`dl}hl`dN uDN 9P}P  9L}LDžpt(,hl $=.g=.tvhYf&j ]SpjvpY[t̃=.tvhYf&j ]StjvPXZtp Yh94}4SZ9<}<.t6h"vld TP 9@}@hDPu Xu jjKF pPhD FSP=.t'DFTPT7 wDD$EEDEȋ8Ẽ0(,EU $EUă=.t E` .AX\SQRPRPh j]SSiEЃ=.t@ȉEЋ@EԋT" XZv PTVh!.먃~Dt~T.u =.tm=.u7=.tvh`Y"Y}~vhaY"D.YXWSj‰E XZ=.1U&jVS 0S脎0Z8t hS"j e[^_]UWVS}E 0ih-"jP jdt;EPhht@j uEft+.. .Zu .1۹MhY"u WV M]1G5$@X".......뀃=.t ......6.............c....v.g\.M. .1..b..........1..{..].N.?.0.d.........@YPhfY"h0,j95+)}. . .t!h "_MtPb+YM=.u ...E. .} =. =. u U .u=.tɀt*uMh.jXZM...=.tftt&.ɢ.(=.t .[{=.t .Tf.bZttuL.@.ϥ4=.t .ݣ=.t .֤ .=.t  .cI=.t  .4=.t  .=.t  .  .}t E E +:.e[^_]UVSƋ.tp hW% XZTV ؍e[^]UVSƋ.tp hW% XZTV ؍e[^]UVSPTxDuRh#hVR@ph$hVhSVҢ u"p0 PVhY"h0,tGƄh!^. .tS =.t S Y Sh#VXZe[^]UPT=.tRph$0 Rh# ZYɋxD. .UWVS=.t;jj h-"rr j]Su@u hY"jShY"XZE .AƉrzSQWVY"=.uY"RPQn e[^_]Ë ,Q,y ;,| t,J ,Uh,PXZU%=t3w=t#=@u1/6=t=u%!|@= 1It*Y]UWVSEϋpP.tvv RhZ"Ã=.=.tBjj h-"v\vXjURs@Uu hY"jzRWh#2à L .AF`VdEUQRuuZ"=.uZ"RPWQÃ. .Et3=.t^fÃ=.u=.tF%=@u FjÉ؍e[^_]UWVSEUEPJEZuEZ"EC u=.tECuoEU=.} .Ɖׁ;u|#9E|EyCu! gEVCu Fe[^_]UVSut'C  CtNV( [[^]UWVS$j}..X=.uEE0F  F^P=.tss Ep(hZ"=.C`SdEЉUԃ=.tEjj h-" RPj}Wq@u hY"jWEph# N .AEUԉMMuuRPSMyZ"=.uZ"RPWQGEPs~sEp,EPh/Z"=.u7Ep4h8Z" wEp$h8Z" =.twEp hmt" C%= u>K % 1RPEp<%RPEp8h?Z"jSXK\=.t6jj h-"QRj}Wo@WEp0h#; %Ex0Z"=.uZ"QRWP=.tC(S,=.tC@SDC4S8h. .t9=.tdlC=.u=.t@uqC%=uX v2e[^_]UWVS]C=.tS(D=.t=.tS0SD. .;+(C;+~:P5.& ZYuj=zX]e[^_]-S+. .1tP  PtF@衸+E졸+}E}ETE}9}~h}EM9M}*=.tK0KS(.z}9 E9U~Uܸ UBE뢍e[^_]UWVS ]C=.tS(D=.t=.tS0SD. .5+9~] [^_]E}EQ31tWF  FtG;}| 1=.tK0KS(z9U~U UBGv른 [^_]UWVSQ}.tG(X=.t=.tG0G\=.7EtoF  Ft_}~;,1EEF,;+| E =.tO0OW(Ev델 Z[^_]UVS RPuV4 u1o_X||@Y^t Sh["oXZu@^_tM8-tuSh["n @Yt Sh#D6ZtDhr["50.t'SDhM !) 1ڋD7Ɖe[^_]g_UWVSÉ։ύEPzZyh`"g+y ha"jt)tSuSu߼XZuuY[etju軼jS購\"ju蟼jS藼`"u觏u蟏jSVVէy ha"ie[^_]UWVS ~Dž=Ȋ+u,h~P5Њ+& ~fDžDžVhm5Њ+ǽ fDžDžVhm5Њ+蘽 y7hga"h~W5Њ+苍à  ha"[h~W5Њ+e t ha"5fDžDžVhm5Њ+  yh?a"0j蠥 tȊ+tdtha"jsXZDfDžVhm5Њ+蝼 y 6Sha"0j*؍e[^_]HyUPj XZËJ UWVSH]Њ+tPq^Њ+`...\..:.,+F;T.Ԋ+ uЊ+T.܊+0hjSЊ+ y"Shb"0jЊ+P.1ɅuwuЊ+T.+?hhS|Њ+ ySh1b"0j誣 \.Њ+t`P.tVJuЊ+T.+0hjSЊ+ y@ShLb"0j4=Њ+}.uWh.5Њ+ͦY[yPT.Shlb"0j5Њ+rЊ+\.PZ@u.%=@u95T.h~b"j薡5Њ+Њ+\.= u'EPhm8@5Њ+袹 @.M=`u .:jjj5Њ+苹Bu@u8u . ..,+uA. .,+|\.u@.9tB%t@.~Iu@.t @..H}wt @.J+~m..EUu/5@.t%RVuu菀 u5@.5+{@.~~1E tlMWVuuM ‹MtEπ}t @.H@.+@.+Ȋ+1 @.(뽍e[^_]Ã=.u =Ȋ+U~h~P5Њ+Z Ȋ+Ċ+=.uNUjjj5Њ+%yhb"0j號 RP5Њ+觴 x11U=.uhb"jbXZ$`.t5D.5@.hc"j=UWVS] }1WSu苆 ~ )ƅuƉe[^_]UWVS] }1WSu ~ )ƅuƉe[^_]UVSUM Ȋ+Њ+=.u;QRPà ~G.9@.ts@.tg`.[QRPÅà ~ .>Ȋ+t5̊+$Vh?c"0j5̊+h`c"j ؍e[^]UVS] 5Ȋ+Su5Њ+ƃ 9uĊ+.~1Ȋ+.tH~Zjjj5Њ+Դ)RP5Њ+d Ȋ+18uȊ+1 8t8EuR8 uhc"jߛȊ+Y[18t8z8u!kxt Ċ+.=Ċ+u Chc"_u5̊+h`c"j_ Mẙ+FShc"0j:,.Ht u hd"jh9d"jXZe[^]Ã=.A=Ȋ+4UWV,+w hkd".t .. Pt .(fEEEPhm5Њ+贲 xyȊ+.5.~tjjj5Њ+萲x5jWVRPz)WV5Њ+e.=Ȋ+hd"jљY^hd"j辙XZ1e^_]UWVSu} E@19Ȋ+.jjj5Њ+ƱӃx׃=.u.E.9u}uljM]jWV5Њ+~ҋM]y%hd"0jȊ+ )ڋ]S1 =.ue[^_]ÍL$qUWVQ1yȊ+m.u9?h.e"9+jjj5Њ+轰y <h]e"C)y11҃=̊+~ he"jRP5Њ+|he"0jȊ+ Ȋ+@.19MQRPWVXvU Utha"j萗Ȋ+XZHfEEEPhm5Њ+賯 y)uOVhe"0jCȊ+ Ȋ+1eY^_]aUWVS0,=,+u,P^+H.L.Y tDžDž=.=,+[h:D"WV5@.5@.xRPVhe"hWK5@.5@.h f"hV)0WVhf"hV}}t^=$.tU5:.5:.h f"hVVh$.h9f"hV(Vg$Vj| =,+ubh#:.1WVRPwRPVhe"hVXV5:.hOf"hP;0h:D"@.@.@.@.WVRP7wRPVhe"hR5@.5@.h f"htW05@.5@.h f"hVRWV5:.̊+HP.0h`f"hPl8}uV5D.h!Sm%V$Vjp{ }*e[^_]Ã=Њ+y:...UP. |.t@=.u7=l.t 0.5D.hf"50.50.脍=\.tJh.5Њ+RZYu4.%=u#. .u5T.\.Y=,+w=.t+~ jP%|XZ5Њ+|+Y~jURP: . |.t1=.u(50.hT!dl.50.誌 Њ+. .u:...=.t̊+. |.t=l.t0.Ll.=.tg5D.hf"ErYZuQ@.@. tjhRPJtjh5@.5@.0tRPhf"50.j50.貋:.XZUVS Sh4.j@y y蟶hf"0j蔒 jjSjy yshf"0jh .=Ċ+ @.=.u5D.h g"貐^X5T.h+VqZY=h܊+VqZY(.̊+uPVh;g"Xhag"PVhg"Ehg";,+whg"h!Y5D.hg" hh"hDh"hlh"h Vh@%V=pYZtFu=.1PRYZ~9!9|1|uhj"jXZTxt>.1ۉ޻몃=,+h,j"j袍^X>.ЉUkLVh>.+ZYUyBt+y#kt+L+.Vh>.Y[1Nu=,+t>h,j"j/XZ^RSh>.h>.V)؍>. 9e[^_]UWVS E.pFE1۸>.RUPZYU9tVuu hQj"xt1뻃=,+uhwj"{hj"jj[_1h>.h ..P$XYҡ.xtt'LURSh>.P8 u~Hu܉>=,+uhj"j^_[hj"jY[uh>.h>.TE>. xtUh .PpYthl"0j =.tdby[|Džl:.PwMpRPh ..P@ u!pt:.:.RPY[th .TZt:.:.:.:.h .FYZu؃=.txPh$.:Y[t. .tkxPh$.[ZuT.=.t/t/t:.9EEx:.|/:.9EE:.|Wut:.9EEx:.h .RYjh .YT[Zt0h ._:.:.:.:.RP =$./u(4uh$.զ$h%.h$.K t. p.tgxPh$.ZYuP=t.t4=p.tt:.9EEx:.|+:.9EE:.|St:.9EEx:..t10.J~PWVh ..Ph$.e0l.[X<:.t@t=P.uPY=+t1:. wlPh .jXZ h . Ylub:.:.:.:.RPMXZy h .%^X=."=l.0.l.=P.uSlh .UY[y;50. z:.:.:.:.RPh .]pPRhh ..P@à =P.hu Rh .'XZ=.t=l.t0.l.u!pt:.:.RP#ZY<:.x5(+X.P(jh4.jf,!dN 1e[^_]UWVS.x .t!9t30hl"j ]PHx.P x=.u.X t @]y^x. |.tW5D.hCl"50.谰l. 2h .T_t.:.:.:.:.RP Y^Ht#ct=.t4h .c^y#.P(ƉI\WV_Zyuth .]Yyơ. |.t%=l.t50.hT!,l.XZÃujh4.j5e| ؍e[^_]U=.u y [y.PHx1]]UWVS Džlh 5L.W = w u}/t 5L.hql"e4~/t/CFtP5L.YZyL.ϡShl"0j}2|%=@t5L.hl"j| XXy u$xw`x=.u )؉h$e[yDžlh .CRZth .%Zt. .u#h . %h .WZY )P1=$./$.PV袖 ;hvh$.hl"j{tPWZYu.=.t:t:t:.9x:.W:.9:.ut:.9x:.jh .LZYy'jh4.jb_a$ 1Uth .YXYSPh .N xסt. p.u+=.50.h$.)l.XZ}tPh$.YZu=t.t;=p.tt:.9x:.|:.9:.t:.9x:.]:.=.t h .  h .Y:.tE t@wpPh .*YZ h .NZh .WYjj50..3bl y80..d`dRhk"0jNzh .V jh .*YZy#lPh .Rh .V Pdlh .WdPh .(lPh .=.=l.0.l.ie[^_]U A. C.=@.u .@@.@.=~~ h~Phl"thPh*m"j?xS@.+5T.&Zx0@.@. A.@.‰A.A.1 yǃU A. C.=,+u;@.t2=~~ h~Ph[m"thPhm"jwF5T.Zx-@. A.A.A.@.@.1 yʃ A. C.+~@.~UWVSX.t hm"jp@.=@.+u@.qRA.+A.EU EU=+}EuuuuX׋MщƉ;EE}u}WVZY+u} A.+19}dA.A.A.;A.s5@.PpZYA.+ A.RPTY_xj A.Ɖ5A.+A. A.A.+@.EU)@.@.@.@.x,+hm"juXZ؍e[^_]Ã=+US=,+uhn"j^u[XNy=+~pC9}kPhOn"j1u Yx]@.@.15+5 A.?ZY~ A.A.‰A.@.@.1u빃]ÃUWVuM A.)ȣA.^_]UWVS]CDž$$ x$|$x $=.t2xPu xZYyVhlb"0jtPux^_u d#ɘhun"0jtDžDž5+5 A.u [ƃ  A.9|VPuV "WRRVPu9uyy(Vhn"0js9|$u9x$thn"XPu gwZYy著Vhn"0js.E49Mu;0thn"jYr9},t"1;x$|$}Pu e[^_]US1ۃ=A.u~5+5 A.)XZ~" A.A.أA.ؙ@.@.Cu4=.u A.,x@.@.X.؋]ÍL$qUWVSQQEE u15A.=A.)9}Ή5A.)ډ tƋ@.]؉}܍uVuuRPOu}ӋEЉE؉]ӍEPSQM؉] M؋]ywEU)@.@.195A.+A.ؙ9|Zx t%u؉}9}E؉U܋EA.+u}머eY[^_]aUWVSU Ӆ~HA.+A.U U  )څ$ 9~؋5A.}5A.)É}봉[^_]UWVSEx$|$hDžpDžl } xJxPu 4tZYuEl(Uhhun"0jDpDžlltE@Džd19 A.+ A.ș9Ή}hlpPtPQ5A.u  E0xA.=T.\t7ƅc;\tdAƅc€ctA. \A.)&} x7pt%1ҋ];x$|$}Phu  19|=T.t t1L} yEP] u41}d9$t!lhh"o"jm le[^_]UWVSV@.@.19| Ef;@.@.}hLo"jZmY[@.@.$+ A.‰A.;E~1}])É]15+5 A.XZ95+uL5@.@. A.}t&5A.NjM=A.+;E)E롣A.~@5@.@. A.E)։׉=A..Jtbt[L@.@.vx/+ A. A.;E})lj}X.؍e[^_]ËA.; A.v.UWSA.)1A.5+1Xe[_]UWVSu] ~>A.+A.5+Xx 9~Ћ=A.=A.)1e[^_]UWVS1;EE }PA.+A.5+Zx5É9EE }]u 1=A.=A.)]u 1e[^_]UWVS]x$|$ $=.Pu [o_Zyz腏Vhlb"0jyk[A.+A.~^9}P5A.u R )A.1;|,5+i^y}W t ho"UxPu snZYy蝎Shlb"0jj+0}94u;Etho"jhi }W1v5Sh~o"떍e[^_]UVSĀ]s|PV/XYx_.uM $M9$$u@;|u8,$M90$u';Uu"xVho"jh x 1e[^]US|]EPSZYy1=.E%=@uBh@%SQHZYuZS|Yy} t)Sh p"0ji-S4Zy50.aSh&p"0jh]UVS]EUdhDžlE UptDžx}=$+t = +|PS^ZuZ=$+u#EUdhEl= +uuhXs"j Xuhss"jQWY[HV{ZH~ 8/u3E ؉CC=D.uD.@.X@.1e[^]á<.t@=.t 4.=.u4=.t+UE$u8.tjP5T.) US=.t8D.1t6{u+uhs"jfVXZ3h"h0,h [Ƌ]UWVS]=4.u =T.u&4.yx5T.#8.ZtHHQf $\"=.tȋ@PURURpp p09xjjuuuu8.pphs"jrUphs"ht"p jSV Rpht"p ǃ$ǃ$ǃ$ǃ$ǃ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=.L$H$X$T$0$,$$$ $Pm6$yǃ$mǃ$aǃ$h RP'< y$8.pxVh1t"0jTƄ  ǃ$h 8.pCPQnh 8.rP/n5D.hf"J3à u<.@1ۉ؍e[^_]UWVS4ÉUMčMQEP@ou}āj 9ƉЍM}QhKt"QhUt"j@S`]ue[^_]UWVS\]uCE=.uPh"V襄 ue[^_]RL}W($HT$X$E7j8$0Ej<$Uu-"u-"PjRj4$What"V#$ w'@$  R%Phst"|$x$h~t"VԃuEPhJ%V迃$Pw Sht"u ShO !V艃 Vj 蟲ZYV3KXe[^_]UWVST]}T$X$uV($CGSWVht"Pe[^_]UWVS]u fVfuPTZt%t0SRjP}W{ VW"Cۉu ]e[^_]"e[^_]UWVSQU] Ӊ];Uss< uB1}uPBJyЉ w D$yw Dyw*DB9uwBD9Uv qЉv1Z[^_]UWVSMU ut B1ҋM\}uB9rmKyW wy0K uK0K t9s)V19w)H9w)ð011҉1 [^_]UWVSuE D$11;t$yC@Fȃ?;t$F~ ωҊ< uF9t$u1111҃}u~F4$~OЀ w Ow _wP ˉF\$9$r+KЀw!Fɉ;t$rY[[^_]UWVSQEU uM\}uN9ryMK}OW ;}rM0K uK0K t9s)V19w)H9w)ð011҉1 Z[^_]á.&u*URE.ht"jlMYXEø1UWVSSu] E}MMl.5=\.u)S\.:-uX. +1Ҁ=X.u" \.Q\.u \.X.=X.t7tMM}E] ue[^_]^E] ue[^_] fUWP>ZYtU:u W3ht"(x:u9+9}l.5@+W3ht"h0,X~?e[^_]1UE E EE],UWVS jEPSkƉ׃EU ;MEs 11M9tu"jJVH *Ej y ZUyhu"΋.B1e[^_]UWVSQÍEPS^_uC .16ƋE| t@E]Sx Zu . KDe[^_]Uh0,hUu"jr,+t 9tU,+Uh0,hu"~h0,hv"oh0,h`w"`h0,hZx"Q j&rUWVSP}hW%SZYhW%Sb^ZÊUhWYXUunWh!y"0jJ t/1e[^_]UWVSl] j/39r_ZD.t@D.h}"PٍY^sD.}"\..E1E1Ejh+hjy"Su ezr$`\"l.5/@.5l.5h>y" @.뢸+댡l.58-uxuT.EfT.U.MP.Ty">./x.  +=,+uZy"O`..=.u `.d.$+c.C5l.5VZ}1.e.V +=P.$.`.l.5.. EP9~5UxPuy EZYUuhu"jLFjoEMȋ l.5 .HUP.,#\..|.r5l.5DP.|"ST.t+DT.h+5T.\+&T.P+T.D+T.8+$+l.5P.$.+.5l.5CY4..z+E,+uUu 0,}u, 0.Hw6}u 9Uuj kLƀ+5..t HuP.Ejhy"jPDeEhy"P1$_ZEhz"S$^_E@E.`.}tE8XEMth"W#Y^E,t&h(!W4vE^ZuWhy"jCEEE5ƅ}tESz [hz"VJ#ZYu`.Vy XEjhz"V[ u=`.t EtSy XFPm Vy ^XEERjSV E2EE}t EtSVy [h"W"ZYt uLZX=.~W?Ej5.S oEOExtE.O}.E@EMEhz"S!_ZBE@@EjPA[^}uEhy"P!ZYuEXEh"Sw!ZY,ud1҉UDžUuhsh"SD!_ZtVYY=.rSh z"ztjP^_y,h(!S}s_XuSEtj.hz"W ZYt2jhz"WyY ujjW2Y_=0EjS+}1T.t 8h!GT.Yt 8T.{ D.! 11jh+hz"SuRz$L^"p+Ã뾃l.5@.5l.5h>y"..wl.5T.e. SP.Ty"D.@2.΀.l.5l.5t*tF[tpt=.ttjbZtF}QtuPU!uX1C<]tIoEz-u)BE<]ttE9E|E9EZ뼋U9Uu1}!9A8Qt e[^_]UWVSS։M:NjUÀ8/uXJ) ~Suh }"jB7C։9r HNHNs19rЋM}t;ur NH^X1e[^_]UWVS 5D.h&}"V6[_VshY}"D6h}":6h}"06h WI6h!WZYuh}"W[[= u h}"5Y덊uh}"5ZX<.uuh~"5X1u8L@%uߋL@LtFCC9r<9u(>t#LRDhq~"jB3tNL@tBuDh~"h0,!e RDh~"h0,e<th RDM, 1e[^_]UWVS}tExu h~"%<\u FFu"8uja Xu*h~"jW2[^uhL"jD2 ]CjWP ǃ t4hVP]uVh~"j1 Sh Y릍VE֊t<\uF8t+FBkSth uhL"j1^RZu% kSuhj"jJ_ Xuh"j0Y[G3CV8UZC CECE C= .u ..X.1e[^]US .1t6Cu+uh"j%0XZ3h"h0,'b [Ƌ]UWVSPu .1$.Ku Kȃ=.Ku $upFP_u!h"jx/CY^t/CcCt /C;WSZC Hǀ?/uC C$% .׋R9t Ouh"j/ZY1ESe dž$XEe[^_]UVSudž$ .u=.tA=.u8zCtEC |/u&PFP38G u$=.u-1C[u1=..KVPYVAZxdž$e[^]UWVS]=+tjs{.u{.u Ct:"j( gXj jCS=à / =1.<7t 9t,@ujeV Yt ph^"j'XZ1e[^_]UWVSQ]=.u'Ujh=Y ._ZUu h"#t1\u{#uCS) ^uSh"j.' gXj jCSNà h) =1.<7t 9t,@ujvU Yt ph܁"j&XZ1e[^_]UWVSut>u h"j/VOZYÅtCFEEPtOzЉ vB,u}u@EE'}u.tVh"j/& EE@jT Xu h<"(t;u GKGt=tyVh"&O}teE8t]Wyuh"jN%W\ aGƒWt(G 9OG}Vuh"j%W[ 8G=.u=..x=.1h"j$XZe[^_]UWVS M.tmƉ׹=1EӅt9{t[93u@U1ۃ}t5j S YUuh"j^$XZ0x@ PE؍e[^_]Ã=.u1Ujh V .YZt1h7"j $XZ1UWVS}.N1$?4$E1}*,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[ujQ YtGGPZt0 $$$CSEC ECECEC1~SY Yhb"j"XZdUh 3 P= 1$$CHKUwEK 3]Y SWY [^Ee[^_]UWVSM.4$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3X X]e[^_]X e[^_]UWVSQ=.t71ۋ4t%v0EkX EPbX XZuC uˍe[^_]UWVS1ۃ=.jhGS .^_uh"jU!Y[W"=(.5,.oã0+Zu5,.FVh"0j"5,.X1ۉ؍e[^_]Ã=.u1UjhGS .YZt1h݃"j XZ1Ã=.u1Ujh= S .YZt1h"j} XZ1UE$$ $]UWVS]E=. $$$,$!Ήu샻0$u9t!ȉEEEEEE1ɉUƅUt!@ xu }98M@E !1 ЉE} P $$$ƅ}uM}tGjM _@ $$$AQ F AN 1Rt$.... u'.U !ƒ=.u`9u\1tL.=. t:UjGM Zt+MMHUPx N HF $$$3ShA"jph|"jd%P @ $$$E쉃,$ǃ0$1e[^_]Ã=.u1Ujh=P .YZt1h"jXZ1Ã=.tDUVS1.0tjjs sss3ٵ[$݃uʍe[^]UWVS$EE} EEEƋEEEU E܉UE$U(EԉU؋ .=1Et#؋M9Hu9p u M9Hu9xt@$uj(K X҉UtMuzUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!RS XE "Ee[^_]e[^_]UWVSEEE EM}.tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3R SR XZ1e[^_]1UWVS]}E=`.t,;/t'PSpn^ZuSh"j |j$>J Yu#Sh3"j tXue[^_];R SZtGFG4W8F VG(W,FVGlFF .F5.e[^_]US.tvC.=d.u{ t s3蠴XZ$+  +tjjssss 3=+t s3$YX3vQ SpQ .XZ놋]UWVSQME @~ L@119}@4tEE1ɉrU1uZ[^_]UWVS u=.1FhGSPf <9tjww 50+@2;Wu;G t >hd"*SR50+q{ 9؍t>h|"0j SR2 yjG Xjjj50+1G WxPS50+"{ 9u+T$X$GW.W81d=h" =h"0j WO X9hӅ"jZY&T$X$w9_}_We[^_]UWVSP.uh"ja_Xqhu u E߅t7u0Y^ƅtcj F ^t;u~ƉYt#umGZt _E81QVN XWN _h="j[^0_SuZYtSmN uG_Zuh""‰e[^_]UWVSu} .t=h7V t&3VVZYuusV2 [֍e[^_]UWVSSljӉȋU t 1MLtt JuQ 9Q1 QA%QA Jك0J t9s'x19r)AE9r)ЉEU01 ىZ[^_]UVS1ɺ4Au񍈜9s AY[^]UWVS| uB¡ ,Ɖ 19tSP*u Ƅ.'?u Ƅ. fD~u Ƅ\ˆBƄ9/u Vhd"h SwCSyEVhl"h SWCSy=Vhw"h S4CSyVh"h SCSqe[^_]USSˋ t)RQP/E3K UEeveRu P/ ]URPh"jUjh2ø1҃=.u1UME.1Ҁ<u Bu5} u*J=.t.8]UVS]} ~z;tujh}"P, u&4+u 4+Eh"jXZ 4+jjPƺ 9؍e[^]UWVS5Å3h"V__Zt+sVh"jKhdy"h"h)"j5 2{hdy"W ZYu,+vWVhW"j.m1e[^_]UWVS]u hVZYyn- 1Cǃ4$WvAVh.. i Rh.. F jjFdP%($jjFlP8$jjFtPq<$$jj F|PEUUEщx$|$ @uAjj P$T$X$H$L$`$d$Hǃ$ǃ$ǃ$ǃ$ 2t~,1ǃ$ǃ4$($Qw^1ҀKƒ $x$|$ށ$ǃ$$$ǃ$($y($|/t5uǃ$@($ǃ4$Hǃ$΀($x$|$%$ǃ$$$11Ҁ|/uDЍe[^_]UWVS u$Pwo$`"=.t_h}"h"hˇ"h" d~ Ph"HuCVc~ Rh%"1jdRPP*dž$dž$$ u#EƄ/jj o11 Y[1u9E2jd PEP)jj o11wE1Ex$|$ƅz ӍyHσ0P uSo1ɍn9r)ڍJn9r)ɰ0󪋅%$dž$n9uhC"+. .t .. T$X$($1jjW_Z8$1jj_ZY<$1jjgtY_jj {O_Zud1jjM/ZYuDhS葡[_yHjhסZYx鋖$  Ѓh`"j e[^_]11UWVS}} ?jh}"Vh% Åulh"VY^¡. . u.h"j} XZjjPʻƺ 9tPVh݈"jH ؍e[^_]UWVS]u hV/_Zy - 1{ǃ4$EYt"h YPW&z/@E K<vI +UVh..E Rh.. f jjFdP輺%($jj F|PEUUEщx$|$@uAjj PmT$X$H$L$`$d$ƆH<$P)PXyjjFtP<$ Ɔ(8$P PsVZYyjjFlP8$ ǃ$ǃ$ǃ$ǃ$ǃ@$ǃD$<6tL<5t_<2Pπ3@$%jjI^_t/"W"@$ % 1jjQZYujj |11^_ƅ6jj |11vZYy7"wu ƅ2 u ƅKƅ1jd PP) .jj |@" u\ƅL5.%$$1ƅ{H0H tm9u H7x$|$%$ǃ$ƅ{H0H u(|19r)A9r)ljư09uhI"DžustafDžr=.t fDž fDž00($1jjd^_t#8$1jjlZYtZ %<$1jjtR^_tg"W. .t .. T$X$jj ZYtk" j8$Jj<$Lƃu-"j W P u-"j V)PF1jj|tq"hPǖ^_yjj ZYx .u$  ЃY5.Py¡. ..^_x)ЙRP衖ZYyxe[^_]UWVS$É֍@- 1uh h`"DP|@ @t . C .@.RpXe[^_]USP]S&Z=vEShx"j; U؋]UWVSu>-u~t2h(!V3_Xu$%0W< PVh"jY,1EPS貞ZYt/G}vEVWh"jEU`t1,t SYXe[^_]á.t UU RuPB5.+UVS]u F1.tRPS] tD3j SZY1҅tЍe[^]US]}t X.|. .t!=l.th0,j `l.XZ5D.h|!h0,1Su h0,xh0,j ` ]USjh5!"Y[xEh=!P+.YZt&h(!S.YZt135.ZSX=.th5!hŠ"j ]UVS] u}t X.|. .t!=l.th,j _l.YX5D.h|!h0,0Vuh0,x~S9 Phı#h0,0h0,j _XZe[^]U#Phފ"h0,`0j' .UPh"h0,:0j&UWVSƋ=8.tPhC"h0,0 =0.u ˋA%=tjRC2YZt"8t͍EPsXZ=4.tVhQ".[^Xjs`GjsXE-"} t$VWPREPh"h0,a/h0,,H,[yh,CY,P,؃ t+@t( ,y h,Z㡀,P,Ѓ1Ylje[^_]UWVSAօu"VP还[_tDžF%=t1jh @txPZY{x~9|u,;u(^9u;F u%=t .q_jjj1  ׉NX^\19ȉ}{9Dž Dž| Pv ;x+{[Bjjj` & NX^\19ȉ}{9Dž Dž| P ;+{4IYqjjj UNX^\19ȉ}{9Dž Dž| P ;+{ezZjjj NX^\19ȉ9Dž Dž| WC ;PPWA +^y_jjj ~\vX19}o1Bn u9 |QP% 9u#)\[@I&@.h#HZYt X؍e[^_]UE @E E@E]`UVSutYSC t } uC0.@0.R- s- S- 0.H0. u,.te[^]UVSu0.@0.`.؃8t VPjZY.u 0.u,.t e[^]Ge[^]UWVS`..1tJ9tGjP ZY9u؉e[^_]UWVS0.@0.ƍPWY11ɋ`.tx?tBA'u9t hd" 0.u,.thAy jVS19}Vphv" pT+HQP yPJ T+H Z J GSIXe[^_]UMtA'1`.]UWVSu^Nj7t#vuY[Åu jWXZ ׻؍e[^_]USh!GZtaujY1"1.tP{ Ã.X؋]UWVSP}U UWRW"ơ0.@0.$3WgCC URTC0.H0.u,.t e[^_]e[^_]UVSuV[t#sVZYu} tC t1ى؍e[^]Uju ZYt@UWVSS] 1}uFYj=GP-ZYjWnZYu$Wh"5P+ ;ubEWhv"Ep T+HQP yPT+H Y뮋J @PW^XZ듉e[^_]UWVS5 . ,DAt]jEPV..E B"t%MAEIB"uV)PRh" .!B"tQ..CB"u)BUPm.NjU. .Xu,ƸN ~|tH9= V~-t >޸(%)&#Ƹ ƸN .e[^_]U5.Ph "`UWVSR5...P&É5.Y=+t *"uMt;uU&jEPSÉ 8uE8t+8t;"^B" tBUUu؉e[^_]UWVS}։ϋ [M]Pw$"_" ] ]u k"U#UBu u|" uuuWV uuWV3 ENj]ÉeEU+EUM? t1M? t1;u] 19u] 19u]|f1;u}}U1#U1E1 U1E1 1*]!؋]!]1؋]1 ] ؋] ڍe[^_]UWVS }Ӌ7V+_=.%us Љ UU_EU=.&t "JE..S1 }VڋExYtEUe[^_]UWVS(Ɖӡ..EЉU:tSUЉt@ vSUиƉX^MƉׅuGMIt!EM̍YWVщ‰=Y[ƉWVh j]SjSuw  e[^_]US7=.)u []UWVS,}É׉MԋEEEH7..W ]ԉE뭃$" "tCك9UЋE4Éָ"=.#|Eԣ.}tw PÉ֋Eԃ'wI.}1҃}'tRPh jUR4jUR7Eԣ...W]ȃU]..WuЉEiY1 1..WuЉE6Љ҉Xz}t "A.}twS.4Ɖ׸1҃'tÉRPh j}W4jW5.  "둋M΋EEʍe[^_]UWVS}EUϋEsá..EUVUL.Kw\"8"}GVQ.YYuRPUMY_Kw#"9M~߉EUouȅtče[^_]UWVS}USƉ׋ .AZwSj ƉXZ=.uJE..MQ1  SUEY 1ۅÉ!1e[^_]UWVS}U?WNƉX=.uKE..MQ  fWUE Y 1ۉڍe[^_]UWVSQMq}W 5.XjLPZYt5xIu,xNu&1҉Uj PsZYUtB@)։5.@뽉. .1=.t Ң"PEԉUW9EԋU؍eY[^_]UWVSRE} -"_4+0+.5.NW;t+ .sx)@׉ċ7 .tx @U@ UυyٛP+4+RX5.SƉRPh# e[^_]Ë.Ѕt#/tt@. @.US]u1Z;/uPh@%ՁZY@tEPSƁZY@tҋM9u;Eu3U3E ]UWVS}VVP7 tS辗 .Y]e[^_]郘S} Z8"u뺅u 0 Ph" e[^_]UVSu= .uG=+t0+h"tPZYtS/ .Xue[^]1e[^]UVSuW2t = ..tP Y0.@0. .. .jM0.H0.Zu,.tI = .t.j5.h"Zj5 .h"Hjh"[^1V@$n.VP: 4+0+. >/t[5 .>t'.H.FxFCXVԀ~/u#.Kh!VZYu$4+9r 0ƅuh.K;/u>th@%VZYt .x/4腘X/ xXV>t.H.FxފFC94+u .x/C 8X/=.u$.0.@0..tP X ..54+ .j5.h"j5 .h"0.H0.u,.tB؍e[^]UWVSSuE E}0.@0.VZy$ 0.uu,.tkEE^j*á0.H0.Yu,.t}t)=+u =+tt5 .Vh";XZ!Íe[^_]UWVS5n+ƅoh "Yt ^t>h-#WiZYEth!!WUZYEuEEEEFHπ\ug}taxP0tB<wI$"AH1.62 . * & " ƒ0wG\9uӡT+HyPCT+H X JS>1e[^_]UWVS]u }+t+9tx u h+X(.X.uAPh|!hl+ $.t$.Ph|!hl+z t&WVhl+* x0h$hl+QZYxSt Ph#hl+3P+HyPP+H X J El+e[^_]-e[^_]U8.uU4.jP{UU ,.0.@0.tuRj yu0.t ,.U,.EEEEjEPj =.t=+tj;jjSj U=.u .E Puj$UEPu uUE.jUS]Su 0uUeuu 0uUEPu juUuu jguUS] Su0H ]Uu u0+ UE Puj Uu uj UM"ft9uPU t@Qhe&j h<.<.áL.UWVSP6YuOƋjjP{ǃ t 3;ZC jjPUǃ t s{Xe[^_]USj[Y.8tN++(T.thB sXZH.XVjjSP5."1]W|$wUWVS ƉӃ=t.uj'bk=+u5tUUUt E܃PuRXZ=l.u V軄X[VXu P.tje[^_]UWVSSE} _4+0+.5.NW;t+ .sx)@׉ċ7 .tx @U踅@ Uυy袅P+4+R跂Y`.PSxXZ P.P.e[^_]UVS]h.1jsEYX=+=l.tUl.up.Hp.yl.빃up.Hp.Yl.MwE5P.=P.; ut-t)E Ps5P.XZ=l.Qn h.5P.e[^]UWVSu=P.=+u1EPpE؉E܋^Zt$hPSK =l.h[E؋Eh.]؅:F.=6+P .PPhj!v P+xWPyPvP+H =X J=sP+xWP_yP8P+H Y J 5P+Zjsv "E Pv<=P.=+uNl.t>up.Hp.1l.Hu"p.Hp.l. h.=P.EPqXe[^_]UWVS]uV跀E؉E܋S .jPs!J[tt=l.uk{t_G.EpWOZYt@1=l.uA=+u81; u{C.u s *P.ZYt‹띋[1P.V讀Xe[^_]UWVS]} 31Es(X=6+{5. .P豜Ph:"Stj RU5P+UR hN"PXu h]"@XP+HyPP+H Y J 5P+Z0.@0.ujSduSPExtUtuduu 0.u,.tdjsvWs Uu P. RXoP.X 0.u,.ttJ=6+tA{t;5. .PFPha"P+Ee[^_]e[^_]US@8.EEEEp:X=6+tlExtc5. .PȚZYEP$:"[EXtj S5P+ [hr"eY5P+[EPMjZtiE8.4.EąuKt&:EP$y"Y5P+XԋEtP.j58.i0.@0.Eȣ8.j EpXZE 0.t2u EpY[0.@0.E8.` 0.t,.t6뾡,.t&Eąt"EPP$"DX5P+Z]UWVS}] CCC =+EP|0.@0.EYy h" jWajWPuu50.,.t\u<jujWuE؉s 0.H0.Zu,.tEP|Xe[^_]UWVSE 4DžHH.`.0.,DžhH.EP{YL.E@.txEXt7u!C.htPS7D 1 sFZtҋ[ŋxEp X|EEXtC.s_uEDž<tj|PSC [뵅tt+P+HyP#XP+H  JvPX6 뾋Ep P+tRVP` t vHyPXP+H J 5P+[_y|sjh؎"Vv u `ԁ}F hh8<1(Huw)<)<88t#`E| htfE=.u Ext,AEftfwE=y t=z t1ˋE@ft50.@0.ju2\[^DE@@4t14t>Dž@Ey h".=+sf}hExt x U.P.H.Ãt t7 0.tS $h",.t ݍEP8bYt.4.uH.j.uP.P8.HE8.h!|GXZ@D5H.RuP\4H8.P.=H.H.ujjSTi @DSRuPm@DRuPPn 440.,.J@=H.t*u蠪$u_X440.,.t~뼋Eft`f1} @4\+d+X+`+@@@4t |lPEp Y[}.f.HftftfuEEu E u=̏+yƀx u1ETtE u =̏+yuZYDž5Dž\t̏+f~tF\DžXDž`juEP]` W`.Zu?/ug`9\|Y@Pho"EmZYtuYDžt5.hw"mYZuz`9\hxPW0IYZy.8Br84dX"E%==.tlEWLȉ`+4+$>_WB^ju3ƃt fx`tWuh|"QW`bXZ0.@0.dTujuY_f~udfF`FDžX BtEt$jXPuh&5P+f`z0.@0.dTujuEXZf~udfF~ 0.u,.tF FfF CfF fCFCe[^_]UWVS$E1EE1EEh"uEZtQEbw$"E1EE뽾EE뤻띅uutjY1҃}u3}u-}u'}u!EEEE.81.tWFft'ftfu=}fu1} }u#}tуufuUSVuXZUЋ6륃|u5T+载^T+@h"[EjVJZYt]@ft<.fu}u>.P.0ufHu*}"fu}}t˃=̏+x tH.PuЍEPVt f}u/6tf}tjVY^t jPXZfu]]u}NEe[^_]UVSu 0.@0.juTË@ZYft&fHu sXfCFC fFC FC 0.u,.t e[^]e[^]U 0.@0.fEEE+fEu EEPuN0.H0. u,.tUjuZYtfxupgX1UWVS E11h"rZt&ptvtVuEҾˋE ctM t Ph"t h"E .9u^Ǧ"ct-"QPh#"uSa_"uFjScXZ1ۅtHwh"謼Y_ur.P.u* 8uSP5ZYhM"j w袘 th["λXhk"輻X{.8tT+HyP胺T+H {J P}u#jSXZdGfEGETPjEPS1EfftfHfj/SZYu]EEԡH.}tEjSEP3EPXMyuզ"u-"Phq"[_udjSEZYuuQhE#XDuq0 PhN!޺ 0uhx"u~t}7F>uD}tt\JCt0Pxv"/u utFtFua .EZxvtuGXtG;Mu5._txP5.1[^yW9tt3;ts+JxvtuxE]C͡.;EtP9Uu8/tMA @%W%PtYE9.t@/>tF1tJxw@tu@p,.tSiYF/|SZtx .u p.uȍP jRlt; tltRu藼5., 뇋EB@JHu@/VPXZfe[^_]UWVS}P v Gu+EHEt7_rxv"tpu uߍ_Ɖ+E[^_]UWVS]{FFu$.si$.Xu11@.+4+EuE=++<@!<*}tE<WE)HPhЧ"1}E%}}tnUJ~@.H.Fx@.H @.N։U?H @.NU뻋EH1҃}~׋U)@Eu uPW1} G@.+ 4++Eu)@..} u1< @}Š" <w2 .x@.H @.U>H @.U .x@.H @.Uu>H @.UЈFƒ v! .xM@.H @.FuJ .x@.H @.ĈU>H @.U뫈U=H @.U1uut?@u=.uM @1 1E @΀} M$h"5@.P@._X u  E PuhY[E؀x1 .@.y5=P@.=@.+=4+uuuuWu=u#@.+4+)ʉ@.@.uuZEu=uuuWu\euEX~1tuС@.+4+Pu }uduڋM}u EMEtr|wt<.<.׃uy}Qt@뿃uHuEe[^_]UWVS]E %EEE tE씑+.u .E@.+4+E;~uE t u SXZE 1Es}B~< ^$":=L{s{u{y{@u{=uzD.E} t .@.y:P@.1e   .@.y:P@. .@.y:P@. m=D.t*@.+4+;U~xuH@.E xuE E % .@.y:P@.}u C< w .@.y9P@.s[ .@.y9P@. .E#E PVu R<.pZ<.<.VXU .x@.H @.U>9H @.U߈E {~=u}Eu V[X u. .x@.H @.U8H @.U߈EE Ru4uZY@.+4+jPHP uމe[^_]UWVSEu ]=Ɛ+tD.P <.4+@.0+.,.(.P.Sp XZu&@.=.u7@.. .@.y7P@.@.+4+P4$. .XtCh .W+$.$. ._XÀtS5 .q+5 .eYWjp4x$.$.XZh$. .tNFe[^_]Ujju54+@E 4UWVS$EPEߋ5@.+54+hREС.H.ZYx@.6P@.=4+V W]S|4@.+4+P35.W$EԉUS44+@.)Љ@... u6@.uuh j5@.c@.׉Gu}"tj)PV[ @.)O@.)=.EЍe[^_]UWVS] =,+5<.,+1}DPuXZ@.=.uk5@..=,+5<.u54+}t }tGwE8tVh"hl+Rj="Eu"PSE)HPh"jVS连+@.5@.).e[^_]UWVSu=,+<.,+EvvE%HPu~XZ@.=.uf4@..=,+<. 4+}M }} }t=9s@UVWQM MUt <CÍY9s16UVWQMM MUS9st{u8u@@9wsS맍Y9rVSQM SMt9s{u8u@@9wsS뼉A9WVSQM u;Mt;uCCӈ)ȉ+@.@.).I9tKCCG+@.@..x C@.2P@. @..e[^_]UVSu]S0F <.4+@.0+.(.jvX.H. x@.72P@.@.+4+PA/ju PES0Ee[^]UWVS} EHPhW,".T+pVP[^yP}T+H Y J1;]}4HZCVh"ґT+pVP^YyP!T+H [?J4T+pVPYyP܏T+H XC;]| J1e[^_]Uh "Uh "UUM Џ+t 9PuH]Ë .1-Џ+B t xt 1z1. .UWVS}u ]0.@0.Џ+z tj-Џ+J B ZB$B .P.P.P XtK =.5. 0.u,.t e[^_]鍟e[^_]UWVSQ5Џ+^ 0.@0.{t-WRU_ZtUD< t< u H+Hg C.C.C .F $9tS$ X 0.u,.t e[^_]e[^_]UVSPЏ+B .tAu x6 .xzh+Uhl+K[^=.Џ+X.hSЏ+pb yu..By8tЏ+xud8#ujjjb xtPjjqb xh-"Ym.Џ+@Џ+B..BÊ5Џ+V@t tBV+ . .1ɅtPCË5.V.+.H.u=&+tE5.M5P+ыXZE.P.~e[^] .x.P.U=~u! .x.P.]]UЏ+.P .P.Pԏ+Pj8~)Џ+@@ @$@Џ+XUVSu] 0.@0.h VqjjV`tjЏ+@~PqZЏ+s{uh(CX..ԏ+ 0.u,.t e[^]閛e[^]UWVSĀu0.@0.jVx_Y[y VhJ"ݛÍxPSh{_ZuE%=upjjjS u]jtWS^ u"jhX"W, uS_Vh]"jjjS諎 tS_Vhz"ISo^9uS_h".u Pp0.H0.ZYu,.t舚e[^_]UVSu]0.@0.} t5.V[Z..ԏ+ 0.u,.t e[^]&e[^]USЏ+0.@0.CxPoXCtP Y{ t^Џ+S Џ+P .P.P.@ԏ+0.H0.Zu,.t ]銙]áЏ+UЏ+;Et!=.tG}.t h"ϙÁ=Џ+.uU=Џ+.u]U}u$Џ+@~PnЏ+@XUE9 +uE +]UWVSU.)i5rO9$+t=.}1$+!߁9CtF9u }t}tVǁ[$+t?iӀu.tiրu$+$+XZ[^_]UVSu95.=.0 +tPmYjh5![ +[Z@u$1SwYuCuAS_ +Z@t5 +l +hk Pm5 +}f.yhè"萇+X4^;.t jj[XjjzjjzjjzY^¡.9t PjZY@uD0觭 hd5.5 +eY[@0z hPh"+]¡.9t&Pj蝅[Z@uޖ0A hPh"5.5 +?eZY@u诖0 h5 +k +jjyjjyjjy5.e[^]UWVS]u+.i5rOCSh="0.@0.19~Qi@tǃu=uFjR@ZY@uՕtP3 Phd"9+.i5rOCSh}"ĕr+J΃utBƃ 0.u,.t e[^_]e[^_]UQE0.B0.9tERܦ EZǀƀ1 0.u,.t鋔UWVSTÉ։Mt&uPhX!S KE:EtM }~EtEtPBEMB;EtMt'Et!ǃt=tt t tM IuE0u#E@VYEEHEuE9u]=.)i5rO $++9t# ti1;J-R@Ph"jEPh!jEPЃ URZEUt%‹E0h"jRU衃URǃE@T=uh"RYXu*tQh"jRUfh?%jRCTu =t̉UQF j URP,E@Ut$RSǸ@)$D=Ph", U:P)lj$UR܁XZKySP Y P G~SEP襁XZEtP}KySˀP _ P KyS詀P|YFP|:}M}tGPh^#S iEM0EKySKP Z P EEE~SX?e[^_]UVSMt$t 119}/ivtC䋉1tJiD} u&ƒuu=tă[^]UWVS utJ>%~W+[tW&+XY"6Ft~uL<-tF<+t<,t><%u:$+ͩ"$+i.ܩ"..E1MxdtS~JH~?u(UFPQMYZMUt UQW1*YZUu뗅"V*ZtV#*..XJxӀt~i90tF΅x+9.~#i.tܩ""1ۃ} uVPH؍e[^_]UVSh-"j4X=.tYh "rT+HP}T+H YSb.Z8P.xj.0Y^u h"觎:P+.i5rO@Ph<"~ 9DiPh^#m~FXZՋJ ;1e[^]UWVSS111UhD"L3YUt$jtptguܿպξǍ7H~hH" .tyt hp"躍UjPXZUt 1t+.i5rO@Ph"t$PhX!}[^1tHi019i0hc3":}T+BHBGYYy0R{X9H T+ MAT+ M9EMeE AEre[^_]USE.t Ph"腌jPZYtۉ؋]á.u!. .Jxu 1øUWVS=.t15..NxtS_...J0.B0.uhc.\iPMË..i߉^19~i9uFP .Z.i.1ɾNtBBt. 0.u$,.t荊t 0.@0.fǃ=+Ѓǃǃ.?} ~iE P,X 0.u,.t؍e[^_]UWVSu]=.u.8..SSsXZu .}=+tpt u /8Wjcx^X}u-W5 + XZY@u萉0 hPh"褉SjlSjl*}u$SjsSjstAt8t$=+tSjlSjlSjxluI.=[ujMjh $L th $hJ"}uke[^_]US]U M=+u1tЃuEM E[]: UWVS}t EEPu EPǃ u=8.t0.@0..E1i.E9i‰U܋UUEE9Et}9uOH%ʃu9t1}@ƃރ}tuދHtʃutEEi}t$E@9t}t 1҉t]u tK=.t =+Ƀ;u u EttPEuP+ 0.u(,.t&}upe[^_]UWVSjjjà ~ jjj=+tQCtN5 +T+^9t7+P5 +TZY@u0N hjPh"1.95.|btPu=.u>S`X5E t t&tt M ڋEF떍e[^_]US1h"*Zt$ltptZu⻀ۻԻ͡.u t8t Ph#cjY[=+u =+u@t4j.0‰١T+.P.YZxuS5T+?XZ1]UWVS,1Eh")_t)ntput h"}.Eȅt2jjS|x uSh"jS[Y^t ShϪ"6.EЅt'}uE.8E. .=.Ix0}t ?uǀ1jPXZtpu}t@u7jVZYE؅t j7S} =+VXu EЃu܃n.8t}E E؉E؃e1E. .ME1Mx2t"t uE2uE̱ɄtẺE܋E܅U܊9t}tPjRUY_E؋Űt3u/1҅tHi4hW,"j}WE܀uPZ}u}Mt}jWS{ o}RIXtHEEPjj @u l耉EE܅r`E؍e[^_]UVS]Hơ0.@0.ujSj 耻t-V5 +iOZY@uـ0< hDPh"u%+.i5rO;$+t \jS>Y^ƃ=…uutt tjVZuSX 0.u,.te[^]UVS=.th "jP-XZu h" Ph#pY^9~iPh^#oFXZ١T+HyPInT+H Y J r5 +M^Z@uS0趕 hPh"g0.@0.SSá0.H0.ZYu,.t~؍e[^]Uh-"T$X.US] h-"5$X]. .uPUS..9|:t%uh۪"hn.X A1Ë]UWVS]fE =..E1E}sF~<}%<T~<w=$"$ "9<=<' Pހ<\sC1s[؉] t" t"0 wF" t "Ӄ8t "B1tq&E}{ uwsr)Mx&t"g}taE+UeuB+<}uU:E@{u)EP@/E\U"" $"1GGMt tBBujt }t"MGE.=.[^_]UWVS]=.;$܏"*"^sho" sh-"[XZsh2"h7"Xh7"[Xust4vZX>t h:"c_6jsejs [{FE^".h#'sY[EMx&[h>"shB"s{ thJ"s XZER"hВ!hW"Xsh^"sw EЮ$~hj!ws oh{,"ejslh^"Qs0hd":Cp/h{,"%s t9vh" v ; uhj"hn"_vEr"sYEw"CE!"1$"%1"1'"1" [-$S9tRhW,"j}W)jW[VRZw,C y E"4PhW,"j]SiS $[ E"Ejr#e[^_]e[^_]UVS]u t0u h$YSZt{t h$X[̍e[^]UVSEp5.=+u=+ۀj.u QX=. D....e[^]UWVS}]5.t/1}t3=+tޅttVSgYX}u(+t?Hi@@} t u P XZ؍e[^_]UWVSP]u } tu,EjWVSE#w02 Ph"wPWVSe[^_]UWVS}t P. =P.dPXX.u \. p.`Dž\\9P.~jh"`P[à u\P.dP_OP^;4@8ux/tFI@xPSpZYyEE\.\u94.E} .u"e1t:t@u=.h"S{F^_190+XX4+5.߉SeP+xWPYyPdP+H X J EЋUԋ\..\je[^_]UWVS}uVY1ۡ.t=`=+u3t/j5P+jhl+c+1PkFZ=H+u?1{=+urXu=+t`=+tWh"dXC+t'=+u1҃=.‰.jPzY[1V評Z(u̕VTXe[^_]UVSU:0.@0.jR08Y^x jPXZ 0.u,.ttx=+t01=6+t 6+1ۀ=&+t&+11j薕j\j舕 =+tt6+t&+e[^]^e[^]US]0.@0.jSd7ZYxjP0.H0.ZYt ShJ"s,.t"sjX]Uu}~E p P`^1Uu| Zu h"IsUu u蒁 ZYu h")sUVSuVr@$VPu؍e[^]UVSEX90+}]ށ}0.@0.FPb8+P4+50+8+0.H0.Zu,.t r0.@0.54+4+)0+ 0.u,.tqe[^]UEuj h "j?4oD4+)0+4+UE8+4+P0+P.P .P.]US]0.@0.8+9t8+PS XC4+C0+C . 0.u,.t ]q]UU0.@0.B.R~0.H0.Zu,.tpUWVSW 0+\ k0.@0.=8+54+G9ui.ta8+CPW¡8+8+J 4++0+.0+.^^t5;8u1H+pp X@MSNjM4+0+X 0.u,.t e[^_]oe[^_]UE0.B0.4+)0+ 0.u,.t]o]US0+,+x&~S54+P]K.4+ 0+.4+؋]US0++.x0+)أ.4+[]UU4+)0+0+4++U У.]UWVS,ME 11˅t MPnZMwDGƋ܃}tE0v h"!oFPE0u _E1t0wLG V|nYMVuqMM̋3XZ̋EЍe[^_]UWVS81EE h3"EZt/}pt}rt}duܡ.EЋ.E뿋5.>u h9"]ntj5M_t S^5a[jh.!ekEZYuEX&EP4+0+._EEEjMQj.1 HU߀\Mu3}\}u,jQj0 H} tU߄tA:UtwtʈUQMu9ZYt֋MQhX&9ZYU}] .xC XU߈+4+E16E=.u2.#;Wuf9ZYt*WhX&U9ZYtKE4+9s}~}tjuh.!ef j54+6Sf jh"Pt} . .~u&EI .xC_&XU߈MMh.!6 'ZYMu0I .xC @+4+PE[)u.j54+6~e 4+0+.EO2EPEԍe[^_]UWVS1h^#E^t0.@0.jXPX0.H0.Y[u,.tj.1rErƀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD=wGuD=xGD=EPEPEPht"ZVh"ZXZ ,DHtI11 MqЉvSh"$MDЩtB:uυt Sh"jPq0.@0.S-XtҁRWWh{ 0.u,.t7iui0 PShɬ"iҁR3WY5T+WZT+@th"#YXEEe[^_]UWVS$f1Eh"nEZt*}St}at}HuMփMлɋ}ľ`"F9t >uWh"h.8}ԅuxt h^ h}uEh,!u{#[_}EEGO/~998;Eظ ErRk] eڃ0ӉM؉]뽅t uh"L^ 1RShj ;EUs uh" }E}uE`"11EPC PN sCP3h'"WEEEt u}eEt u}euu h,!WY%C 1RPWVƉRPh="nW } Ph$TWXZ}u ;I11ۉM؉]܍}WF P~ ZY@M؋]uf0} PhC"EE}tREtM]tM]WF PT[_yrf0| Ph\"f~ uajHd./tM] EtM]uu hu"mVY!F 1RPSQRPh#LV 5T+dTZT+@th"UXEEЍe[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]E0 w9j EPS%`M t#9t9uƉׁvSh"Sh"Dee[^_]UE0 w @8u1]Ét2USe+t1:e+uf+@uf+[]Èf+U+P#P+P9XZ=`.tM=֐+uDQPRQP*`.QXY"t%jPh"^ UWVS}] Fh"S_$1ۃ<`+u,d+Rf+h"RPh2",T]B"CuġT+HyPwRT+H ^ J 1ۋ`+t# ^tj>Yt + =+u=+u+=+u ++.=+ut 8-u+1B.X.P..jP.X.XZ=.t6빋u h"^H ..Pt......1ۉ։B9tt 5. .e[^]UWVSQ}~h"#uE pZ.9} h"?^0.B0.)أ..ljNx=.tE7o XEy1ۍ .1u. 0.u,.tG]1e[^_]U}ujjjjITF0.@0.j.Z8tPgX 0.u,.t\1UU0 w!j jR Hu..UWVSuEt;uLu+E@1ۿ?A8-uލXxtՃx-uxtE8tduNE8:uUEjEPhȮ"Và !RhϮ"hl+LjhȮ"[1۱?Hx:u뚉떍Kx:uk8{u=u=E:u$MUEjEPhȮ"OVà M^Rh"|9uUjQhȮ"Và 1MUjh-"hȮ"Uà MU+E@1ʸ11ɈUU PhW,"j MQKhMQh"U ÊUUEjMQu U( t E,NjXZe[^_]UME  h" [P u.=.u...h.h.RppUVSM.t8u;.t+8-u&xt Z.x-uxt @u.1gtp8tuRh$"8Yy:u܀y:u-xu.H .0u Rh7"Z5.15.Ѝe[^]ËH+z8U .x@ @H+J8H+z8]ÃxuUSt PFk XK]HÃ8uU@8u]UVSƋXCF~h@0XAf@ fZfXfZfXZfXZXRfPȍe[^]Uj@H+JHR P UPUSUJtXxv-u~u C $t h "H+B0+B8PCXe[^_]UWVSԏ+E3=uE8t h"154+0+.} t u Eu K9E@EŊt 9u uԏ+H+PP GӁt uu -j+}Wu, .H}t .R\uG.x\F tp\.à u! .x F Op ԏ+9 .xF /p uԏ+߸=ȸ=T F>ԏ+H+PP .xF @4+)PfH+Xԏ++Ee[^_]UWVS@} H+B ]urVUY wVh"Vh1" 4"hL"j"SESTZ؅tWhZ"}xM4"ho"jPkESUWVS]S50+M EZY94+ulPnT_H=`.9s<wDu 9wMW5\.c ZYt%\.=`.M܋=\.5\. ""Se[^_]ø-"H+ztLUS`.tt"u*-"#4. .5ԏ+P`.ZY]UE`.jZECU茶\uH肶 u"ԏ+H+@8xtjjX jjh  ?UVSH+Xt@XCx tj`H+@ ZH+@8ԏ+P0 .x.P.0ʳƃ)c t,~tŁF $ " ԏ+H+PP @\ |td;\=t < u?&uH+@3轱H+@Y|uH+@肱H+@&t;u,H+@ H+@ ,H+@H+@tH+@a6=t0 u9ԏ+@ԏ+H+B0ztjjUXH+@衰jhœ"Và ؍e[^]UWVSQáH+@tul =H+,uyGEt7"t,O8uQP YZu"^_8Et2jw\7XZt ^SP4$PS Rt H+@؍e[^_]UVSH+p$ t jjH+udX(x,u{ upV8Zuh"P: uBPVpH+BCYt‹(wjpV P0+P8RF Xe[^]UiH+B]US]R9tjS]UWVS/t u%mj >8XpZʡH+@؍e[^_]UWVSVH+@}t11NYt"t19}}H+@};uEuPw C'uj yX@[Åt^uj WxXY\j :VPXFZƉ9 }uKd[Ew9}tt8H+@6t"}t jj H+@؍e[^_]UWVSdEӉMH+@EE8.EuE+4+]EPZt>uY_Et EP^ ^EH+@E8.jP0.@0.EE}~uE[E54+NjME8. 0.t }u,.t>L5ԏ+=4+0+.H+x tjYH+@ Ã`u8 .G+4+~PY4$jPN ] \t=H+p0h"豮à uԏ+H+PP \ta`t\$tW.HMIMMDt"t/.x\G%x\ԏ+H+PP " .xGWxH@tjQZH+up1t x@ԏ+EjXԏ+E}tdt jjHH+xjYYp}t:H+@0+;E}4+.}tMߋuME).0.@0.u\ E0.H0.Zu,.tIH+MHE8.E@EE5.Vfxu@tE.xC @]+]Kx< .x@@.xC @e[^_]UWVS]U DžlDžptH+ ԏ+H0fDžz"t fDž~ fDž~DžhfDž|fDžx@8EfE=4+0+.lDž`F|b"u ǃ=.NjFP< $H"œ"fxœ"u fx .Gdԏ+H+xtjjZXdFf@f(Ãx[T."jO tn@=(@#$"Džd'0dPЃvD\ԏ+H+     \PЃw \讦@;w`u h."\u'dƩ\du ӃLhE"ϻ?u6Džd Džd11ۉ\v@Ѓ \w \)Bw \Bw \ A;dud(=w h]"#=. ǁw? .?ˀC< vG .GG .xwj . ?ȀP vW .WG .?ˀCJ< w .JB .y}w= . ?ȀP vW .WG wn .?ʀB< vG .GG . ?ɀQ vP .P@ .  .?ʀB< vG .GG .?ʀJ vH .H@ . ?ȀP vQ .QA .?ȀH vJ .JB .?ˀCQ< w .QA .zhx" ?À u .tM t)='% \u*=uh ">ԏ+H+xtjjMX븊" <w .G .fxt @ .G豥=u ._\N u%ԏ+H+@8xt j[jVHtu[y>ud|ud&du y1yt|&dd@H+j+C(H+@(dHԏ+PZ-H+@(u @ (@ dddxH+dH$ H+@ eH+`H,hP d H+xH+@ [ N(\u5. .FDB .B"dGjhd5.H\G{t B".\+=4+X .X@Džd{Džd#Tdǃ}TtqB"us ,DzuftC7}TupKTcd.e.jjhd.T T7TDžd Džd B"t5 .x C\{X\B"uuQЃ w= .x C\>X\_dt:@Ѓ v0t .\XH/{hȱ" .x{=\x=\duh%t8:t#u3DždQh"ZYÅt"X\\9uC4͙-d u}t hٱ"#讙dDždFfxufxt dCwd@d ؋4+X rƋ@f@f@@œ"@'uAV|œ"u1.\Ƌ@@"f@R.\$还M .B Ƌ@@b"@f@e[^_]UWVSRH+1ۅtXC1H+0x tjH+@ XF8Pv vS‹FP U8tSjH+p蝝6jh"PH+HUJ@ B ӝ[e[^_]U'Hu)]UWlTX8.ph6+d(.`}1H+\DžtEP蒲YE8.(.EH+Xjl褜 :jh"P H+B t$Tt=+ lttDžxDž|RUX}E6+jjxPx 4+tn\H+d6+hZp8.`(.4.u jp花Džt-"u^j5Džt"\H+d6+hsXp8.`(.tu ltt}UWVS H+@E} H+u@$x@@$"jjCj5jCu;jF EjrUBjj^UB뻡H+xu j?F Y F @jkj BáH+x $CjjCjtH+@M uH+x,u p+Zu h"|j H+PS @0C>H+^x ubx,u\h%pYZYuIu@ H+up0OpXUS@PvjjlHuE >j+@@+@ @H+J0HCBHYvBH+@ttjjjCV%H+@^Xj H+B0+B8C j H+p0_C5H+ ~ uh%v%ZYt h%CEFH+xjƋE0FEXH+xuH+x  jj p0‰EEUH+@Yu UBE밡H+xt jj@0FjdF H+@>Zt-Pv jj u H+@ FEM@}j jCCZYtNjjX=+tt3jHH+@X&}tH+@uWhY^Xjjl H+u@$x%@}t"t;tj gXZËEC؍e[^_]UWVSS} uE EE1]H+x H+u*p0ƉXYtաH+ptZu1뿋H up$E0FEh뢋}O9u} uyjH+ ԏ+H4^SZYuh)"Svj/v t hH" H+ԏ++A8F FH+@4S@u} u jjnEj @EFE F H+@0FXe[^_]UWVSPH+@1u=+tt hZ"[GܡH+@YZuYj 聼@EjjËUBp^XUjQC YUt֡H+@tj)pZƉe[^_]UUH+@@PtjjXH+@ t/Ht3H+@jH+Ytrrhm".H+1U11ҋE]'UU Et 9Pt]UMt.tPt9JuB]US]j SCU PUPX]UWVSuEP[y h"-~Wf-Z=wPWu ]jjj膵 uKu jjjjjjjj$jj Svubju Ee[^_]1=p.UUE M~t E@] E U]bUWVSu] 9t:Sl SVE 9t,8VQ W C PShI",V9 X؍e[^_]UWVS]{t97Gu p.} tWy P X PRpZYW> XCe[^_]USt.0.@0.jSt.S= 0.H0. u,.t ]+]UVSt.t/}u jS8ZYstFxPN X6͍e[^]USL+ @L+ L+ ~!CPjj x P Xڹؙ } l.]UVSul. ~;d.|y5l.j VI à x 9t PSw hb"(S Z 0.,.'WLX~Euy=+up9tZPSW y@'0W| VK> PSh"(.'j0)PVh"WUjjW I19u>e[^_]UWVSÉP_u S>Yt uhj jS XZutB'0= PShij"Z'jS\ ZYut'0z= PSh"%pt @e[^_]UWVSSljWÃ}tWh 5T+ E-"tEb6! "T+td#GtQuha$RW҃!t#)t7Qh"R u1ۃ u u1hT]%5T+tYX 됅ttSh"RY h!5T+FXZe[^_]US]5l.j S# ucl.CPj S tCPj S u0j j S ujj S u h "%]UVS]t4l.9C|sXƋCZ9tVPSs s e[^]UWVSuU 1E E1E Et}jȱ@t.=t.[]^9d.[vaSYES[$4X}up.u EPVK vu9h.}h.9^ uSYu S+Ztj jjS} y<$0: PShX"T$S UZ9US XISwZYO0.@0.=l. 4l.h.9}@PjS ƒ uyE#Ht UtvE5l.jS ƒ yE{#8ujjS ƒ y( \#8tR#09 PSh["xjjRUc URSW0.H0. c,.V"L}t T+X+}t P+X+e[^_]UWVS ]EEp.5+EEh]"u S tl.5EС+E)É]}"hT]%u ZYu}^h1"L"E뉍x+t-tPhb"EE؍] EE؍]W!^¾ "N9r-RUPWt UuF ЋM!hT]%j] 9d.}u}ƒEE܋ptWVػ_>0V YvVh"Y!Wh"}uSE9h.|jM1ҋEEX5T+kXT+@u1h"XE M܍EW~mF^9h.bs%@Hsru,1UPjS @UuS 06 PSh"> !9t'WjSS @u 0v6 PSh˴"+ }j 1}PMZie[^_]UVS]u M1P1<"t#KyS:PMX P"<u~tvhW,"Su S4"ZYt vQuLSh!HSh "@F y$KyS P-Y(P-PhW,"S Sv1XZe[^]UVS]0u&=.u .u0.t]=.uTY=.uZ.tO.8tCt>..@.=+tu0.u ,. 0[^]US]H"t%S负ZuShW,"j h.&.]UVS]} t"KySk P ^ P VPh#S  t?uSh! ZY"KyS P X P F@ue[^]US0.@0..t8tP. X.u. 0.u,.t ]]Ë.u.t9u=.r 1UWVS}u =.u.t 8=.…tlugtQ t'tE^uE=+ۃ4=+u0=.u'=+=+ۃ u.uTEPjW @}tw tB18=+t Gvt=+<u 9uvPWYZ@tju.u jW>XZEEEEO>v $ DjEPj e[^_]UWVS ] {}uh1&s^Zt K}esh#VZYEhH"m j5T+ FEsh#VvZYth, VeZYu81~pEE{M}u$}udhM" [EEh1&7ZYÅLM}t }@ }1}ub11ۍCtA.u6u hٵ" XSPhx$ G ~ h!] X1C@ut h!F X11.tB.8u6u h" _V>Phx$ C ~ h![1F@ut h!Y1ۋ.t7.8t+h".P&SPh?" C@uEw}a}t 1EJ=.}Qs}}.t.Ph"Y^QM.ZMt Q踲X)h%QMF. ZYƅtMQXu?rwh"5P+ h".Zu h" .P XVPh?" AFuui0.@0.t SvX.t.P) X.t jV^X 0.,.E7[[;-u{u1ۃ}E5h"VZYE<1ۋ.tH0.@0..Pb( .Xt jS^_ 0.u,.tC@u.}EEe[^_]UWVSuu .?.tJ8tC0.@0.1P-.PB0.H0.ZYu,.tqOuu e[^_]te[^_]UVS]u .u VSYX.<vjSXZuƃ.e[^]áP.=.u t8u1UWVS...u@@u .e[^_].=.u.t.}W55P.SӡjPS& 5t }sW55P.Xa@Ht .tUS]9.t$jjjjjj.]USXE=.u'=.t.t EEP...P..tEPώ[u Eȣ8.EP贎Yt0.@0.EP蛎ZuR;Eȣ8.=.uԋ.tʀ;t.jSx[X몍Eȣ8.j{Y]؃EEEEEPjYXjSXZEEEEK>v  DjEPjW 蟸SP XZ5.{U.E.HUWVSh"PuZYj'V_Zu <)19ˉe[^_]á0.@0.+t4UP# ++X 0.u ,.t 0.u,.tUWVS} ]1~SWu ~)ÅE u F ~ԋE) 8tÃe[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu.CfKS u>0.@0.s͝C CC0.H0.^uV,.tMFfu9s0.@0.6CPR蝝C S)S0.H0.ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9P+u]e[^]e[^]U5T+uXZU5P+u~XZUPuu EPvE u h"uPJu! UEPu u UE Pu5T+ UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'V_Ztt~tnh<"VZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%h"VrZY<tBEt9KyS'P'X P'E E1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\_ P\KyS`P'Y P'1}D>;,KyESJ 'ZE J 't"KySP'X P'9P+u]e[^_]ue[^_]U5P+uXZUh+Khl+AXZU8ruPhA"Pha" UWVSSEXE p84+U0+.j=SZYj=VZY)߉)U9~߉t/xBC .I .<=u)Pڅxu ]e[^_]骾UM1Au,.+.Rqq h"jh..UVSu]t t;E u1Ʌt911B"Ft;U tB"u1@t)[^]UWVSS11 .FtYuƋ uPGEY1 .t5Nȃu$Ft sVЉZt F6ǃuEe[^_]UVS];uE"e[^]h"SRZYS8 Z9u;Sh#j'SY^ƅu+Sh=$XZ/<'uh"sXuS)Ph"} e[^]UWVS]} sSt$CtS҉XuEsEt Whl#(Y_}t5uhl#XZ$T+Jy Rg T+z9 _F>=u y:Cu}th"FPZYT+HyPT+H X J e[^_]UWVS=.u. h֕.Y11ۋ .tJG} tE t8tEt..9P5.讕.%.XZ.]D9>(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$"SVY[SV _ZYSV[^SVZYƉ׉11 lj։11 ylj։91lj։9slj։h9(Ulj։J9PVm^_xPSmZY04]E9uc9u_E98PVsm^_uWxPS`mZYuD04MU9u9uE98f9]PVm^_t1PxPSmZYu鋅|9u;xu͋3U 3E >~u5!uډx!(u;)u{u ?e[^_]UWVSu] hi.$3述_Zu#NuxtP*zUWrYu UR ,DPtÅt SWtZ@tM}th1&6辭ZYuMtEE8%u$PfX6h:"Y_qj EPu1ljыE 9Euy<8u t-u u-"9uЉM8Mt!뾸n#uPhI" EGSW۵ YZ@u'"|]F!RPhJ% Etu jW蝵 XZMuUVS@y....w55tj=SYZt j"SXZC PhW,"j@]S'jSh"j h+h.!(j h.#h"ƒ "t%j Ph"j,hù"h"j h.#h"$e[^]U=4.t..VH+ .4.<. .=t.t T++P+l+d+tP d+XUj#P.XV(+.`+Yxt@j0.@0.j~XZ1.uƀ.@@u 0.u,.t0$UEt]UVS]u tVs XZe[^]UVS]u "$"Vs [u CEe[^]s VDF4$VsJVs Vs[Vs GsbVDF[ ]VsVs C[XZD[*uFEEh3"VmIY_EEEE8.u)px*uEEh3"V.I_ZEEu Sh"H}f?f}ʋ}G}D"(uC"YwtK"(uJ"7w"wt S"uR"%=t)wt=u&"=u" ""Z" rY"w rs9/b" ra"v޸j"sqwr !i"q"rp"Hw sy" rx"(ws"r"ws"r"ws"r"uS"";t3C P3h "jd,V 1F1:1ɾ"$t VF8t ($h"j ,(PFmPh"j E(P{ A u,P5EP5YX1Ƀ Yt,P4EP4XZe[^_]UtPh"h0,2jU0.o#=4.t"PRPh"h0,jUWVSQÉ;#uCj EPS 8t Sh#jE8tWShI"jګe[^_]USÊt%<#uo#SZt@8.]UE E EE]-UWVSÉU}utj VSD @t E 9v 8"u"3O;t)t:Et ,fDB@fO1e[^_]USÃ=x.t =d.t?|.9t6t2"t!"=t!QRh@" |.x.d.]UVSƻ"t[PVZYuICƒ..C.CD.C 1f‰x.te[^]" Vh\"je[^]UVSÉ֋t8uVhu"jURM1ZYZtVh"h.XZ1EEe[^]UWVS11Dž=.~ Vh"XZ1 RPhS =t=.Vh"|m f}Ut=.Vh"T[^1ۋh,h6"\rEa6Wh"h,vvWh"h,cF (to(!S[tZYu,jW11ҋY_.rh"StYZth"S tYZu,jW11ҋ_Zr.$h+"SsZYu0hW11ҋY_2f.hY!SsYZu0hW11ҋG_Zf .h/"SNsZYu0hW11ҋY_f .ah9"S sYZu,hW11ҋ_Zusf.$hF"SrZYu(jW11ҋY_u9.hQ"SrYZu7jW11ҋR_ZtSVh"X.a<w{t SVhe";=D.rSVh"vjSVh"HT.h.X.h.h<"S"ZYÉ;uVhu"%[^Dž"RY ߋt uvPSR u["`.R趵ZÉ;th<"SmZYÉ;Dž("Co ,DPt2hP11҉TZYtVh" YX Dž"!v#SVh"h"Dž`. .Ct<H$"2{ ..C h.h.17CfCt..C h.tYvh.t217CWK.h.1&h.,Ze[^_]UWVSS1۾"<"tCtiEjSEP蒮 th"Y1@E hz jSPcp1E4FZ9uuXe[^_]U=+t]e ]USÃ=.=.u1҉t%Ph.}XZ eu=.t =.t  s `E E"]Un'!=X.t>(!Ph"P8 ~;$u ~EPV MXZ9@!L|\us11t\Uhx&SUB 9}Sh|L$KXZ]e[^_]sUWVSu} EU MahG8lG,p1pd1ld1pPQhJ@!j@tP'C1w,pC1w8p1w,PQhJ@!j@UR0URtPhhS@!sQhha@!VC u8t/jk} tu Sh"p7 ShTF&`7_X뿃} tu /Ph"B7 벍/PhTF&,7[^띋$t $P/YP"Z}tEajPS yhZ"6X;ƒu)t"=tR芪$u h! 1e[^_]UE.E .]á.á.UE Puh0,h0,j jbUWVS]莓8ށu=.t5.h|!豝YX=`.t%=.u5.h"荝`.XZuu ( ZYyW茩Phı#_ t7=.t.j iX=.t9P5.h"(j蟖e[^_]UE Puj$ UE Puj UE Puh UE Pujj:UWVSxu.PhW%_Zyh"[khWVwU t Ƅ1҉|PSZY|ySw%=` 9u;u.Shh.d ǃ uSh4"Y[xPW[ZyWh$"ً%= WhN"뻃= u+t'ShW謈 t úShl"놈|SZYt?|t50hWb u|h.h#0XZ|랉e[^_]UEPZtPRPh" u uh"hh..Ud.tjXj 8gUSZj0h "jR h.jje2]USj&jjejjve]UWVSÉ֋x CPww wwփt= .~j =&X .e[^_]UWVS... .. .Dž DžDžYu/h"h"[^Dž SUYuWÅuN3hV` ǃ uVh#1XZ PlXEtVh" Eu {u{wu"Wh"h0,裛 DžQCC jhPjV Ãt%$Phzd@S脁 @tSR YWˍZD ,9wDYt)PH .t4KRWQ腁 u <tXȉjh Wh CC C CC.C..Y_{ t%VwTHYZuVh"XZ?j'h Vg G~g G pg GGCG8{DžEtDžH .Eu.} u:E 5j ^tsh"赖s _Xtvhx$蟖6M 9~= . 1;}1U% tE 9}?CNj PYt5 .9F6냽 tr.q^#:u-"hM"Phg"h0,蛘.<]B";u!Ps ssh"h0,bV jsVsUE #9  Ph"tXZ ԉg^ EtPs ssh"Ӕȃƒt.t&Ps ssh)"h0,cDž StPVSt$.C. s贛s講S覛 F .H .~ ut .;;. .?uǃ tuU E t19uUDž e[^_]UWVS]fU ffCffBCffBfCffBs sY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ssY^} GWssY^GWs$s Y^G W$CDȉGDs,s(Y^G(W,C@ȉG@s4s0YYG0W4CHȉGHst ^F)ٸ;MF)fFދGfN=/tww@FXZFEFE@Pw5D.5@. Z[@@fAG5D.5@.f@5D.5@.u uwu uh"S$}u}tuuh"m =/uj lX؍e[^_]UWVS}u w wUXZCfEE9uc/t=/t =/tj jjjw wu/jh"Wo w wNXZWD.9G u ̒+;@.thf%¸!f@tG)"Ph"/w wE)Puh"yl=/uu=/tRyNj zkh"р_X=/t2h"Y=/tfE)fCe[^_]b h"XZHt/x뮍e[^_]UWSá4/p8薿SY t& 4/q0RP¡4/H01z 1҉Ѝe[_]Ƀ=/tf‰Ã=/tÃ=/tUWRPY_}UWVS0u} }- p/t/9]K]);E4/@8]]M9/P]!ыU!M]M];E]}=/tuH!PWVh"j4/MĉEȉMuuWVV EM܉mẺUЉEԉU؁\TtC#ECEUЉEԉU؋CEU؉E܉UEUEU;u܉ECEU;EE=/uuWVh@"i 4/\Tumq#uqmqWVuuhX"piTEċUEU;EE}>=/t0uuWVhx"5i4/uuh"i$e[^_]ÍL$qUWVSQ0QEU;EEsE9`/d/Esuuh"F|..4/sx1uЉ}ԉ t9E}rEU9E} 1ҍMQRPuu u}uĉ}ȉŰEƉE؉Uu܁\Tt-CЉ!U!CЉEUuuuuJ K` t1Ɖ׋CEU܋ 8/tas0RP8/4/px1WVuu ʣ..4/@x1RPuu 8/R=/tЍeY[^_]aÍL$qUWVSQ8QEUx.|.Ӄ x.|.;Uu;EuE9h.l.Esuuh"Lzp.t.E؉U܋E9EEE`.@Ẹ`.4/1ҍMQRPuu u}u}UċEƉEЉUuԁ\Tt-CЉ!U!CЉEUԋCx1RPuuX K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=\.u L.P. T.X.EUܣp.t.Suu5H.5/蝩=/p.+EE5H.=/1;}VV|f%ZYf=u Gvdv`YYF`VdvlvhzYYFhVl1tttpM`YYM؉DpTtA u1M5YYM؉Auv4/(=x/t<EẺ}ĉEȋU9USuu5H.5/ЩrVVf%ZYf=u+=/u"}uFV y9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡H...=/.ЍeY[^_]aUWVSS4/Eu1WVu u  tu uh"vu} 5h.=l...EU x.|.p.t.`.=H.8#KH T.=/ۃ、1ƣX.E1\.P.ډL.t@\. 5P. L.QhKpH.ZYu h"ue[^_]áH.tUPiXH.H.UWVS u=/tFVFV EU4/H0AEUSQRP  w EtE4Pa_< /RPuu  /CCM 11 MuE UCSCC E UC SEC$EC( /1E v 9vt DpTtD(D,T0Gу} w/9/ug11tDXGuP5/dZY=/u hE"t//d/P//e[^_]UWVu} /RPWV /t9xu9p tWVhd"se^_]Ã=/tYUS//\9/w 3egY5/Tg5/Ig//XZ]á8/@ UWVS$Éx@t@SЉ_uDž% s ss 4/p0sszNjH4/P0@t 1;}=ƋA뻋EU RP Ɖ9r=/td/tD1;}&G q1YYQFG W5/̥XZ;}W ʉ@{*c 4/9Ht΋G=/t  T<uds sh{"hRH\RS褦t*G=/tDG  /F4/9ptmW5/^XC /GtI T„uA{@)EU 9|F<븅ɋtT>CS"CCuSЉYu uXZ_gE E J/CS RPRPhV裦Vh"p h"aXs sZY=/t@Si+EU ^CS@S K+EU @CS h" /gX ge[^_]UWVS$uE 8tE @0@4/tFVFV } G$W(ff%f= 4/funE H$x((9f=x/t;9ʺIu!=/t F Fu/~hu)$=/t@󥋅 󥋅s0NډWVRP 1/ t b54/#8tk@DNL##NT t4/@8M A t`d E x@/P @RPRPhSbSh"_m h" ZHE p p^X=/4/tH0ωș!CSp0 CS h"ִ/[BM AQ] CCE x@tPPu 4Y G 4/C8} G =/t f{0k )ډƉ׋=/t$ݸݼ tHM AQDt-M AAWVڋE YZIE x@9/E P @RPRPhPwPh"nk h"/ZHurE p pZY=/t@S<)3CS@S )CS h"/Xi4/Htș‹Љቅ+CT됍e[^_]UWVUr8azu;Bu;B0B4|B0R4B<NA^_]UWVSu^8;uUCv? RPh"-? =/ j >_=/t4h">/^tssh"> j =Y/$/ /k=/tm4/j04h 54/5/5(/5/=/t/PP5XZ5/V /X=/t /j脍X1ۡ/4/;Z,sDtPJEXCP@E/X=/t =/th"4R/_=/=/u hM" R^=/t ht"Q[Ptp0PhW%zZYu90t/Dž,j,R PhW%h~$w"t"=/u h"QX 1e[^_]UWVS0Epxx@u&EU;MEEp WV1Eԃ WVh#Ep px/|/EUx/|/ ;ME}_Ep ph"P =/t h"m_h"N}^t E/jrjS5E@ EE}}EEE̋Uh/]]y&E]]EUċMȃUMMu<P/T/jWV _EWVh#Ep pzp/t/E܉Up/t/ ;MܸE}Ep ph"j 9[u%/h"Oh"{ZYwpx /u /$/ $/ /]܋JZ9Ut 9u9t 9t' /E@0P4M?E9u؋Ee[^_]Ƀ=/tf‰Ã=/tÃ=/tUWRPNY_}UWVS<RP`v{ff%f5/tCSCS lftGj`h0.CpPR urjh.P{R uX uJC C@j0h.C(PNR u+j h/CXP7R u u{htmh"Lh'"yHu=N[^=/t .@ . ~ / h/l/ 4/t04A0;rWA0;r1;s/@u#=/ h"=/uxh-"wxYHujË5/XZ4/@4t,CS CS 4/@4f 4/H0AWQRP Ɖׅy%=/ RPh<"f%f= ufu=/=/:;{h/C(R4/Jd1RPS5/yt hT"/I=/t1Shh"h5JPC(P=/tCCChd4/(/xj9rE=x/t;;s$t C Ct{ht$t 9}~FDžDž~B@tȋ뵋 Ɖס/ 9}A t?Dt Dpt=/u&D(WVPQh"a3|(‹DpTtuWVRPQh"*3U=4/119}rOtRP FNjRPh"2 t uF~8|X=/uDXPh"X2_XSs^uH/L/CAfGf]j k1Yu2/h "~Fh"Bs_Zu-j{j\+PH//@u< SZD/  G=/=/tzCSf@t`@3?CpfCCCtfC-Y^ Cf@up/t/x/|/GW =/tCCpGD=/tCCtGH=/tCXCdb G@WSXZ=/=/t =/C\u"C`Sd uChSl h'"6DhF"pu/>y@\@`@d@h@ljf!_X=/u^4/@4 J4ȉR0׋ыg0ʉG0W4=/ACS;C\t@@C\4/J0D1Dž1 C\54/#8tk@DNL##NT t4/@8B D`Td uO/FVVV^tqCh1ҋO0_49u9SQRPhn"B=/t h"‰Yh#nZ/^_=/tP4@0QCS @05ChSx@jjp4p0pHpD葄 wh"9Ah'"mHvZY=/t .@ . e[^_]UWVS,/E1ۋ 4/9Y,EUu\TtA!A1EUAEUEU11Au}|E|Uh/UUy2EUtDžxtxUMM;uEjCHLY4DEU;uElDžplph/UUy2EUdDžhdhUMMbU1E*c P/T/H/L/E4/}9x,OuuEuui 4/E_X\Tu]e+Q#UQ1E]]]euI RPh/@q5/4/}=/t =/t =/t54/u5/ =/tE@x 4/1҉EU=@/t94/p,kEd1`<SVuPh"h0,+@/=/=/ExU t1U u E#uh"<[^ExU uۋ}G\M]E EtIu EUJu}1uEU9}u9uuu}Et/ËE} u C<}%?}u;Et uuu&|Yuuh"<j 1|M󪋅|CEUEUlpu}9r WVXZ Ms;pu;luËu} h/l/ȉڃEUh/l/4/u}11 9E}e9E]ӹr"\Dž`M]+\`t5/ȉ uv-/tD[y9]u9Mto<%?u9tSQh":jM]W|2*XYҋM]u WuhB"9MEs+}]1VEa/e[^_]UWVSEP@EUE@ E}juu t/t`}9xuPu9puHEuuh#Ep p /qyEpxu}qy /9 /u /u덋=/98tEUMK؍e[^_]UWVSTU1EEbz $//11E4/H,;M=@/t7kEd1M7SMQuPho"h0, '@/E4/U99swWVXZthu}=/tCCp=/tE=/tCCt=/tEWVmZY8tEPSZYuEWEe[^_]UEU @,+B,]Ƀ=/tf‰Ã=/tÃ=/tUWRP軨Y_}UWVS( ]s8=/t DžO=/tt1;`/d/sNj}1RPl@FY_DžC4 C0J>Fh@%P>YZ-CS u9ttFPh2"5XZ"Pbb_FfPV詺 h"*bY<Fh+ZfFNPVWW8fPV2C0S4s sbjfH Dž;C0C4|s sп@XZ=/Ѓƅhh!Py  / /ufC4 C0FxF:99F)ffFC0S41RP@ifH1󪋅fFY_>tyFh!PYZueAA =/~hY"s s+FhW#`H/CS P@ u hq"RPVFD9s~">tFPh~"2XZ"P^__tcuC0S4=/t h"GzYH@ FfPh"^Zu@@ uC0S4=/t h"yXH@ F>ufWV d+fFPVRĶfWV誶tC0S41RPffH^_Dž)VS0K4w\~.uV;}>uh" ~ .u(h"s s赤hW#]S0K419`/d/s h"=/uDž/HuT~tNh"1RPs s`=/%FhW#\[HS9Ht~u렍P;S0S4<!=/=/"R1RPs s転h"W\Hx1RPݱ_Xf%f=@AefGh1RPdZY<<p<t <Q;C0C4hq"1RPs sh"[/"1RP讹XZG G;C0C4CS RPRPhPEd‹x1RP1RQhPd0Ph"Ph&".=/t h0"uYh"ZZH;C0C4} CS GW=/t_V@9tMh;"1RPs s裠@FhW#3ZHt / DžfHqPPhJ"/,u Dž  e[^_]UWVS`jjWb^_P$l"hf",h="xYY[u /ahjjjj螡 h}"|+h"d,h;"(Y_ZuE/h"Y^jDgj%h",h;"XY[t#jjhjjjj ihW#XZ5jjD_X%@f} Ph"*=/tjjaf[^h| j5/5/1ƅDž| //9W=@/tD+5/=/k)VWSPh"h0,-@/C$w5h#ss 莞 X/A1C$hW#WW5X/VC SRPRPhWM`=/C$t5X/RPWh!#h#)*5X/RPWh!#h#%*=/t h"qY X/C$D1C$=/t2ss AXZ=/C$u,GW v'h"jV^Ht/ GWҍ@1=/@uufC$1C(ƒ v 9}L,G HLP fC$1S(у v 19}t,|0`d@ vHC SCS=/t`H=/td&PPзY[=|/u 5/T5/|/;s݋{$@1@=/unfC$1S(19tL,@C SCS=/tLJ#fC$12{(19tD,T0`dA㋅`=/tdPPuXZ>O_ u;r$tGW 1‰1ډ t#@tSQ[YXG GuLGWGW =/thA#ww RPh!wwww MfKPh[#ww wwhW#]Ru/w wZf@fKGWGW RPh!ww J//49s*;ww ZGG_Z8uҋ=/9s0CS tK  KtRPPSXY[jj.XZe[^_]Ã=/tUWVSX//D/;=@/tC=/))KkdN#VWSPhu#h0,@/ss YZYS  S7S St t%5/tC=/t8=/t/u*CS 9RP&Yf@1C SCS t(RPXY_8u95D/|Css~FXZ95D/|)js s+]Ah##h"O 3ssj1ƅs{Dž J ^_=/tBBp=/tBBtVRSZYu h#E"_PsstQDžJ ss~VPtiWf@Y[5D.5@.RWfHXZ8e[^_]UWVSHEP@EU,/E4/RVuu EԉEЋmԉƉׁ\TtC#ECQC RPh/T5/4/}=/t =/t =/t54/u5/0~ ExU t"U tuh# [^EEx EEEjuu诠 EEEEċUEUh/EЊuuuuy&EuuEUMUMMtG5$/E9BuE9BtN^JZ$/VYEEUO}tr}tl4/E{89x u[E@EL@jRPEppX K` tPuSeh 54/5/`5(/5/VY=/Q/PPyXZ>!ӋEЈ}ExU uEp`ơ4/RPuu衻 MEM]ΉÃ]؉%Ey&EE؃EEEUE؉U܊MظP/T/Ex@t+jj4/@4 ؙRPEpHpDp p6a 4/]p89s !}uF$ ]LC 5/! /h/R/Eԍe[^_]Ã=/tUWVSXU1E˒ E4/X,;]'=@/t1kEd1-VSuPh #h0,h @/4/u1EEE/MU99WV-WV.Ru}=/tCCp E=/tCCtE=/tCXCd EP$"YftbWV蝊YZt=/WVh1#!WV^YZt!=/WVh[#b SEPיXZ/Ѕ9xu39pu.JZHX/Rjh"EPzQjh")=/tC CC Cu jh#jh#EP6[WVPh#@ExxPDžTPTx|xDDžx{,;x=@/t7kxd1VWxPhj#h0,@/xpDžt𙋅x‰dxƋdׁ\TtC#xC1QC RPh/G5/=/t =/t #=/t54/5//q =/u-xU tU txh#^_=/th/H/Y=/t = /u/ / / 4/AhdptЉPpƋPׁ\TtA#xA1dAId t1RP5/5/C 4/ptЉdpƋdׁ\TtA#xA1qhARPh/E5/txh#AXZ1X4/ph5/50/] =/t50/5/lY_0/\8 uǀ\T5(/54/LXZ=/th#POF^_u)50/54/,ZYu95/u 4/AhdptЉPpƋPׁ\TtA#xA1dAId t1RP5/5/Bj54/H^_Ήp׋tЉdpቅptdtpt8D<4;D4} D45/u y|@xD+pupdC,H;xu4xdf"șdD1dffDžh$~ 1s8dDž DžDžQ(9w1҉Q,9w1҉ W09w1҉$u DžlWx9sll(1󫍕HU u H1׋l󪍕U u P1׋LuxLu DžU x1Dždd9WVCZY< <<t|<<tU U u PdPd⋍P9s WVPh# dIxuPU u PU u PDždD9pt4h/ ptPTDž<1{8;<T,Dž0,0PT P\T`y>\\$Dž($(\`\uBU u T <d 2@  /^ /=/tP}XP  uTPTxU u PTHU u HlRP  h|#\P+<ZYtwXV诌 HU uH򋅀xU tT GTlRPfh/N</ /=/u)xU P\19@U u P0U u W\ 2!8uF룉p<1ɋptUxU t B\0u*xȉdPh#(YXdAu1@;8=U t  G`0U u T 2!8uF띉p<1ɋptUxU t B\0u*xȉdPh#KXZdAu녍U u PLRP  txh#Pz9^_taU u PxU t G\LRPɉh/9/xpj PVc  =/tm h#XDhX#P_8ZYtkƃƃh 54/5/Ј5(/5/==/t/PP^ZY5/X /X /e[^_]UVS1;] s8Shn&^X1E0Ph9#FZYuj XÍe[^]á4/!uUVS1ۡ4/srT =/t4В+hm#!XZ">#tU#PY/Yt=/uɡ4/t44/Dh P5/肇5(/5/x<=/t/PP\XZ5/  /^ /Kt 4/=/t h#I[h#.Yti=/uۡ4/ h P5/ˆ5(/5/;=/t/PP[XZ5/S /X /jXXjOXYXuj^Zuj]Xe[^]UEH/E @/]áH/áD/UE Puh0,Kh0,j GjUWVS]8ށu=@/t5H/h|!YX=/t%=@/u5H/h"/XZuu ZYyWPhı# t7=@/t.j X=@/t%P5H/h"je[^_]UE Puj$ UE Puj UE Puh UE PujjUWVSxuD/PhW%TW_Zyh"[khWVܣ t Ƅ1҉|PSWZY|ySw%=` 9u;uD/Shh@/ǃ uSh4"Y[xPWV[ZyWh$"ً%= WhN"뻃= u+t'ShW t úShl"놈|S/ Yt?|t50hWK u|h@/h#0XZ|랉e[^_]UEPFZtPRPh" u uh"hh//U塤/tjXj 蝵USj0h"j /jj]USjtjjjj۳d]Åt3USӃ=/tPh|!YXSh#XZ]Áu=T=Tu =Tt=8 t=TuH/=tu /`/|///1f=T=Tu = 8uH=/t*/|////{UE/ /t,\Tu ǀ\8 Tu ǀ\ 8=/t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXC[^5/ //Yx/54/\ 1ɋ tc{S\9tt@Bt9-"u!RPhA #F\ @KCu=/uhW#ZHuqh #*_=/th 54/5/g5(/5/=/t/PP-=[^5/ //Y4/=/u ,q40;u ;RPhe #J4/04 =/uhW#ZHuqh #)X=/th 54/5/ g5(/5/=/t/PP><_X5/ //^4/(=/tx<Ph #uY[=/ăx4/(=/uhW# ZHuqh #(_=/th 54/5/:f5(/5/0=/t/PPl;[^5/ //Y 4/8<qH։9u9RPh #4/BHЉ8< =/uhW#$ ZHuqh #&(_=/th 54/5/ae5(/5/W=/t/PP:[^5/ //Y 4/@DqL։9u9RPh #4/BLЉ@D =/uhW#K ZHuqh #M'X=/th 54/5/d5(/5/~=/t/PP9^_5/ //[/=/2PH҉8<PL҉@D/=/=/N4/,=/t h #Yh! #> Z~ /4/ǀ,04ǀ(<PH҉8<PL҉@Dh P5/2c5(/5/(=/t/PPd8_X5/ //^=/P4/L5=/t h= #[hf #< Y| /4/ǃLǃPǃT\ǃX`B,F $1҅~K`F@ #CLh S5/a5(/5/=/t/PP 7XZ5/c //X =/tv=/umh 54/5/la5(/5/b=/t/PP6_X4/ph5/5/(ah/5/54/Sh‰LY^u Sh #1׉DžDžDž 54/;+^09~ËLSF8HLNd t1RPW5/ t@ t Dž +h #h"^Zu/jϿ=/tHSWW4 4/SA8HLId t1RPW5/ =/t SWW4 4/@0 p/t/11Qh\£h/XYҋu Qh #1^,jS/Y_uSh #=~/ / `/d/=/ȉڃ9sA// // /jPã/j5//…ˆt/Ph #"Sh@,/_Zu$Sh9 #[^/jX4/ /=/u*t!h#PtZYu x/ />hSP5\/5/ƃ H/L/P/\/=LBALt[=x/hc #hW#Y_jjjjjS8=\/fGW7fG`/CJtejPh # =/uh#'Zu9h"(X=/tC=\/fGW6fG`/_fCff=v]h #Y=/uh #Zu8h #X=/tfC=\/fGW36fG`/_fCffuih #Y=/uhW#QZuDh #R_=/tjjjjjS6=\/fGW5fG`/f{f9}zD3<:uƃu}EEUEURP5/u uy /9u/E ;}|t/EUtH9tDRPؙUEЉEeUEUSQRP~m RPh#舺RPh"w F{j 船Xe[^_]UWVSEEE Eu}EE}/ؙΉEUMuuuuuax 9Eu/!nh#̹X19]~NؙEURP5/uux /9tؙRPh"腹 /EE e[^_]鄸e[^_]UWVSQƉӋJt,B=/-"9t#s sRh#C Css ssV/E14/9)r09~ƋL=/t VSSF' 4/VEA8HLId t1RPS5/=/t VSS& 4/x0Ede[^_]UEU z t]]UWVS]4/Hdu } t1` /9{ u9st7S5/d /uWVs5/Cs{ ECe[^_]UWVP@/4/=@/t+Jdu}  t19x u9pt@t@=@/uh#uu uPE#EHJ@@/@/@/B@/He^_]UWVLU1u} uĉ}ȋEER赩Xe^_]US]E tywt1t1tmRh#H{@uPs s? Ph#.XZ=/th #Yh#Zu ]UWVE5,/4/x=/t54/p5,/' e^_]@/ÍL$qUWVSQQ9`/ d/s RPh9#[5/ 4/1ۍ}WSQRPa U Ƹؒ+9vAeY[^_]aUWVS\]u EUEUEUEUU3UE3E uUE u uE W%,uu+ZY=p /u <vuE m!]e[^_]鐠p /U1EEƃE9Eu E9EEUEUEUEUEUEUEUE J ]uuqKURPXtuSѩ)lj$SWNwG/ 9rMEUEUE Et6EUEUEaJ E!RPKURPXGp /EM tF?N)Eu ]e[^_]yMUWVS]\TYL} FE 8uh`ʲ} ^E u h\#h`SP M =/t h#Y=/1҃LJ =/uE PP"XZE \=/uPP!_X1fEfffE@9uރ=/tE PP!Y^E \Ǎ=/tE PPZ!XZ C0\C 04C$8<C(@DHLǃ ǃ Lu*ǃPǃǃe[^_]UEU \T 0H   Lu5PPQ\R\P,J UWVS}u=/ //y /h/P[^=/=/=/t h#Yh#=Z=/u׋4/ /=/ux șRQb / /h S5/:I5(/5/0=/t/PPl_X5/ ///^h@/5/5\/蒶h/5/5/wD/1t-@/t%FS5/{sHSBϡP/9t )Ph#8</8/=/4/=/t h #[h(#Yu/=/4/ƀǀPǀTǀXh P5/G5(/5/=/t/PPXZ5/> ///RX=/u h?# X=/twhe# /h 54/5/"G5(/5/=/t/PPT_X5/ ///^=/twh~#g /h 54/5/F5(/5/=/t/PPY[5/* ///>Z=/t"d / ` /kdPQSh#p/5/f X/Ee[^_]f e[^_]UWVSQ(ME11҃}54/~8;} p/t/)ӉMЉ]ԡh/E1҉+EEȉ;UЉEE]9]}EЉEEM]H;Mt*EȉEËE]̃rAMEE䋎E؉U܁\TtF#EFEU܋,/QF EURPh/5/4/=/t =/t =/t54/S5/ {U tU tuh#XZ=4/EUؿEЋMMh/{U tEC`؋Uu؍  0EU9Uuu5P/=T/4/MLU9P8u+KIjH`URSP U)S$) )Q h 54/5/[C5(/5/Q=/t/PP^_5/ /h//EY[EwV11ҍeY[^_]UWVSu /!Ut 9rt8R}t-jMXu h#v1rBЍe[^_]USM /#AUY9u ЋR9uX[]US]M 4/1!t4^Fu(9u 9t331 ‰[]UWVSu} ]9WV+ZYWVrZY/l /t9ZtjSPl / l /M]XM ]$HX h /t}9xtju5/fh / h /UMHU M$PH e[^_]ÅtUWVS E uV8`"<}EEH89~gًEtV"E4"ߋE#E9u(EUEU~U߉eUUGE9x8}C돃 [^_]US] EUR`t(t7uS /u<<+  !8]Rh8"h#UU ME@`t+tDuTɃu:< %ЃPh("h#zUSE MUR`t't2uCɃ)u-7  Rh"h#]USE MUR`t't2uAɃ)u+5 Rh"h#菹]UWVSu E$ EÁFl&EFhEEE}~ E@E}$EFp;Ew FpEEEp8MU;U}tуu >FB߉+}EpE$E+EEyEEPE9M}Etu EJI)΍T7E9~ЋU ڋEtE +EtE ڋ+EE$E4~FuI[^_]UWVSu]tVw XuVhp]!jv `DžPhd@u S usRhedAu \ƃ u8tuh]!:_X$B<CB(CB,C B0CB4CJ8KCB@C BBC$BDC({hӈ$ ƹ ߋSh]!V CPh]!Vݫ C Ph]!V˫ CPh]!V輫 CPh]!V譫 $tP ^}=uhzd@u 3 @RhedAu  @uuh]!j)u 41}󫍅Pu) ZY@4ȋ9~9t8Ћ}LJLJ(Eǀǀ [Eƀ*Ptj PEP蔋1e[^_]UWVS,}jhPjW:tGjPjVWVY u$U ʋMQ؍e[^_]UWVSu] DžPV& Y_TDž%= j/V4_ZxrPRV)Ph#h0R藝jPS  10; }SRPhOZY0u$PV Y^yG =@uu`uÉDž PSm XZuk%=@u4h#h0W茜WÉF= jW ^_1!hh V à 1PSrZYwtSW Yylc9u 9tԍ0PS ^Z+8T8PRPS̃ yu Dž  Dž Dž h#j$VWjjVV ÃPhFS艅 y(8SV Y뚃}tV|7MZt8PhF|@S= yhF S+_X12tP腣^}tJMQ41tPSYt ZxSV X؍e[^_]Ƀ=/tf‰Ã=/tÍL$qUWVSQ0EċqAQ EUAEԊ/4/x0}؉E܍EPuuuuF UMUȉM̉E9}EEsp1Mȋ])jj`SQXI щEt /]Ћ}<u h#O[`!ˆEԋy1FX /!9tEԋFXRPh(#t /UЋ}< =/t h #YhW#Zu /!FPVT]ĉSFPFTeY[^_]aÃ=/tUWRPzY_}UWVS EԉUMQƉ׋]  4/H0ș9Ή}EE5EPWVu_O4/;B0u ExthK#X4/@0RPWVJ UBEuWVPuU tUB EPE܉UM9E9u9t5MC E܋UƉ׋M9M }a ;]t }tcM܋EPEEPT@PƉ׋M܉1;]t ce[^_]UWVS0] CXƹ1}jVEp }܅tPEpdXZCS(EԉU؋WẺUЋE9E؋C8SEPuuu$K4/;B0u Exth#X4/@0RPuuDB UBEPT@PChSls}EA}GXEUGWEU G8W<5/#uTGPWTEUTUB E @ 1;U tbe[^_]UWVS4]uEt$# Eo##4/x /E؍CrE‹R RPYXJ4/wE$"1Ut4Vh#T}t4Vh+#:1%Rut4hK#jMt4c*XZf%f=t+4/ڔڐVPh{#̧EPjjQH4/;B0u Ext*{rt4E4/D_XP=/%JXF^9t*4/ؔؐVh#=E`&B9uΠ/8BufJEf9ur=/t h"Y#h'"Zu/t4/ؔؐ!EY_4/DŽؐDŽؔ4/{rT uDVh#}XZ=/t h"2^h"YlS54/kXZ4/t4(EEPjjucG4/Z09u Extuh#jي@EE=/tP@P @u؍4pu3SQRP? EPbƣt /EX};}}g4/@01҅uU)й`1j@@P_X1U9} MĉыU @BUEEHhhv EPUE[^EE;E}*uLphv EPUE]ZYEEM;Mc4/@01҅uU)й`1E1EEE;u  t /h#HX=/t h #[hW#Yu/M1uEԙEUȉE؉U܅uEEBEP4/H0șRQuE4/;B0u Extuh#蚣XZZ]ECMQhIlPPHT4/@0EEUMAhQlC E@ 9tcFE`UEE`lje[^_]UWVSMu t$# o##4/L/E}/u/Eʔʐ&%ÍEPjjSC4/;B0u ExtVh#耢juMUHp1;u})h EPMUMZZFEU9UEU4tpv vv6vWh##=/t hX#Yhe#Zu /4v vv6vuSuvEoE`1e[^_]Ë4/!U偺^Ft.hk#aX=/t1{h"Yuj9t u h#-Z14/t u h#X1=/u tøÅtUWRPY_}UWVSuuuu]9 É֋EU)jj`RPr: Nju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVSP]UpEM1}%JXF^ECS}tffsCCCC : 1҃}t1 :C(S,C8C#zZs,茎C,PX{8th'#hp"h h#迧C0E]I]US]{,thW#h\"h h#腧CPtPX]]UWVS\}1tF uuuu=y /tWuuuu hp#}}yNh2uuu PWEЃ<=LBAWtPh#蟅Y[EO4G 9F wjTj裈ËE CEUCS {,F(V,CSF@VDEUCSFHVLE܉UC S$F C(F8V ؙt,h{#h0"h? h#5U Mu)u؍e[^_]UWVS}]O,uhX#h"hO ؙt7h{#h"hQ h#軟UMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}y /t5/WVSh#[~SWVu5/1e[^_]UWVS] u}y /t5/WVSh#~SWVu5/>1e[^_]US=/t h#u?j5| /r[Zt!h'#@h"ZYuj%w5| /dX1ۡ| /9XL~$y /t@Pp0hG#q} Cҋ]á| /t(Ux,tPZ5| /{| /XË| /1t z,tUu uuuRUWVu} WVZY=/t@X@d=/t1s(4/f`u1򋈄1 ҉Ѝe^_]UWVS/tH x / x /4/!`t'Rht#ϐh"蓽 "juatuhlpx1Rh#xh"< th#s4/ ǀdƀah P5/g5(/5/]=/t/PP^_5/ /[1111 4/!PRWVjh| /h#詏h"mZYh#褏4/ ǀdh P5/5(/5/=/t/PP^_5/' /[1ۡ4/dJw*atP Ph#Rh#͎h"葻 h#Ď4/ǀdƀah P5/5(/5/=/t/PPZY5/J /X؍e[^_]UWVS] DžLDžPDžTDžXDž\Dž`DžDDžH '#d󥍵dhO'#uSbc < @t|uu h+#WO%sPsT1$lPsLsHWpu/}tsLsHh,+#WVpY^;CXt.tsLsHhP+#WpmZ~~*U +# Ut+#uu Phs+#Wpu  ujSPjjuu Wj TjpPl1RPsLsHW8 "t Džll9CPvዕlSTp4F(V,+F V$dh~>Vh#htQChdv$v tQh+#Wd,jVjhdv$v Wf PlQPl/SwkX1e[^_]UWVS(ƉUMjQRPuh+#VY[QfUt&tuuh+#VSkZv11҉ tu@ tBuuL]tY} }u>Hjjh+#VjSjjjjjVa 1uuh+#V~uuh!,#VjSjjjuuV E܃ GE؋E E EԊGE<G 1O1ӉM]G1O 1ӋE ȋU uuuh,#V~+SQM̉]uuEPPh3,#V& M̋]ЊGƒt:<t6jujSQEUEURPVƒ tZEB@]2EUE UM ]}uSQuщ‰ @t9}_ShX!(jjh+#Vke[^_]UWVSu} hjRdZYuVhc,#eY^EEU(,E$E U$04%jhSPVIuhVSLhx,#S{T8RP5_Z@uh,#B$@%=u?$Phd@6I @uh,#SY^$uh,#M, ((Phd@H @uh,#뭋, (h,#S딋ȃu ǃ$, (uFM苳$1RPWV  ‹MtU (,(,EU싋$1҉MRQuu Ɖ׸9ЋM|RVh,#StRVQuuh-#SWVSO @EjjEP11ɉ @t`jjjStLEt+jS!YZtT@ P$@ tR9MsGQ jRPS@u*tPa ZSeX1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@F @u%h/-#SXZuShN-#S E] ]USS]jS*ZYu Eh-#jS  ZYuEh-#SY[EFjSjStuh-#SXZ1 @ ]UWVSVu}E X CPCTPw ZYCXCs SZYCu V[Zu Eh.#WVY[uEh.#VhXZE1e[^_]UEPdUE PJUEM }҃ @@@ }~ @ H ]UEP EBTU B ]UEH E ATB ]UE H E ATB ]UWVS] {C E1}PPE$h$V ZYt -"..# ..#-"QM73RUVh8.#h0,]UM;usRQM43RUh-"uhM.#h0,]F MU;ut43uht"h0,]Fރe[^_]USQM$1SQ,(o eY[]UWVS u} W l.5M19É}uRPhc.#V;IEPu7 ZYy 5l.5hli!!UEG9ø|5l.5h.#V e[^_]UWVSxu >1;FN|#~$u~,u;FF |F1҅8tOu[tu_Y-{CV$9tVN19};K;VN 19};K ;SHEPu1_Zǃ~,uVЉ||t(6jmEPj$W8RJEPv, tijWR>r uYjuWUu<@uuZYjuPUu.@v0sh.#uv[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h.#S 1e[^_]ÍL$qUWVSQ qyAQEUy uh.#S~XZ:$E܉EEuuWV  tuWVh.#SCDEPuuuu lj֋EU tuuuh.#;MM}eY[^_]aUWVSu FhT]%5l.5x _X1ti1SщU #MxYZMt/UBuSh*/#u| hT]%j# XZ뫋 $#F (#F։e[^_]US1,# #uhF/#BV`u܋]UWVSP]EE}u h-"SA 1E#$#(#! t+]B";u-"u PSu #S`u؍e[^_]UWVS]EEEE}EE} tE U U uhT/#SZY[YSZtN@P;E sPu hc/#S42E HEPSkY^E#ƅUtu h/#S c׋EЉEJ0!#B4 MJ0 EB4SZ@tuS2ZY#x0U#P4 }x0 UP4S_@tu h/#S e[^_]USP] ;u=j EP5l.5} U:u1҅u5l.5hli!u] Ћ]UEUitstau+u P uPZYU@Rh/#P US] ƒt+S5l.5%4ZYt5l.5h/#u ]US] ;u&5l.5Y1҅uh0#uXZЋ]USEU MitWat&bt?L,RP@st?ttHs:~h0#P'Y[n1gRP $RP_[Z@&Zƒt,S5l.5!3ZYQh&0#P ]UWVSu }jj h-"WVj]S yEWVuh?0#tR}t Shı#`RZYj xQXe[^_]UWVSQ]M tu ET!E!QhG0#S'M $j*UXZM uWhb0#S 9jVQjjuuS E 1uWh0#SV$Ye[^_]UWVSQ MAQEUA E܋AEjS)ZYth0#2jS^_ujjjjSJEUE Eu h0#SY[EE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSxZxt h0#PP @9E}}EU u h1#'EUjjjS@ $uSSY_u h1#jPjuujjS? uVeWhD1#S p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEԉU؃F0V4F8PS51_Z@)QFHVL}$E$;EvE܉FPFTy 19VPvUWS0ZY@UB߃}uujS~@jp juuuuS u hd1#a @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]UVSĀ]E 9+tE @+Ee[^]i,(h2#3$h2#M$1RP,( RPh2# h2#jSV uh2#XrX CRPh2#hMs,s(h3#s4s0h3#$C8PhW,"hxV,Vh*3# MsPh<3#M 1e[^]UU E$E8E U]bUWVSPEPV @'Et M 9 +uPhR EPVzhX+juR e[^_]UWVƉj(jZNZYt:0xu} px @@UP@@ @$e^_]Åt!USÃx$t p GRZS@RX]UWVS}uE}t;EPEUEP @E؉U܋EUEU9E ]|'E@h3#W,Y[~M ]M]M];EE}?ENuuuu uuuuh 4#W(#E@U3U M3M u[U3UM3M uKt-ut#uuuuu hf4#WvEpE ]C E$C$tKut73#w #3#w#QRh4#WfE@VuuE Uƃ )E F E$F$EP]K[ M];UuK;E uFE@FUVtpEpEU}WEU+EUGW QM]ӉM؉]܋]9]u>]9]u6E@F}~tpEpEU+EU}GW u{]sM ])SQ t@FV AQ ]S)CS CANs^qAtH룉뛉h4#WXZEEe[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuu  t/E؋UWVRP8 щΉE؉UMWVuu  t/EUWVRP щΉEUMEE E؉EE EEi{USEЉUԸ;EиE4}tE9E؋EE$E؋UX9uEE؋U܉EU}NWVuu EUċE Et0EЋUWVRP$ ։+EUԉEUċCS +EUĉEȉŨ}tE9EȋEE9uȋE||E Eu?9}EEPWVuu= ÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuà [1ۉ؍eY[^_]aUWVSQM]ԋyYq ]uQAEUw}x}y h4#TE Eu h4#:~t h4#*GW E؉U܋FV ] ]uM؋]ӉM]O_ EUuuRP UMˍ eEUME9Eu E9EE9EEE}!uuuuh5#u$EUGW +EUVN^ )ӉN^ FGFtxuuuuZ  t;M]M]uuSQ UMˍ eEUMGW EUE9EEEE}rUGW EUt~tIWjM]+M]SQ uh4#u1GxpF)VFV 9EEEuh)5#4~thM5#'FV M]+M]M];E]}hx5#uXZEET+EUFV M]+O_ ^ uFGFtxEUGW E؋U܉EUEUeY[^_]UU Et 9Pt@]UE]UEt Pt]UWVSEtd1yAQ $T$D$T$ D$9E ED$ |I11҃yu /@#Pu h+7#u UWVS ljЉjRPWEuhf7#W`ZYEƁ8WEVu WEVthz7#WVF EE@(E1E܍EEE9Ev3ExtUUE9ʋU}11ۋUBUEŃ~SQM]h7#WM]$1RPSQn E܉UEEEE;E~AE@ "vPh&7#j@h /< /@#Puh7#W3E@ PuWU tZjH]S8RSPE@F(1$1ۃt+M]EH X$E1ڃ]C(S,mEE)VEXEe[^_]UWVS4]u EEEEh7#uVu' ǃ tBpt#At-fu9E΃su+EEPS`Y_@uE95+tht+jSuS)ẺUjSE t @M th7#SE@ EjVuuSBu@p EEEE@MQЉEfA fEfAfEƒ~K19#u #"@=uRh&7#j@h /: /Puh7#SE}u h;#SXZ u؋}܉0x+EỦQ}u h<#SA_X1;EE| EЋUԉEUuujS@jp juuȋEU+EURPS  uh"<#S @ r $󤋃p PF V$FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@EthC<#-}~1EǀuSEY^@ha<#SXZE}Љ΋Ee[^_]UWVS]EEEEE11h<#uu s btENtoat%itClhx&Y1EPS&EPSdEPSZY@ky҉Љ։X1;EE}=SzMM܋UUZt&xuPtM9Hu M9uU@օtE 9+uEU t th+jZYWVRPuSme[^_]UWVS֋UU $$#E<# t h<#+XE"*#hE<#\E<#PE=#DE=#8A t h<#x+Xh=#m+C SX1O11;u ;FuEC=#h)=#*_tjmWj$8SM1tttShW,"Sh3=#hW Whp"*ZYzh6*#*Xufu]E<#E E7=#e[^_]Q*e[^_]E*<#t-"PPh$* e[^_]UVSÉjj h-"U MeRPjuV' yEu uShZ=#)}t Vhı#)ZYj (Xe[^]UWVStƉP]Zt 9St[Rhw=#V= ({ Rh=#C)$1s3щ¸=#$1s sщ¸2#Wh#hVo(WhW,"htSUSVuhh~i&VO SVhc=#(GPhW,"hSShK>#($jmSj$G8PSh>#m(h>#c(G0W4 u hr=#謄XRPhPP萄1e[^_]Ë ,Q,y ;,| t,J ,Uh,P>-XZUWVSxhp$ h=#'h,# h=#'h=#Vsà Gs3 h=#s's s h=#]' / %CPh=#0'K Cs31 { Wh#hPt WhW,"htRZtRPuhh~i&PB Ph=#&tRh=#&GPhW,"htR tRh*>#]&hU>#S&jj h-"$K $cRPjRr (y&$K $cRPhm!% Rh#%ZY jmPj$W8RBPh}>#%h>#%G0W4 u hr=#XGRPhPKPف)h!h%K Cs31: + [1e[^_]UWVS}] uEEEEh>#VS, tSl`~Qa wI$$#uu=MȃMƒM뼍EPW EPW7ZY@uM9+th+j_X_jW<[^u h>#πY]t I;]E}1W)uMZt xuPt9Hu 90uU@܋Utyhp$ h=##h,# h=##h=#9Wƃ v6 h=##v v h=## k aFtPh ?#p#XZ h!b#Y 6 ,N Fv6U vXZZ؍e[^_]UWVSD] 1} '#}E&?#uh3?#uu tGTtlu&hx&3Y1tukVS_Z@ut6PEPS @u#tjh '#V< t E 9+th(+jZYVh} EPSae[^_]UWVu }^_]UWVS]u EEEEEh?#uV tfitLat%bt0lhx&VY1txEPSthEPStXEPS_Z@uG1;EE}1SHM}Zt xuPt9xu 9uU@܅t95+thH+jZYuujjuSVe[^_]US HfJfHfJHJH J 1Ɋ\ \ Au[]USYSYSY SY SY SY SY SYSYSYS1h?#RP=]UWVSEUPUfPfUP Uf@fEExsu>1ۍujVk$#W9 uu wu  u]CuEExlu<1ۍujVk$#W9 uu wuo  uCuɍMU Ee[^_]UWVSuU t>u1}]U EPEPEPEPEPEPEPEPEPEPEPh?#V$ 4 U u$Eyt%PXZ h^#BXh^#7_ t9ֺ})؉Rh->% ZY h^#Xe[^_]UWVSVu _uhE#h^#j ƍEP i[t hn#j juVFNj] t>sVOZYu+C xu"t s s-FYXj ZuoXe[^_]UWVSuE @80ƅ77Ph^#V t 7u7V Y&Vu Zt h^#_j0 PhE&H Ttg81ƅ9E&@󥍅8Ph^#jPSx0Ph^#jPuVx VSh^#jX Sg[t hn#jl T˅S zuR$(Ws迱ZY(u1$zu%B sV̫ZYu+C xu"t s s>YXj ZugXe[^_]UWVqJ9vr^_]UWVS]u(ZuP7E_@u hLG#h]#u/^uhLG#h^#j sP3s WshR$uUu t.P贈 EhM#u8u E tZu蒈 EYLEPh"us }Chs@Pu @qh`#ut XZt V% Yh`#ut XZt Q XMEPh"u E Mu {hE EEEM؍CU`EPu u @MuhLG#h%`#fEftft5fu6t2C t Wh4`#j }tC(UhT`#C0ut3hp`#j t C0sHtS4KL9vщ}t:s@shun us@s`uY @u;481t/sl`}t$CU[s@s`u# @uEsd6CptSuZY@u s\h`#s8sXu @u s\h#te[^_]UWVSPu`p Zu1hu q _tPVN Yt8Wtz EWu s Mu SH [1PQS6s uVN XtS,p Z؍e[^_]UPEPh#ug ƒ 1tEUWVSu\Ph,`#Vm t\MfnjN4Zu\VXtd$1jRVVhiS@tt}f1RPh,`#u V 1e[^_]US]uu S? @t ]]1]UWVSu uRq [^u P{ Y;Ev?V腄 }ƉM)1Ze[^_]UWVSu up [^u oP Y;ErR?V }ƉM)1Ze[^_]UEPh6!u ƒ EuUWVS8uEPh`#V^ uhX$hpG#hh`#h`#Vp _ZtP| }ĉ[J]ShiVC5}ĉjS藁 Ph`#u }p ƃ SE YuaEUu؅yكۉM]! EjEP; XZt!Vh`#u p VE ؃e[^_]UWVS1Rhiut4 @t|j7RPh`#hSހ>tVha#Vt j7RPh`#hS;tSh,a#yS\ e[^_]UWVS]h`#Stn Y^tVP誁 Zthr` uhI#hc#j׼ jLh+ڪ_Zc#u-"jmh+辪ZY¸c#u-"WPShc#h0,!=h+t VW?Xjmh+xZY¸c#u-"SSSSSPShkd#h0,$VP9 jqUEU P]UEU P]UEU P]UEU P]UET+T+1]UE\+\+1]UEd+d+1]UEl+l+1]UE@t+t+1]US]Sh+aYZt =CЃ v؃߃Av h+BZ>u +1]UE;1҃t` /]áp+uUP;Ut@u]UWVS4EEE䀖5//EPj2 YZ@u he#EU׉uȉ}̋MMāɚ;~EU6eĉ}ċ5/EEtNމ׉uЉ}ԉ΁ɚ;~3EUʚ;#EEEEEEPKZ@t E EԉE{hn#j詹 u8GustwC t@P_Džt@tCt΃}tċMU;Uu-;Mu(9u}SYtjEP薞 XZ=/u(];MU}S_tuQjTEPj ZY@UE;Eu;Uu E9E~ 9Uȋ]}h!j裸 UWVSÉHP _tP^D DžD1Q!LY@u h\I#h]#&RPHSƃ uh\I#he#jH R1RPh f#hWWVhf# jVW WhiL@u Whf# |t Phf#XZjVWWh~iL@tt Phf#W_Xj opHHY@uh\I#hf# u =`+j:RPhf#hW?tWhPg#WE| j:hf#hW訸?tWhbg#W| tHSW?XZjVW褱Dž@WhiLLuhog#(_XjS1#jVTWMDždDžhDžlWhiL @t|h%Yu hg#l@DždWhiL @@u hg#@lhg#m@R HS XZ= /u0= /u'DjHSDP jV`VF = /-zk?VPL @ue#= /uFl#Pj hD%g# /X thm#]B"X th!]B"X thg#]B"X tRPhg# hD%g#D /7_ thm#]B" ^ th!]B"Y thg#]B"Zj 5X+X SV65p+tjHSVv e[^_]UWVS]SZt EPu S @u Wh!c#j3 u V SW XV EtuhdI#hh#jѲ EPEE^t hn#j߲ uEVtRUW=ZYU}tRUuZYURh#S tFE= /tFtj= /tFu[= /tFtL= /uE= /u+ Hu)}tj Xh,voZY U06"= /tj XS. u. uFJj UWVS,ÉUP@^uh^#@hk#SX ZYucU̹ Rh8i(S @u8t hk#jb jhk#u uhlS#h'k#j; Eܣ / /u VhDk#j e[^_]UVS։P豜VSPhVk#j̰ UWVS]U hnk#SW ^_uh%hS#h2hxk#_‹ /ށ؃E u %ERUj NjURj WPvtBPEV ZYUu r'"9ER ]E É /X1e[^_]UVSP]U Ehk#SV ZYu tWPj S9j VPJvÃt7EPS5 /3ƣ/S1Fu"U /e[^]UVSP]U hl#S^V ZYuh%h`S#hhxk#P{i Si VPuÃt7EPS5 /蕝ƣ/SV1Fu"U /e[^]UWVS]U hk$SU ^_uh%hTS#hhxk#YNj /%EWh Wh VPtt5PEu胜ZYUu k#EK É /1e[^_]US]U fEPhk#S$ uhX$hDS#hhxk# /%˃ uˁEU ى /1]Uh0,hk#|XZUWVS]hk$SzT ^_u3hl#SiT ZYu"hk#SXT ^_uhnk#SGT ZYtP / //!‰ /d$1󫉕tVh7iST @u hl#j e[^_]US] uPh#E tP]Yt Ph,l#XZEP菙YtPSha$g T]%܋Et Ph5l#JXZ]UWVSuV[u h^#/VYu1P4Z@u h4S#h]#p 81jS8P8Ph8i(4@`%1󫍅`PhiV  @uh4S#hBl#j踫 tUphRl#^XU#Ht#t8uP9u Q3XVh\l##XuShcl#f_XjP.Y^u hR j% \8Ph8i(4ٿ @uhk#H蛖Phwl#h$HH9Tt$h#~h$Tj)j ~P4Z,H%(hRl#&U#_1ҋ0t^`U#xtM(9u;0t⋍4#HɋL ]B"u-"QPha$ ,떅u h~i&^j YjmZti 119X~M%9u>uWQPhl#_ hl#Rhl#4j _F뫃 u]e[^_]e[^_]UWVSSӉϋuu L  0L Xt8tVWPP u3"& Y1t$EV & ZEV% [ Xe[^_]UWVSu]Et,DžpVRpRtWjP2u pWa Y_u %NPڋE ZtEC sF C1e[^_]UWVSW]EtGs$URP^Ɖ׉‰ 9иr E8t W8"uFK9;sC| C 9s} *"WV0 Y^u 'K(PUE -Z@tE}G _C G1e[^_]UWSËtPa$ X1e[_]UWVSÉUMUEE;E t]ztOUj8ZtbNjUx4uup4x u}x xuupK(C(E81 S$uS$S(PXC$ue[^_]UWVSDž@}uoE@u E@ u+PE 0(M ZYuCPE 0M ^_.LPh6!E 0 u Dž0 L0t 1󫃽0 00`0ul[HhT]%HP H,ZYu Dž,U&EXtj/V) [_ÅtC`1DžT0XDž\@PTP,V ǃu@xuPqNRTt/0u#xPV&ZYHufDžtt,Ttt1T[Dž,tN(j DPSk,D (t8t1ҁ,v "1҉(V?^(v0 Dž,1ۍ A$(Pu0Z$ tW0,f8ljB$@tP Y(0Z 05 uEHVUE Z@tEx$,V1 Y_u,Vh V#hm#j臡 @PSZ S u h V#ha#*VEpE0H V_ uh V#hb#j- E}G }xG }G1e[^_]UWVSu]}t W!Zv aW YuI %NPڋE gZtEC sF C1e[^_]UWVSU1EXEECu5}Ej1ɋUE E@upup Z\uu}Wu Pu4Eu }uEEXExtHu E؋ExuY}t 1}t,ES$}e[^_]UWVSQu}uSEX$:Cu S{0u3PE 0"F YZun?-uGPRU{YZUu{(WR{YZuA{ Cu Cu5PE 0E YZtPE 0E YZu^Cv Ph-m#jx $U#PB^ -w7& XZ w74' 1t7 _t8ȋK 11PE Zt7EF EFC4FCF1蜿 菿e[^_]UVSu]}th.j] NPڋE ZYtEC sC1e[^]Ujj$ZYt$0V#U PUPUP UPUPUjj]ZYt(V#U PUPUP UPUWVSu] FtVuVVP[Y1;}t&j#Zt2TPFNG1 VuVVPXFue[^_]UVSuj(jZYt; V#ECCCCuu S> @u SX1C؍e[^]USj,jIZYtAV#U PECC$C$C(uuuM @u SOX1ۉ؋]UWVSPu]E1+Ei;}|1bt:M9wCGM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EV EtG븍e[^_]UExu@Rt]1]UEP 1tRZ@US]C$u C$[Ps S= @uCuu P{Z@u1]US]C u C [$(KSs Ps @uڃC4uu P Z@u1]UVS]u jZt$pSuCCC]e[^]e[^]UWVShEm#u@ hLm#uw@ tÅu'j`h`V#hSm# VS SS Y[@8FthYm#\F1󫍝NvJvrt󤀽uIE9 t hm#j觘 |t uhm#jS jtP PhJiuƒ 1Buhm#\Xe[^_]Uh0,hm#fXZUWVS, = / ƅƅF1RhKiuF @ PXujPx Y_VjWhQRPq qpujP2 XZpVjRhVpQP+ hU&Ws$Ѓ,hU&RsZYЃ,jr#tRVRSPhn#e[^_]UjhIiu} @u hn#jɖ 1US]D+9t tu</C@t5</| X ujjS]</ u D+D+]UWVS ]E1}t;0uK ,f|Jxu}}E} tˆUPu ZYUtCt! ,DHt KDHuh7n#}9}rthNn#hjn#X1EtR ,ҍBu  ,W{G09u ,f8W Ћ}G/CEP#U+UE9~ )1}E؍e[^_]UWVS]u ~;0t = ,11)S ,f|Pxu> fLOt0@t@9|u"tt SVh{n#SPhd!l %hh#]Y19};Phɫ!GGXZe[^_]UWVS ] uع1}t}u+EU EUܸMMمx9s蜵1LuÍKكt :M؍AMPZt fP׋Me[^_]UWVSQUU} uj[Uuh]#RZu h^#j jPVx u} ]e[^_]/UWl$1E|Ru ul}UWVS4] uYu hV#h^#j)Z@uhV#h]#jӒ P$_@u hV#hn#ݍF1jR Dž&t6Džn#*pn[^ÅtuP zu yljDžBPhi賦 @uhV#hn#UZYs:[= /u@ SjjhSRPB Sh! )Xe[^_]UWVSu FPYZu菲8+u1hbF&j \`%1juSۋt \vSh iR~ @u81t8/thn#TXpe[^_]UEU = /uRP*ZYE En#UVS] t4sVulZYtC P;UuPVZYft1e[^]Uh0,hn#T^XZUWVSSƉӉM1VY_t@jho#P u*W ,DPtSh:iV9 @}u hn#jI e[^_]UVS]u1ɉf@uh,W#ho#j? EPh#o#S4 u蠰)EfEVh9iSƒ 1Bu h+o#j e[^]UVS ]u1ɉ@uh W#h]#j輎 EPhUo#S t,juV E؀8t-EPh#o#S u)EfEVh9iSƒ 1Bu h+o#jA e[^]UUE7@t0UMfu t E Eu7o#PRh>o#踹 ËPtB eo#Pt8m!Pu+so#øjo#Ptm!Pu ~o#øyo#ËtO-so#tEyo#t8m!u+eo#øjo#tm!u ~o#øo#UWVSljӋuFEE9vU19ta ^w@vzMShh#WKS 1M;us?v:1MFPhɫ!)ЉUPUU MuQW u9utD7...}e[^_]黭1e[^_]UVS ]uVhiS @u ho#jT EPho#S薽 uhX$hX#hho#E߉EVhiSP uEho#!PXE1e[^]UWVS$]uӹ!1j EPhK%SMuhX#ho#j EVhiS= @u hp#j艋 1e[^_]UVS ]EPhp#Si uhX$hX#hho#uVhiSt @uho#E؉EVhiSU @u ho#j 1e[^]UWVSxhSh1u#u@uhX#h,p#j蕊 DžDžDžDžDžDžSh?p#ZYuADžDžDžDžDžDžjShGp#ޒ ‰؅uDž8 ,DytRx:uL҃0jWVhT]%P;t49u8tShPp#jK jRVjPuԪHDžDžDž|Phi8uYƒ 1Bu hpp#j e[^_]UVS0]juVhu#SҾ@u hX#hp#VH Zu Vhp#j茈 Uf@fEލEPhiS @u hp#j艈 1e[^]Uh0,hp#VXZUWVS] 1}EPh8i(S~ @t&E1r r%1ʹ|󫍕[!RhiSt @[< v Phfq#j腇 hq#j[P\P| <fDžLVhiS @t%fNthq#= /t hq#_fDžLVhiSi @t%fNthq#= /t hq#ŲYfDžL VhiS) @t0Nf=) Phq#葲XZ= /t hq#zXfDžLIVhiS @t0Nf=) Phq#F_X= /t hq#/^1|󫍅|Phi8S @t}u(j $PhiSb@Uhq#ϱEEEEĉEEEԉEEEEE|Phi8S@uh_#yYruuKE E Eu:}~IE ,DJtx:t~+jPh?p#L uVhq#XZDž|}Fy h?p#Y Pv XZ9j,Xhq#走Y4t8hq#蛰XZ h"荰Xj 覯_PhiS @PhiS @jhX#P u ftePhr#[^Vf"fP= Phr# ft Phr#ʯZYj Xe[^_]U8EEEEEEEEEEEPhi8u @u hpp#j腃 1UWU1Rhiu @u hp#jL 1}UVS]EPh&u#S uhX$hY#hNho#uVhiS: @u h"r#j 1e[^]UWVSVƉ׉Ph#荮V)ƍ 9})j<艭E[7)؅~%Phɫ!HCZY9]uj>Ze[^_]j-KXUWVSƍt1fDžfDžRhiVX y hr#j܁ h'^ Džl)֍H(@!P _9l}l' Džl hs#hN%hs#hs#hr#hp#hws#llh"s#*(ppx(@!P!pP Y`/t `/Ea/tI@tc@tC@tP@ tS@@tB@yA@pX@dp@`pp19~pL9}B\pfP@u uw%k pfx p@tp d#z= tt= w-g [=wOft'k 11?1p%1=$v-- 1p-1Ƌp P h`/Sd`\VPPllhKs#6p@"Xp@!ǃ0X*w'Mwt4tou2tW0 Y= /OGPSPhvs#h|s#肪= /Gd4r#t;r#Ph#GXZ"9dv ΃o#x-"VRPh(!CT]%ʀ= /cGPGPGPhs#hs#کG1d_19d&j>Ψ^= /GPhs#RKStRTRPhs#mRPhs#\ F뗀= /GPhs#7Y[Gd<G=PuZhs#h#XZ= /bGPhs#G.Phs#ը_ f`WֹCr#d8t-\PQha$茨K b6!\`f\TddT_r#tHHr#PtUr#Ptm!Pueo#PQha$K b6!\T`\d<K=PuFu:hs#h#袧^X= /GPGPhs# t#= /d4t#hs#h#?Y[= /GPhs#!XZ1t D ҃L dd`dr#du-"VRP`Q4 Y#h t#¦Cu_h9t#h#袦^X= /GPhs#脦GPhs#qwW ÉTӹCr#\t-dPQha$4N b6!dϋ\fd`T T`_r#tHHr#tUr#tm!ueo#PQha$謥K b6!d`\kTPhs#hZY= /O)w1ir#'w$X#r#ir#{r#tqir#ugr#`wr#Y|r#Rr#Kr#Dr#=r#6r#/r#(r#!r#r#r# r#nr#G)Xjj 蛣pp)hXh't#`<XE1e[^_]UPEPhIt#uh uhX$hX#hho#ME[UPEPhq#u uhX$hX#hho#WMEUVSjjj"> y hRt#;\1ɺxBhPS<\ y hlt#^;ZuufiuS&] Xe[^]UpPhiu. ulh{t#:Xl$Eu ht#jv EEJ1UPEPhq#u& uhX$hY#hAho#MIE@u ht#jTv 1UPEPh`%uͩ uhX$h0Y#h4ho#M E@u ht#ju 1 +USE UUXt=EEEE1҃UjURP=n 뺋]UE Puj觭蛭 US]SkPhTu#jP- Sm/P/~ UuUE PujH<j- UE Puj& Ã=/tRUEE EjjEPEPjEPGKuEheu#XEEUSP[ jhHu#Y jSY uShu#1jP|_Z@uShu#jl]UWVSd;u~SE=/tC;Et7EE jEPjjjV}J@uuShu#H EEEEEEEP]Sj=lVSj4l#1Ãjhu#v[^uu# v#EEEEjEPjFW E% Ejhv#h8"藟 EPh1j$#q h1j$hnv#fj* j9kuv ߒ![^]USQjj]Sjjh +GthE!u+/Zu hR jp jjSPjh +zGu‹E/]US9Ph9x#h0,Oh0,hux# ?Sh+y#h0,0 jЕUE E ]LUVSE M}uP0X%  %9t$x## % 9t x#w#1҉1[^]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t$x#/ $ 9L$t x# w#11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]$x# $09tu x# Ew#11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t$x# $9L$t x# w#11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]$x# $9tu x# Ew#11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]$x# $9tu x# Ew#11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]$x# $9tu x# Ew#11Y[^_]UWVS UM EuT9|$y|$L$ ʉ1щ9L$t$x#9T$ x#uwy|$y|$L$ ˋL$ ˉ$4$19t$x#9L$t7z#$9T$tKz# w#11 [^_]Uh jjh@+u蝒1҅tPUWVS jEPL E}^X1;u}2}SPuHZYt#SPbHZY t FEEe[^_]UVSQË0tRVhL}#EPiVݞERrgZe[^]UWVSQ1:nuzouPDgXEhT]%P] ZYt98nuxouSPҢZYu}SPZYuE1VEEe[^_]U<3PPPhR}#h0,wjUWVSlju],PQ ֹ ZY u Qh}#zDžt } t-U hC!u Y^Džu !hu4hW%,PF^ZuC!su MjPJ ZYtDžoh#-_ jh}#P~ uOjZP,P~ t) 9|] 믋RSWM~ Åu=/h}# j Vh}#覔Et !Ety"Et !Et6${#u0P,Pc [^@tjj@eZY,t#jh}#W_} uh}#S蝌Y^0C!tWh ~#Wh#hSa,@hT]%,PUXYG9 PVdXZ tK <-u"j=RiUZYt)@ T" m b ,tD=/t}t =/t/h~#胒Y14hx$mGXZ9j 耑_}t$Py [@u h2"*Y $ t t8hr!z*ZtP膙XPyX(=/tj}t0$L jL j(x @u h~# *_+,W3h$h,R9P,Rc '8tV,Rh") ;u8uWVWh9~#)j]tP薘[P艘Y}u, Ex](#K jj [ WS$I ~)t}u2h,,P+3XZj P$I ~j,P  @uhZ"(F,ƒu t(bt!=tRXPVh!g }u4=/t+0SV! Y_@uVhL~#9(XZ 1ۉ؍e[^_]UWVSj PhW~#u311tc {#tN${#t =/t2({#P#t]B"QRha$  !փ 덍N8"u-"x#t]B"VRQhj~#ĎƃtGF#t]B"Rh~#蚎xg t 0h# hW,"oXZ=/KtSp#t]B"QRPh~#?=/h]B"h# sds`sTsPh~# slshs\sXh~#0=/~chSjjhC!ju.t%j SO^_tSh~#舍 hMx& Y""u !"Ph#XXZe[^_]US] 1t-tPu=ZYu/1=/]UWVS];nu{ou /S(X1uh!+%X1[,u@B uPXuhR $V^_&3{j,VNZYt p7؍e[^_]U(PhC!h0,jUWVSRu ]1}Ep.5+h #Vu)v tXe wc$#MՃMσMɍEPSh#5l.5`Qu h5C!j_ P QX똃M뒋 +E)ȃt!ru2uVrE}8EUBpe[^_]UWVSxSV|PWu ujtW|ShP ip ,@uSVh8H!j$_ ~@t(RPh8#hSpS j.UVS]u VS YZu] EC!e[^]";/t"Sh D!͸XZu E$D!e[^]鶸e[^]U&PhC!h0,j贃UWVS EEu EE}]EEEp.5+h5H!Vut t4ouBjWh`#5l.5eOu h5C!j] POY붋+4E)Ѓt8S6EXZEE FEe[^_]UVSSPPVu ujVSh~$n ,@uL~toC!t"~0Z@C!uC!PShC!j\ jEUVS]u VS YZu] EC!e[^] ;/t"Sh D!XZu E$D!e[^]Ͷe[^]U$Ph`#h0,(jˁUWVS]E#1Džd11DžhDžlhƇ#u u'r 'u+fM'9t=G K|뷃g$`#UK| 땃K|돃K|뉃K|5l.5CpXDžhe5l.5CtXDžlG5l.5CxX.5l.5Xjuh #5l.5Lu h5C!j.[ PULX5l.51 YDžd+P;UtGtuSx t SxM tu4guV^Ehhhlll ЃtTxPV~YZ@u Vh$jKZ htECpltECttE%CxdupVOVHr@$XZK|ǃe[^_]UWVS SVdPhWu uhWdSh1$j ,@uSVh8H!j|Y f@tKRPh#hSkSh؇#0jc~USP]jEPSu U :9uySu heH!jX ]US]SWZt@ ho#SZY]US]S\Zt@ ht$SsZY]USP]jEPSU 9t :uy ShwH!j.X ]UVS]u VSm YZu] EC!e[^]K;/t"Sh D!5XZu E$D!e[^]e[^]Uh#jW U- h#h#h3#hj#h#PhЍ#h0,Q j|UVSQÉj EPS U:uVSh#jQW e[^]UWVSuEE@t"/ 1VFe[^_]P/_u h!j(W VP ZYujV|]e[^_]FUWVSQ]EE1+hH#u ul 2F$ #=H/tD/뷃=D/uH/c뛁K뒺al.5C8K t L/hK\cPDl.5dC@K@2K&gl.5:Po s4K #Il.5C(KK@KEPuh #5l.5Fƃu h5C!jvU Et L/tctKtK@tK t=H/D/ s=D/tH/c@tKt ,+sc sKsC  sC shr#VD@/XZEth$VDC$KY_Eth #VDC KXZEth#VDC$KY_Eth#VhDC Ã=4/t5SVXZ1T(ʉT(@ uFXȉCXF\ȉC\F`ȉC` h%ClRPuu Ã=4/tUSVP_X1tttpYYDpTtG u1YYGu @ڣ%CP/H05/E؋UXe[^_]g_UWVSQEӃ=$/1}=L+tBBfCUS)f UZ[^_]USt't7uFɃu0 ='Ph#h0,^ ]W|$wUWVSLEUЋ /A Id t15/NY=4/t/5/PP /xU t h#EExush#˷ N/H`u܋} tzU tRuL !8/@8EU/J9M܋E|`R`t*u8 몃u:uNQh(#h0,f] {hE# ZEEW /$~I /1Alȉсy˃ރ /EH//EHesE@E=L+dKdu܋} t1RPWVy }WTU u}WT }U P}t}䍄E}GXE1}EEȋKdu܋} t1RPWV{ MQuuRPZ EƉϋMUeuuRP ƉыEЙMыEƉϋRPWVH }f E9C0u'=4//5/PPe K4EDS8)‹}W S8)‰ }W$D4Ɖu}/ /9A8~zU tR`MEM]ʉ]ԉ]y&E]ԃ]EM]Mԉ]؊MԻ@c /A Id t15/XE܋Ue[^_]g_W|$wUWVS։ʋ@1󫡀/=L+t@fx|fDžAkxD |fDž +=L+t+g/@4/0uDžQ/@DBLBL!! pϋZ4JdQst@f fDžAj C P(,iKL04H8 /Hdx| t1QX}/ؐؔtDž'> 2e[^_]g_ÍL$qUWVSQAAA AAjPc^_=/=x/h/d/u 8/h\!jjjhjSjƃtjjjhjhjջv$hP>Y[58/uj h h{\ã/XZt1߉hhR\£/_Xt@׉󫋅//L+u ǃ,5ǃ,HHăx(ƃ=$/tƃD+@+ujh#MJY[/ujh#M$XZ/\/B0 `/J4PtPh#|M_X/@4PtPh#VM[^/@4d/9}RPh<#,M /@0=hPhj#Ms /@0=~hPh#LG /B0R49}RPh#L X/ /Y0;\/|Bt\9\~\\=H/yX\9}AX=p/~ Vh#.LZY/PX~~$X0ډPHp4ډPLS8<V@D@Pڃ~@P@THT~AHTP8@`у~@`~$ؙPSVh#qK/C4=d/1ɺ9u8Kdh/l/ t8<=L+A uPhT#j  9sRPhr#JQ /ǁ\Tǁ ǁA0QtAxAA8A$A@AD<A4=d/A|ǁǁǁǁXǁLǁP/ǃ\TǃǃC0StCx5/~4F8H GډSWRP ӋRPSQ~ FN ˉN~tn0牅kF0 H048<kى9ȉ}QRPh#uH L//@x<8@)׋@8tD11QP/ʋKT t1҉ u1RPWV  uDžDžWV ;s(WV Ϲ9s1Džp,ƍ6$1~ ڃ߃11Ӌ߉11ۃ~Z@` tӃ1 1Ӌ@0+pDž1ҋ)׉ߋ1RPWVx 1Ɖ׋ʋRPWV ;sv Dž9s H11WVRP KRP WVRP FC<1~!H`9}d+)HRPSQ 1SP] C1~H`C9}Vhѣ#uB /C`Cx1CC8<Hщ)9~)׉8<C,B,$1Ʌ~ @SL!Љ=L+(C|HL!򉓜jjjhjC4Pj֭£/uj'A:/H41󪡰/H///H4 ډ/)ʉ/@`#PL Ph@h H+P<H/PXD/P\T/ǀǀPǀTǀXǀǀǀǀǀǀǀǀ ǀHfǀƀN/%ƃC4D8<KC,ș)׋C)1)׉C8HK` tƉ׋)׉#!Љ11ҋ#~ ) 1ǃǃ)׉@D04=L+@C s(Hǃ /t ǃ^F=p/s0Kd t1RP߭ڍ8^!PP$h#< / ؙy8PۅI4p#PP$q,h*#< /A0= @ //=/u\Tu kУ/jjjhj5/jN£/u/9/uhd#荘 j&5 /1=x/Ih/l/9|RPh#; a h/l/5/ d/g#Xt<  DOu뽸=$/t?jj5(/S=d/Sb d/uPؙVjVuؙ=d/VkX5/X=/=4/t5/5/_X/x/\=p/~ h#辖 ^Dž=p/~} /A,XÉƋׁ\TtA!A1׋AId t1RPh^=#jj8f,ftRhht@P" DžPu  p/=x/t u/J,Dž1DžDž/9x,i h, /Dž牅8[9<}Ƌ\TuA#AAA+ugy4D1ҁTtYӃY1;|hä# (._/1=//CU C +C5/$~N`Cp=L+u,{tFx9vCxC\QfKxF,H9u fSCf{CTCXK\OK\K`ȃ~CPSh=$/tChChCh|{lN`Cd9Cdvh#藒 %[//P t)+Dž1xU u@\€ /H xU u@\€ /H EzU /@`/$~%/Bl=/G/=L+~(s8/9tR`zKd1WTU uWTU t PGXNjP1~FKd1111f,/@8P# /)D4)Ћ/9v?zU tR`ك 2/B$C19w+/H`艅 //BY89'zU tR`A`/$~%/Bl=/G/=L+Kd1WTU uWTU t PGX4P1~FKd1111f{89rJ/5/$NhFlx1Dž+D4/;xsxU t@` /@$벅t3@҃uG;^prtʋ$9~1뱅t$9~/B/;/ud=4/t/w4PP /@//Z4Jd15////H41Y/Z0 } /؋5/=4/t5//P5/ /X0=/ߋvpx /\t4Tuv%Glv%CPN붡//𙋝ڋÉƉ߁TtA#A1׋AId t1/Z\Tt=p/Ss8/+{0ƉK`Cx1񉅴69v+9v/u%Cl뀡//9r /A01q8𙋝ڋÉƉ߁\TtA#A1׋A׋1Id t1X~==x/j.,X܋ /𙋝ڋËƉ߁\TtA#A1׋A׋Id t1$u-"WVRh0#"-;|]=p/B/B,t)=x/t h!,X0j +XDž~j +X=x/tjb_u=/th9#v5/04=L+0FF4+=_w hQ#j X=//`1=4/tR5/[^/=t/t ǃ\8 5/x\d/RP& SY=4/t//r4PP /X4HdLH t15//Z9/vE=4/t/r4PP躽 /@//Z4Jd15/2X5/5//@4P5/ߖeY[^_]aSV̖jjjhjSj1ƃ$guUWVSu]tV XuVhp]!j `DžPhd@u |- usRhedAu ƃ u8tuh]!_X$B<CB(CB,C B0CB4CJ8KCB@C BBC$BDC({hӈ$ ƹ ߋSh]!V1 CPh]!V3 C Ph]!V2 CPh]!V2 CPh]!V2 $tPy ^}=uhzd@u \ @RhedAu > @uuh]!jR 41}󫍅PuRZY@4ȋ99t8Ћ}LJLJ(Eǀǀ [Eƀ*Pj PEP1e[^_]UWVS,}jhPjWctGjPjVWV u$U ʋMQ؍e[^_]UVS]u VSI YZu] EC!e[^]ξ;/t"Sh D!TXZu E$D!e[^]Te[^]ÅtUWRPɫY_}UWVSuuuuO É֋EU)jj`RPd Nju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVSP]UpEM1}%JXF^ECS}tffsCCCC : 1҃}t1 :C(S,C8C#0\+h,h0,#0 $0XZe[^_]W|$wUWSøth$1h#XZ5X$0h#5P$0h*#H&1t Ph@#_XX$0t?P$09} hQ#[()D !MMEuQQ$ht# j P$0Z1<&1H&1EE($0ۃH~- $0]PP$7 H#RR$S0$0QQ$SEWW$S h+PP$Sh#<<&1#0#0]#0#0EzuX#ٞzuX#=P$0\$=X$0$h#<e[_]g_1UjjEXZ1=P$0PyU=`+u =P$0ujhܣ uX$0ZY9`$0~`$0<&1ueUSá#0#0xFأ#0#0#0`#wh#r\+y1]W]W|$wUWVS$0X$0ff%0$0=$09=$0u ; $0$0T$0f%0f$0Yf$0Ej]Sjj5(&1 yh#[jh%1jjh$05(&1 y<&1t h#ؒ^EjSjj5(&1; y h2#j h$0j< Y[$0T$0f%0<&1 s$ $0ɡ$0ȉ %0%0s%0 $0%1}Xf$0=f$0$04fpjh&1jVP5,&1 Ã9t:y hN#ӑZSVh$1hU#'h0,X`+X$0ؙ%ك `&1CX$0#0 $0#0#0 #0u#0 $0 $0 $0#0v.}fE fEm]mE#0#0p#58$0=<$0@$0 ]u}fE fEm]mu#0މ#0#0#01Ӄɚ;~ ʚ; #0#05#0 $0#0(p#؉#0#0#0#0 #0ى #0ɚ;~#0#0ʚ; #0H$0rW 8$0<$0 #0#0 #0#0@$0#0#0=ɚ;~ #0#0-ʚ;#0<&1t 8<&1te[^_]g_UWVS<ÉUM<&1tUUEčs}u}MăA;E}lE؍t E;T$0uP$0$0u8}t2<&1u)?EPuho#" UЍe[^_]W|$wUWVSEU܉MwG]<&1MQURuh#t h#XVh#<&1Y^t,%E H#RR$Ph#j=&1t"uG0,e[^_]g_3'e[^_]g_US-"=d.1t1&蛑SPh#h0,jzUWVSƉP?k ¡11_tEtPh #E 119U|} Vh/#j tt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ 111҅w =w"=w:=w?=w W=w=v=w 3=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPs* PVh=# SU PVhK#BhPSjDUPVhY#SPCPVhh#h,1Xe[^]Ãt"¸v#7t#tURZø#USљRPQhSLh,S۔ ] ,yUh,j zXZá,P, UWVSDuh,~e[^_]ÉÉh##aYE1ɉt1\Ѓtu }uCEtHPDA u1ۋtЅ}t1}uI1}ʍ}j.h11EPjS91}ʍ}u( VPh#j.h11h11hx$XZ511VPhx$C :=11UWVS @<tPh#{Y[C@#tRh|!Ph#R^_Ph#BXZCH<$#h-"C Ph#C# Sassh#C! #<t<#<u #C[S C !CPh!#CZYPfwi$@#h3#h0#XXh=#hJ#hX#hY!]_3h]#K^!he#9Y PhG#&XZ1ɍQ9vhl#pK EԍsfCfhw:ffEPEPEPEPEPEPhy#jfEPEPEPEPEPEPEPEPEPEPEPEPEPEPh#^ACPh!#*C^_ft fuhm#h#[ PhG#ZYj Xcsssh#C@#fh=#C(#OhF#C #8S Cxe[^_]e[^_]UWVS0É։ME11j511表 jEPEPh11VSEE"EEEE jj}Wjj]SɗyhO#EЅt?P7Xu hR j jjWVjS荗yhe#݋EE E1=11t#h#H X=11tuh#u[_1}?1;]=11tCMԉ!9uk% Eta11tSy9uP=t11uGC{PS511 u@87tMPh#/G=11t3dV>Y19~Ph#XZv=11t 뻍Sx511jRU Ph#mCxUtIA511R Ph#:hҮ$G We[^_]UEt Ph#eXZ苇h#Ph%#h0,jfUWVSDEUϋEE=11u110+11E 11tCt)t/HuLE }t/} u9E@EX5E@E*E@E@ E@E hQ#0+u^h%$uޚ^Zƅu>Et(}11u1ɋU[Et$"1uuu ^_1ۃ}uj/u ZYÅtuԍU1EEEEPVhU&u t3Et/EPVhU&u 1ۅtuh/#t/Exuxtuh`#j p}u ju }tCU1}uExux uxuxu x0E@E< u2UĹ1jEPUR ¸pZ!uE耉E 1}E@111M YЀ w)YwW Yw7 uEw$`#@ @11@ 9Ew+E}u}j/uɩY[Ã}txEpVu= Y[u Xu޻Yu~CEZP}Wp @0VĀ t=11uu? Zt/u] ^tMUCUe[^_]/3}u =119EXSm ZuF X 91}u/MUG U& 11UFEe[^_]US+tuPіZYtC]UPu*fxu#@PhC#hh4141 Htu DP P ZU}u U Ƀ'hK#h#PPh=>%QRhQ#U UEttz#t #tp#g#Rh`Y"Ph#XZUVS$#E׉Íu 9stMtJ@Sh#XZe[^]UVS%$}tJE t1@jjEP@à tj.0ѦY^ƅth31@P+YZuUuR ZhPh4141e[^]UUE Pjjhh41PR thh@%h41Ȧ 41UVSE UZ1t@ȅt1 @!)ˉ t Eu7t3jS:ZYt%t%$hPh41  VRh#hh41mVPRh#hh41DσVQPRh#hh41VSQPRh#hh41 41e[^]UWVS$u} .E ~y11Dž119Ft } |7uiM L1tMw tLxw tHuGC@u?6ttxtu#" @ @u 5cƄ5V)э1u- uh%$h41V[^zth#YEtPjjhVPPJ t h@%VXZSVh*%hh4141e[^_]UVSMQ21Q21يۊ#BZ#XÃ@.)օ~=21uC21[^]UWVSu] =4+tN4+hh31}_Zu(j.h31跢ZYth@Ph31 31uhh%$h41 F<tW<t<u]] FEe[^_]D1}ʍ}fEu jEP ^_SEPZY6e[^_]VPFPh#hh41K41e[^_]US]U MC<t#<t <u&]}MU ]]؋]FS3PCPh#hh4141]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV _XUЅҋEtuu SVZY SPV) }yE E#e[^_]tEEԉE Emt"e[^_]rEEԉEE E e[^_]SUWVSXEEE EEEEEEE"EEEEEjjuVjj]SyhO#Et@P/E_u jj jjVujS腈yh#ۋEEEEEh#9 Y]r;]WCU!;U<}t Sy;U)sxEt  Cy;8+t8+PuCyPm S 1ɉttЊtOGDA uϋuЅ~uE'uPsuV~uEuPjju^E#CPih"h"h#X,H,$yh,j XZ,P, EEe[^_]e[^_]UUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һ #~kMUD8-u^@P1ZMt$Ut:u?DX,t*DX\}uCNv t}tEEEe[^_]UjjEPEPu u-h?uuu](US)wPh#h0,dSh.#h0,TShO#h0,D$Sh]#h0,1Sh|#h0,!Sh#h0,$Sh#h0,Sh#h0,Sh#h0,$j~UVSƃ=51uX1t|1j#jh`918 UWVSÅt։ƿj#VWhx#501N501PhPh,H$y)s1Sh#501 ,fDPfn,f?twfauJ1Sh#501 *fptfqt%1501h#Pj XZ<s1Sh#501a SSh#501J1e[^_]Ã=1t=1uÃ=s1tS=1tJUVS511111511u s1[^]s1UWVSxEUtk1ut=tu ,DSt1@֋}u$EE%@ ,t ,fBuӃ}th1 1tFE}tC1ۊ41t'8u9v&H 1+E=~CuύHE봉EE} Uй 1U1 1t}|tq|$t|\uK8XuRdx0~6H|8t!ODЉTB t8|uT$8|DEǸ 1P[t&\t$MHG ,€z$u`BDCtSB0uU BGOɍqσ \|t9BZAB],@\tހ$up0 ,Drt^0u1ҍu t BۍSσ tt|t|9t AYB+|iGa]\tЍPHuxtPp| ,DqtZ|0uEtM@GO|Aσ t2t|t|9t @XA+|GBE8tVEQ@:8\ ,]t+|501h#e XZHEe[^_]USEU t~M轢$@+01tRQha$P~:"Ph]#1e X1XZ2t$h1h#501AX1 B]|]UVS]u9151E 1u 1@+8tP9Xt@u=1th1PhD#q PhO#qZYu151 Sh#j迕 e[^]U}u芡X1]ø#]U}ueX1]ø'%]U}u@X1]ø#]bU}tX1"h@1h#501X1 U}tݠX1"h1h #501X1 U}t蟠X1"h1hC#501aX1 UWVS1}uEE PPEu:WHt}6hx#E PEP uh#E PEP t}E pg_uX1E Ptڋi#8atn#=p1us#1t1=`11Ƀ=d1PV1ɍM Z^9Yu19ARPSWĆSe[^_]UWVS0 Eu/X1Huh#E PEP ts1h j^Y[jh:1. ^_u=1E ~E ;u$s1jju 莿à u=1tӃ=s1tԉڋt5`15d1 h1ڍy_Z9u 1Ƀ=1n#=p1us#QPSR胅E =s1b=1U111ҋts11'=1t=1=s1u$C9]j[^s1E $tˋE 5`15d11ɍZYU 9u1҃=1‰ֺn#=p1us#VPQR臄=s1a=1T5111ҋE ts151# 14RjhE 4yd u uE 40h# ^_=1=s1E 5`15d11ɋKZY9u1҃=1‰׺n#=p1us#WPQRQ=s1u5=1t,=111ҋE _ts1=1'Pd Xe[^_]UWVS1}uEE PPEuMdHt}6h#E PEP uhx#E PEP t}E HppqtZuX11`t&1҃=`11=d11Ƀ=h1111RPt^X}51u501h#] Y[xPS&XZ}uOy2 8tSh$"R[^11K112u.jE ppYYut_9о}JU p9Ju19ZWPupSh#Z111tXe[^_]U1 1!t#Pju uU1 1=!t#Pju uUVSEuX1IHuh#E PEP ts111Džxh#E 0ciZYu*=1u501h#&[ ^XDžxh j˥tXZjh:1S( Y[U t;u(s1j51u à uN=1tσ=s1th1SֿY^uSh#501跺 멉ڋE nt5`15d1 h1ڍXZxt9|PV#ZYu11 Vh$"OYX9u 1҃=1¸# 1 1u=!jRPSVh#ۆ11=s1=1111ҋE zts11tjXZs1e[^]UWVS u }t耖X1h(!v谹ZYu"vh(#501,X1 sj h#Wȡ> #1 1u!=!tVWjVjpjhRSySdXe[^_]U"}t ]U}u蜕X1'hC#hL#hW#501YX1UWVSE]uu1҅‰uVruEE xh WZYu u2Jh"WZYut/" u븫 PVhg#501趷e[^_]Uho#h1u uGX1U}u薔X1=1t01E Ey#]W ]Uh#h1u uX1UVSE] u'"1҃=1‰1 tX1sh VٿZYtTh"VȿZYu1"AV5^"sh#501臶X1 t11fPh#501S =1t51h#5011 501h#U 1ZYt ,1X1e[^]Uh #h1u uX1Uh#h1u uyX1Uh,#h,1u uWX1=,1t 1Uh9#h1u u"X1UVSE] t~fX1 1=x1x1~u=sh VYZu x1Yh"V^Zux1<usl1Yhsh91yt191x1 x1t1t't8u501hJ#GT x1XZ4l18u&<" u"SPRh#501=x1X1e[^]Uh#h1u uX1Uh#h\1u uX1UVSE] uX1ujsh V趼YZu 1[h"V虼YZu 1>V Zy.sh#501]X1 ]1=11 1 s1t  " s1QRh#5011=1X1e[^]UEuX1Huh#E PEP tЋE ph9#_YZu9=X1uM=1t501h#:R XZE ph8#U_ZYu111USUE X1u a1Pt ]$pXtgSk Y@u Sh@#oGB=1t$h1hQ#501辱X1 501hj#jQ XZ]]:]UEt~蕎X1=Huh#E PEP> tӋE ph#8^ZYu 1USPEu9X1 Huh#E PEP߾ ts1h jhEXZjh:1 Y[U tE ;u!s1jju 诮à uu=s1tڋEtSh#f]Y[u 1=s1u=1t111ҋE ts11tuj蝚XZs1]UEu X1}Ht}6h#E PEP讽 uh#E PEP蓽 t}E ph#\ZYu!E ph#p\ZYu 1UWVS u} Eh#WXZYt.h8%WGZYth!#W6Y[t밻v覜Zt01u6h)#R ts1ts15s15s1hE#RÔX1e[^_]UWVSSU} uRU^xZUuUE p#01Ee[^_]oË@tP CYW5CZ=1ttP3h#501.e[^_]USEU X1tIt ]q+Hu.t8Cu-"PRj h#501̓jrr X1]UVSu X1}t e[^]pvCwZuvhp#501`1@tPCX3h#5017X1 e[^]US}u1pX1B=1u01E E#]2 11h#?1X]USEU HvoX1V=1u01E E#]H2 11Hu h#X?Yrh#H?XZ1]USMU AvIoX1_=1u01E E##]1 11BuPhP#>XZrPhX#> 1]USZKJy ;J| t Y RPXZ]UWVS Eu} tnX1Hh;#E PEP- tЋ5s1} 19~j kq1Pww t*Cu%wh#501X1 hh`1Py DžDžkq1X 9X ,DP@tC`1<$t<\CFC= ,KDOtQ1KSDOtk DЋڋMQ9~ox`1)PE 4VxE 4AiuHCDž9E~5`1)PE 4VwxE 4AƃF;!hqs10Wn_u 501h#u!501h#/ X1Y^x t=1u 501h+#΃=1t"501h`1. 01 BXZj 6Wws18P5s1V =1t~t01hPh`1_wyps1Es1E 9XCt9Ee[^_]USËt PYCtPϒCZCtP躒CX]USdY1j'Ph#jd]S誉~!01fJftPSRB jh:1 USdjwX=1t>.'Ph#jd]SH~!01fJftPSR^B jh:1 UWVSƉӋ:j:WLYZuWh#V. :WP这YZtj%WhLYZtWh#VW}C uf{P Huf{tCPh#Vƥ h1"V踥XZe[^_]UWVS ERUZEE0U;OwtCuRSf u=]< „t <w#;Ow tCE1e[^_]UWVSË@tP艐CYstVd~Z1CtP^CXe[^_]Å8UWVSH%Pt{= ,ufTwfUtaPtZftwftK0Euf]fۃW})0ufۃW)ڈQ@YAaAXZ[^_]UWVSlj։ˡ1u<P uEPhVWgjt;yFE8 u@Euh# XZ,HEHwtE1e[^_]UWVSUu u h #j\[ ljjh2#P_d uWC fCPjh:#W6d uWC fCjhA#Wd u WC _t36脜vzCvoCF C FfC (WuhI# Eg :j/RUH^ZEUu R 8)ЉUHQM萛ƋMQURPq{ uEuћCXj@V[HZYta{ u 1Mq@P蟛j:Ep&H t@PMAYE@E@t>[urVj]RUGYZEtH:UttWuVhY#)PERVMVu WuVhy#fEPx:t1j:VuGYZtP>t3tJj EPRU U:tM9u HvWuRh#/ =fC*C ttp1ut1t-"RNCZ{uW%{ uX%P.CX1e[^_]USZKJy ;J| t Y RP虉XZ]UWVSDDžDžDžDžfDžDžDžDžjh:#P` jP#;ZY@tt8tt8uVh#ѱ C8j;Pp} [_Åh#PZYtCh#S Y_t>h#S_Zuh#d [VSh#Dž DžzDžVj@PE t'1@PJYj:D_Zt@P&^DžG8>1ۅtK>tBj/VK| Y[9u"uFjhW%Sm tC11ۃu t =1Džt^1uNt;th1#S2_ZDžt >th1#V2ZY1=1tjjYX1hPRlDž tDž 11RPv 11YZuu0m!)Hu?[ uPh8#诮 DtuRj茾Rj觾XZujh#h_#jT 1u2j/S;BZY…tBu 1Ҁ;hh#o&Q/kDž1PjS=1u/;E=X15h0,h|#! ^_*>!t3hSSjhhW%S1hVS 1$hh#SJjDž tN511=`1t hh# hh#Si Wj*51Id1uj/VMx Y[‰tBDž=`1t WjWjXZX1-1҃c‰[Ѝe[^_]UWVS hDžlDž(Dž$Dž,Dž0Dž\Dž`DždDž4DžLDžTDžPDžHDž8Dž@Dž<DžDžDžDžfDžDžDžDžDžfDžEDžDžDžDžDžXjh:1N _Zu P# [^@đ_貑Z蠑Yfu-t#8th#P芇Y^t h#0t8u+pu =d1u h#輩 Z PZXXtd1tL=1t!WhV#501r CQh#蛋 t2=1tWhk#501\r CVh#e u>`h1"PM^_`P诌Z@u8h#$W\=1t501h" Y[j.\h`$HR@RtSh#501 b u E 0EڋbMXZtSh#501a U 4}bth#& ^_'h# Y!t fZtSfXue[^_]USEEjh1E ZYt-=1uEE@Ejj耼Y[hjjKY[h֟j \KXZEE;EEj:M 4 [Zt{ <1=1u 1EU 1Ed1t'h"SDZYt;|tSdd1YE~E@EE@EX=1uE]ËE@tjj蘻XZUWVS$u j h#]SH]EEEurljEPURD<:[ J= =~-v*sY1Hy P>Y JPh#Y1Hy P>Z JPhhhs#5Y1[W5Y158A1j>j>=X1t ujPY|<11fx<1<1@ulp ffz<1jh<1h<1!] 501h#501hU#e[^_]UWVSD}Y1=P1tWPHjjP! ƃ HPj5Y1 @-Y1EfEjEP M]ġ1ZZ<ډEUjEP M+M̋EZ[+Ey@Biy1PjEPW 588t+88#th#<1EEPEP5Y1 à ty5Y1 Y1VjS @t?}uEjEPjjS; W5Y1z'Y[Quh#9p X5Y1 Y1Z1(w78\i78#Nh# 뽍e[^_]UWVS]t hF# Xhh_#5Y1@5Y1 Y1)Ã(t hF#x X=@1t X1j<Xt(t#fVfthWP jYu=X1(ujZjXe[^_]US EEh#u:[Zt E#n#=l1us#E1u=1t=1ۃ91u%h)#Yt!501hh# ZjSyXZj]X=1u)501h#v [Xj:XX191uh<1h#sZYt}jSIy[XjhA1胫 ZY'hEj(Y[E11 uuuhJ% Hu.RPh# tԋEPj(XZjXljC $mXE@E11 u{Eu PhJ% Hu|@1j$$$E$j([XjX@1uu h#501I=RPh#- mjh@<1F ZYhEj'XZ@1h#uY[¡1tt =s1tSjtj[XEt1=1P?[=s1t(MEu PhJ% Hu\jY뼋Eu(Eu PhJ%U Hu/=s1tjZ1=1PX=s1tEjX=s1tsjQi 1ҡY1%~j$ X=1u06u=@1tX1 h#E Xj8Xj=Yj5[=@1t X1EPj &XZ]UWVS1pt1rc!Dž` 1$111,1P=1t}u=1tTuu uy E 8-u}tuh#501: u h#501: ʡ191u<DždDžhDžlDžX=!jh@<1莧 Y[u#jP4uXZ븃=s1jcXhʌj$XZh\Fj$Y[hh"u ^_uDž\,,1 E 8|uijj h$ZYlE Xh(!S ^_\\uSh#1 _XX1,1Džd)h(!u 9[^\\u u h(#Džd\fzt \@xRP ZYxE%=tu h#5018 NEЋUԣ110jh@<1 ^_A51=1 hs#uZYthi#unZY1tw?\fxu\jWVP( \@jWVPyu hO# _X(5151h# DžX#}tEuuhJ% H1X^``u%uh#ZY뽡s1h#h#h*h-#|U ;tX1v&pX1tP;Xs1tX1PI_pX1j"^l@ujj !ZYl51t=,1t ރ=1y5111tX1T pX1`fxt `P\ft \@VSTs uu hOC" ^_@)8 x 1$1o\P7Y ` 1$1\J볋pt9 1$1|B01#|501v[pt1ډptu`@ @tu:c` ( 1$1B\H 8$pt9 1$1|01 \@ @t#01#u hOC"z XZ`@ @tzhH#] Xxj_dtd\R^Dž\`PLDž`$[thPjZYDžh=s1Y1xP XY1`t`PXDž`j7XX11; 1$1}jCXh@u l@u"hPjY_X㋅lPj G[^Y1xP" YY1du `u)\tꋅd\RZ؋`PXP,111 1$1e[^_]UWVSDž0Dž41PT1T# 1$1DžL11,1(\1$h#u|Y[DDu =1uVu=1t}t}u&E 8-u}tuh#50182 뺋E Ph#5012 ɋDtE uPu Dž8Dž<Dž@1=T1uDHjh@<1ٞ _Zt=s1tzj^hʌjXZh\Fj Y[<}tWE jP3Y[E j/P( _Z*$8tN $8 tDE Ph# [^X1$ E h"P^_E 8|utU W%9t @%tE jP53Y^t/x=l1t #8 uW@#8 u"E hP _ZyE Ph[#P=l1t 뽃=l1tE PYE .D1uJu tW jj kXZ19u(ju0^_11X1=ujPjY[@ujh@<1 XZvDu}u-k11 tRPh# ͋E8t8PuhJ%o Hyh(!0_44uuh#8Y^ȃ}E h"P _Zu#Dž0,,1\1E 8|u^jj w_Z@E h=!@P! Y^00u E @Ph#G,1\1Dž8)=E uP.Y^00uE Ph(# XZDž80fzt 0@xRP^_@t#E%=t,1\1s1h #h#h2h-#K ;lX1v&hX1tPy2Ys1lX1P=@ZhX1j_51t=,1t ރ=1y511Dt@11 t/0f{t 0IjRPQ1lX1, hX10fxt 0P4ft 4@VS, u08 u 1$1hl#( ^ڃD1 1{0jjjP; 11ۅyUE PhO# Y[F0JyG 0P Z t t*; 11|0x:уԋ0jjjP蠎 `PT9ȉ|M01#E501?XPT1ډPT 1$1u 1$14J4P+X 0@ @uL0 t|u<4Jy4PXt uL@L7ue O#4H vHq04 1$1v4H 냋PT95 1$1|01 4@ @tA01#8 u 1$1 hl#l X݋0@ @tE PhuC"O _Xj^8t80R[Dž04PBDž4$YLu 1$1y3`LPh#501=) 501h# XZ뾋D$ u=\1ujS _苅8=ju*[^X\Bu@j`S ^_X\lpDžtE SP& ZY@XP-$,U $Rh#501Y(`jh@<1q Y[t$X11; 1$1}4ju X*hEjXZ=s14P8X벋<@u @@u"th#WZYEue[^_]3ø#=1uz"Ph#501H  +t$=1t~ tP3PS2 S%YE ]e[^_][< QMZƒMuQWh5#501KSu QWhQ#ދ}u#Uj PMQ^MMEPjUR rPj h#501v릍e[^_]á@1 s1!t$uCY1tJu6Y1H1%Y1P@1+8!t+UVS t t u@Y1tJt Y11&Y1H1 tGtBB@"u\uXu@!@B؀"@tՈBut B1 s1@1u.Y1tHu Y1H1 Y11ɉ[^]US@1`1 s1@s1Y1s1@s1}P5s10XZts1ߋ]UVS =1t201SPm "[^8tPhl#501 5016jhh`1h,*y}u2501hk#t=1t01 Ey=s1Os10YÃu 501h#+u 501h#x t =1u501h+#脼 XZ1j 3uVYs10P5s1S =1t{t01b{ hjh֟j e[^]UEt]1]US]u hx#jI SZu Sh#j1 @]U=+u +01fPftP] Z9+ÍL$qUWVSQ01 ,1 ]jP + |11Z^+1y @B501h#Gh1h#3 ^_@O51Y\5s1u501h #Χ XZkq1q1q11HyPZuJ ,DB@uGG9u t$1HyPYuJJסs1uEq1a1kq1q11Hy4PUZu2501h#.kPkq1Bq1뭋J< u6s1kq19q1u@s1 ~u@s1NrFj501h#e[^_]1US] ,uh#SZYu1DB@tCjh#S u 1Uh#S]ZYu 18h%S@ZYu 1h'#S#ZYu 1]USZKJy ;J| t Y RP^XZ]UVS1=1u 1h#螲^t9h,#hY12ZY~ Y1.uHhY1Ph1#501bjhN#hY1 51tjhz#hY1 uVt 1 11j h#h1 tbh1h#501 Ht 1 1t*j hS#hY1= u501h^#X Y^111111Y1 h#3Zu)1<1u 1@u1 1Y11e[^]U塈Y1tPZY1111=1u 1Y1Л1ț1|1tPX|1=1u s1UY1jX=1t%01fPftjh!P) jh1zp UVS]0j;Y=1tlY1t0fPftjP9 5Y1nY1 Y1x jP 5Y1 Y1 1jZ=1tCY1t0fPftjP輺 5Y1Y1 1|1j訽 Xt Sh#j6 0e[^]UWVS]1=s1t =1u6u d1=`1<WZ`1Y1$u9=d1uEd1d1Pd1xd1=`1h5؛1V /thhW%Vs hh#V`V 8yVh#q XZsPQ =1Xأ151,11,1} t1=1PX=!EEt!jjRPPh#0!ҡX1-cvtY1} t1=1P謻X=151,1h(!VT`1V6=`1 uu h#K+ ;#P5`1hh`1_+ ǃ u5`1K`1[j h`1ZY`1te[^_]UVSQSMq1=1u 1=1u501h# PhB#ZYu;j hY1nY^t|j UR@P) M tg5 ,DN@uZSu=X1u=1u 1t+=1u"501hY1P 01 sXZ‰1eY[^]UWVSQ4My}1=X1}=1u 1=1u!}501hJ#ѝ _XtPhs#Y^j hY1V_Ztj.hY1AY^thY1NZY1uKjh{#V6 u7Vh#501 fY120hY1h#501g Y1 1}V_tVh#5016 EPh#V tEEP Yuu E 1ue1qu=X1u=1u 1}t3=1u*501hY1p 01 1XZ1EX1eY[^_]Uuh#j2h 1 u h #j 1UWVSP}u jjhz"jWh;#V ƒu&WhU#Vq ƒ uWho#V\ ƒ USjUЍe[^_]Uhh1m ZYu1UWVS151X1=1u 1h"d_uSj hY1ӺZYtA8t)؋u N9CT"=1t1u")ڋE Htn<.u}mtd9voCD"=1t|1)؋u Nt79vBCTE H9v3C%U JU9v"S% 9UvMA%[^_]UWS$]؍U1EEEEPShU&uy ƒ1uu' Xe[_]UWVSu] }VuS~ u/N ttO# t]#fN nS"YHˀ; uLUJ9uD ,yh,fZ t@,H ,8 u҅to#ff te[^_]UVSPuh`1Zá01vPh#趑 juh#P Cƃ`1 EUR)Ra1Ph,yh#uh#501 j2Zs119s1 U e[^]UWVSHuVbj j ShWuu Q t hhm!Wj hm!Sh1M I9Ot uwwV à ucjjjhVww thhm!V? ]Vh# XZVjjVn ǃ u(PPho#h#躅 PjV0 à uPPh#fDž=1~"jP 1[Xuu V à 8$}ul8AvPPh# VjP芚 +‹YY+y@Biy1fDžPjPn uf8u=1~s8#tDWjVӥ à u%PPh h# 1~ub<tQDžPPhhVk @h  ؍e[^_]UVS]u S Xu ]e[^]u P UVSu ]h.#V誛YZt'hU&V虛YZt>tuh8#$ XZ 1ۉ؍e[^]US]SZu Sh\#j˾ ]U u h#j设 US] Su ZY@u Sh#j芾 ]UEu h#jD P]Zu h#jX UWVSduE ]EEEEt PE_t SE[=1tMEtP:EYh#bEEZtPEXhc#9P9E_XEPEPEPVNy$X15a1E[Ea101t^RVh$P EEPjP]Sh,yh!uh#501 X11Vh,$P Sh=x1tPPÉ4$|<$WuPWh#S諚WVS裚E(tPY]uhY#XZu[}u-ha#菜 _u]SES1[^uhl#ΗËuVd1 tts;}u-h#- Yu]SwES$1XZE8uh8$ XPh#VËuV1 EtPh#)^_uu|151[1,s19~Lkq1Phx#ƗZYu0hh|#h`1s105s1$XF11EtP%EXutV_1EtPEYutVZ1EtPX؍e[^_]UEu)X1=1t%51hE$501 X1fHhR#E PEP UBw x1t l1u t1u)E @tt1t:u hp$j褹 PRPE pZY=x1t"=1t5t1h$501% 1j h'%h111j h$h1`1j h$h@1 1$j hq h1g1j hV&h1L1=1tjjE p{ UWVS0u=1u e[^_]&]ȹ 1SjhV u}uVh# S# 1E0ES XZEče[^_]UWVS,EPu EP? Uȃ u ỦEЋE0ufEjEPƑ 1EUXZ1ۃ=1~wjEP袑 E+E‹EY_+Ey@Biy1PjEPS u8t8#tu<TjEPVߚ u  y8E8#7ËU9| uJX )‰UE؍e[^_]UE]UE@(]UPEx$tEjURjj0V 1UVSjuЛ [^1ۅx%j0jZYu V菜 X 0@$؍e[^]UVSPuEj0jEZYt,0@$jjV jEPhhV ؍e[^]US]t&S(3 s4s,S&1]UWVS(]=1~jEP茏 1EUY^EE E̋C t ;EvẺEЋs})C C)E2}E&uW3V t}R)EEЃ}u488#tyC(8uE;Cw">uC,p8#us_ZCEЉC{uMEЉC CUԃD@fE؃=1~;jEPM E+E‹EY^+Ey@Biy1VjEP u'8t8#tC(1@E;D|51Ph*#501z Y<C(<뼍e[^_]UWVSS]{uhƉCYC{(t1{,uC 9Cts C);E E HCC CSjjEPbu{(u{,t{uKSBCEC9Cu0xWsXZud C($s{} us}UC ։e[^_]UWVSQu] }VuS u-~,ttO# t]#F(]SZHˀ; u;UJ9u3VjjEPTt} uto#F( te[^_]UE Pu~ XZ=h1u h1UE Put~ j UE Pu XZ=h1u h1UWVSSƉ׉ˉʁv )…tRUWV tUu6؍e[^_]UWVSx}E|ˋ7GEGEh1EYu hI$4hEZtUĹ 1u]EEEȉuEEEEEEE1E11U}11ɅMEEUEEu+}uhl$~Y^i$$U:t41;EE}uh$LXZKh$;h1`BUHEjjjE ]3U t th$BUHE U:th$[BUHEU MBUHEE}EU]BUHE|U  MBUHE^}uxNEu >U:u$ Eu U:u BU2EEtE }u MEHEj8h$jEP.;u h$jEP<EZYwI$$}tK}uEEmh$h"$2Y#h4$hJ$uhb$XZ+ẺEtM9u71MUEEE}t:jEPEZYvh$1h$UYEEEP贤Zt h+$e~PPPPPPPSh=$hu8 ,UEth$XEUuu]EUSe[^_]UWVSÉUM=+t hN$h1 Z+jjjSBu11@tCjEPS uu h$ th$*X1u1WVuuh$ E1EU)ӉM܉]E ËU 1 tL}xA19}M܋]M܉]1 tiE1-Ph$j]S LLD.Sh$h, uh?" $e[^_]UVS|Pj(ZYyh&!pU1uEԃ=l1t1h$щ1CSpSVj脌 tpt)u߸)؃u h$nt h$Xh$tPj1 e[^]UWVSÀ8-u2xu,=p1t e[^_]1_xDžtPx>^_=p1t8uvx+Dhl$tYlhu hR {txJ5+󤋅txJDžtSh$s%=@uxh$F=0=p1jx XZy xh1{!_XPSҦY^tS薋 xh$~ %Džl=u TlhxW脼WYơ+9~&)V5+苁YZu5+Vy XZt1 l1u xh$?:XȲ?v.X?v"?tP?uP ?uPɉ[]UWVSljU΋Cuj RPE F 5151hZ$j9 ؍e[^]UWVS ÉU;]CCDq@u<}U<;CAR5151h $jۘ @9}VPR5151h$j賘 x @$$DA@tCuG҃ ЈGO'5151h# $R5151h9 $SCtDq@[u<\t#R5151hl $$DA@ Cu DA@I Cu C DQ@ @C DQ@ @DA@tCu@%ƉG;u5151h $(1څt @ 1tJ;YuAApVsZYuV5151h $ 벉j0 1Xx@ 1YsC<\tu5151h $aj$j4G1ɍeXZu5151h $(wu F1ҍFwDžhCF1FhHX1DžDž؉h<\t uuBhh<9  e[^_]UWVS1ҡ111t2;{ uCp5151h! $: STYFu\1tk P`1ZX1@PT1Xe[^_]UVSƉj pX`+`+Xe[^]USj@\+\+X]UVS5H1vtQh(!6V YXtKySZt# PSP" St  SdX1e[^]UWVSu]81^L1u1PtJtHh(!p蛹 41_ZL1uph#j{ @181iph%"jh1ƴ vh$h,1躮 ZY11L1@181}541u VN tI=1W1Ju>#u~nu 141R fL1L154181X1=1u8#uxnu 1M 1M I"t11tnt @uMf 1/t181=L19G L11tBJM l1e[^_]U1@ t=<1t/=@1t@HyP-YtJ51P XZ1UWVS|u=1uQH18u==<1t h$$j 1,1f$1,1  11tQHyP{[t@ J51P] 51h1h1螥 ÃeN1=,uF1P轛Y=@1tdh@1h@1519o t $p$\19p1r\1kP5`1`1Y^=p1k 5`1CFPZFG=p10 11{u51syK Y[ =l1uCu =1 1t51CPj Vu u1 @))Ӊ1SPV%B Lj5151h1;jjh!h1j5151h1Fj5151h1U1 jjh!h1:j5151h1" 51saJ 1<1@=1,uX=d+u[h "uZt8tP d+X9TPhht@jj uVftd+d+<=d+u d+t 11<tR<@PPدHt%tv$@P 1DžHP u?F;5d+r51h$$I ^_51j$m 51j ` 1-WخYtJW%Z;d+r51h$H Y^151Hj@LitfW=ZtZPhl$;d+r51h$H Y^1@HЉ0,Ph$51 ,B 90uH@)< F;5d+r51h$G XZ51j$ 51j 1@ @臚¸:tvPذP51h!jx 1 1u45151j51g=1t51j [ _Xjh16Y^1f_jjh!h1jjh17@=1%5151j51g=151j XZ=11=1BHPj Wp ƅt*14)11H85151jWf=1t51j & Y_S814181 1u45151j51f=1t51j XZj; \19p1r\1kP5`1`1^_=p1k 5`1CFPݗYFGp1=1CH@u. d1t$P;Qv@1R51Ph$j,v 51j1ɉ@^Z&111҉HLC0t[uT1H 9Hu;Pt$jT10Wh1CP 4T1pP @9u9t)HL1H;HL}jjQh1T1PHσ)HLL(Hj@ZY!L HjHWh19Q tUAQ )HLLHj@ZY T1QNu9AuAQ 똋 1j)ȋ5T1PQh1rCP T1P @@DjH+@P@4Vh1+ t1󥸤11111t󥡜11Cxt45151j51b=1t51j M _XsF uq=1u~uhh PX F @t"5151CpV ;1t Cp jh!CpV Ht1 h1=h1h1[=1{uhh sW C @t5151sSV ;1tsh#jr jh!s*V Haփ=1ujjh-"h1_\1󥸤11111\=11H{51= ,u119Fx1Tu@1,jjTPJkH<‹;HvA;@u,PB0PV荶 0,uk51hu 51詟 1 1u45151j51_=1t51j [^Ljr$B(Pht1<)Ht1󥸤11t11t1t󥡄1t1)jjVht16뇄bC e[^_]U塀1txt@ x{u@jjh-"h1US];] ttCtE8t_O1:"u#C@؍e[^]USPmYt@Ut‹EBu Sh^$jRn ]UWVS Ek< +E@ÉE19E~GuVp9< u01;u)QLQP3kE/UVSu] h)/C Zwt @t2E0f~ufFsHPhf$h.e[^]Ee[^].UWVSÉQ-W-VPh~+$s ~e[^_]UEU t2t Ju6"2'u%32`2 `!2]]UEU wS$$X-2:32.`2""2`!2 32]]UEU t2t Ju9"2'u(32(-2 `!2]]UEU t=t+JuD @21u2=22-2 ` 2 ]o]UEU wG$$ 42.`2""2`!2 32]]UVSuU E$ $1if;2Z Kh$PB=ZYt u hW+X   e[^]he[^]US]E U $ $1Ƀ:i-2~/2"2`!2{32o}02 ch$h}02j<ZY02t=02t h*X ,12  ` 2 =22؋]v]USE h$P;ZYudhRh-"h .1]U@:2ƀxjjPUS] @:2ƀxj3P@:2 )t P=Xjj3P]UE 05@:2US] @:2)thej9XZ9ƀxj3PQjj35@:2j35@:2&(]US] @:2ƀx3j35@:2]Uju ,Uju Uju UVSu jVZYtV&jSP}e[^]UVSu jVZYtVSPB e[^]USRu ÍEPjSiu ugX jjS  ]Uu 8US]E $H$1Ƀ=<:2i 52*2J82 xh$h82$9YZ;82t=;82t h<'Z A:92 5` 2 )=225<:2=`X ؋]]US]E U$h$1Ƀ=)2i$2&2w#2.k'2 _h$h'298YZ'2t='2t hQ&Z ((2  j+$5)2k_X ؋]I]Uh覷221U 1j _1U 1j^ c1Uhh+$h:2LrE Uhh+$h:2%rE Uhh+$h:2qE Uhh+$h:2qE UE.tgzEEPjjpҺ UE.tgzEEPjjo诺 UE.tgzEEPjjf茺 UE 0]Ph+$jjckUE.tgzEEPjjhb UE jUE jרUE j轨UE j裨艮UoU ]U輬U ]U衫U ]U`U ]UjK_U Uj5_U U轾U ]U@:2,P1RP(U@:2,P@1RPu(U@:2,jhT(U@:2,jh@3(Ujj1Ujj1UjjҰ1Ujj°1,Uh+$GN Uh+$3N 1Uh+$"N U@1]UT-2j,1Uӱ1]Uji.1U=21]U^01]U+1]UEU ttu(X-232 ;2] ]UEU ttu( 42`2 ;2]]UVSE 0ڸ uhl#K hv#K XZjShl# jShv# 1e[^]U:92 =:92uhl#bK hv#XK XZ%jh:92hl#譂 jh:92hv#蜂 1U(2 .=(2uhl#K hv#J XZ%jh(2hl#L jh(2hv#; 1U12 =12uhl#J hv#J XZ%jh12hl# jh12hv#ځ 1Uh$h821ZYu;82dWhh;82h-"h $1Uh$h'2s1ZYu'2d hh'2h-"h t$1Uh$h}02%1ZYu02dhh02h-"h &$1U5@:2Zujj5@:2+ US] @:2)thejйXZ0ƀxj3Pjj35@:2$S ]UE ]UE ]UE ]UE ]UWVS É֋EEE ECfƒC19~Cfx fCEC9uh[-$RQus.h$RQuwCuDSu0Kx9tF( Fat~UCuBEs5+EECES _9~Mf{ufKf9|A)fKsu)K9M|9~fs)y1fssf9|MS;M},9~(CPuyRuFYXCu;M}ys(uzXZ1C9uf{th+$uQsFCujjs} uCES)Pss~e[^_]UE ]UE @]UE @]UE @]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE @]Y"U 1jR1U 1jQ1U"251]U` 2 1]Uh3221UX-2e1]U32q1]U;21]UE uU]U321]U`!2e1]U32J1]U"2/1]U`!21]U"21]U`!21]U 421]U`21]U` 2 1]Uh覨221U32\1]US] @:2)thej軱XZ*ƀxj3Pjj35@:2]UWVS ]u t/{u)PfvP t6vWϩC EC;E~Y}C48"Zt>vPzZYt/{u&MVU7MQURPkGE랍e[^_]FUS]CtBPwC YtsPEs * C sTs CXZ]UWVS +1AfEE1;E}DQF @tf~u;E}֍~@kC fRC tOP54?^_?sCƒF99fsK C9|)FfsU #sV_#P$$D==t'3=R6S<sσf}׍b$$C*h0,j觡 XZE{G  HSB ufCf;CfCs$uh0,jP 54&54&jjWP>=EtPu54=54V ƃ1Et9}} < uEF54ph0-$jj54^Vjj54N$jj54B54q54Z= ,DBxt;xdr<^+=1qu@usLu54=o,OCf0S K)y1fK)y1fCWCfEECfEЍP9UK ω)y1s9~fSM}9 E}|8f{snXxu f}tfCLz `~x~Ha (mS9aSB OfC?> =t\*=S=VIYv1 ,DBkh0,j胞 Vn |smC Zt sP ;_XsJY-taF t!u S_Z(t Cz~ftbF uQs&mC YtsP:s ]C sJsCC1XZu W_XF zslC Yt sPL:XZsIXCt6PrCX&uCD0tPrCD0XEC9E|ыC4tu S_XsCC ^PyC Y>u3>t.1|=tP=t܍jh0,j袜 XZ9}s$ YqOu =Rt=S벍e[^_]UU1U fP]UU1x91~1]UWVSP.519B  MP519n_XҋMu1 116114uj@+t-t)91r!DP4 Zt91v @+`+؋]U51a11XU518XU51lXUS]uQu P"nSPj`]US]u(u PmSPj7]UE Puj UDuPh# UuPh# US]uuPzmSuuu jPm$]Uh-"uuu uUWVS}5151EXZup},u0u(PmWPjj] ǃ}t%E8tE$9}ukT^|E$|9}@u6/}t$~ E8tP(TYU$D9} u)@E }y$uxZEj P Y[tE@M}}E)ȻEE;E~E)ȉEu uWQM51)ÃMu)u uWQhs.$51VME1M?Sm+EZMtP54,ZYMM51薁PS萀51PSjjS^$S_E @PE@PWMQ51(PS< P51.S9P51axuu(PjU,Ru$u uVP$t Zt hW%> Yhjxh~YZ hyZjqXUWVS$E}1T-2jjׇY[]߉jjP N =T-2u:SZxEPj _X}ejh訐[^T-2WYj@:2PgZY~>jhcj@:2Pgyjh@^_=*2;SEYujhXZS,_u@:2ǀ$HuVY@:2Ph#jXnj蓆@:2)t]SV^/}EEjPXY[{EE119EtMЋ 1҅t9t; tB C@܋Ekl9tH41҅t9t; tB Cl19t4EPYZu EG19tPZtGEPf_1;}s7klE@0 t(Pdt!ztHhr2p8p4xkG19t4EPrZYvGV\_}kSZZ^u`SD[Ohj]jYjGu8j]S4ZYu'.SDS=jj^EPXe[^_]UWVShPVo?hh#$VhVWM?$hh$WV?tOW2Zt/SSSSSSSSSSShy!h4jj[Y[WV6XZe[^_]UVShPV>hh#$VNhVS>$hh$S)St VSXZe[^]UWVS}1ET-2jj[^_ zj|VPI e]@:2$*u u^)uYjh\.Y[,u>tPZt@:2$PX@:2$S螙^_EScSjZYS9^_*$5$S-^54Sjj54!y54R54SEPj }tChj_jZj=u,jS-ZYu*$5$SXe[^_]UWVS}1ET-2>jj胁ZYHxjSPG xpu@:2*u$tPV!_XEV\[u4EPj ZY}t!hj`jj>u  V6Xe[^_]UWVSDžDD;E E8u EDDžLLUEL8< t tLu EY$}Dž889E4SDZ9$ PuS8 _uDžH<%sCt^}t1E t/t& ,DxuUWuOZYUtCE)؃~Wh$PS9 FE ؍e[^_]UWVSƉUMjjjQ à @t5$1UVjh1V&VuS#S؍e[^_]USPh1h$EPjh!u [Xh!j ZYttjh*$Su# u؃h2$SO ZYuh<$SO ZYujhG$S<# t؊t t@hSh`16% uAX]UVSh1.$1.$h1h@1$ =1tR)~1.u1Ph1EZYt+hh@%h@1Nhh1h@1:@1e[^]UWVS1ɺ!idu$xtxJp jPh1C$1ɺ%idu$xtxp jPh1 $jjj à < 1jh1V#Vh8i(S>!SvugL8P?hPh1#l#8PXt*hVh1 hSh1T]%Íe[^_]W|$wUWVS-Tho$(Pj+ y,D2t Ph$ [^h0,h$ j0 h6Ƌ(Y1ۋ(?RX,ZX9h$W!YZPWVD7 h$Wi!| ,PDžX+XtIQH%,$LHQV  uLPDAu&XhViP!C iƄV=(=_Xujrjp[^TDž$Hjj$V(WhȬ$Y @u"Dž$ jjVWhڬ$9 @u/z ;Tsh$jPZYt,뱸 ;x|s5h $jPY^u#heZt 1V jSr8T^_u522Y. T‰f@ @ 9uhojjjjjjjjjSTjuL4DžXDžPDžhjthPLؿh uL@T;XZ1h  1hiPh1jhM$h1t(jhQ$h1x Q$M$1DžPh-$j@$W2 jjPpVW% $@t pue4x$h1ha$h'jdÃlDžpjVjj$V 1@CVh?$^^_DžX=1su'=1lu1 ,fDPfX(PhW%0| Y[u7h#P_ZÅurDžP1ۃXEjv$X󫍽p!1󪍍pi^@_hhD$WY[Fhh1h1j=1 hh1h1hh!h0$,5 ÃPh]$j ]h$S]h$S\h$S\$h$S\h1h$S\=1th1h$S\ hƭ$S\XZh֭$S\h$S\Sh$jw\h1h$ho(u)h1h$h$S/ SBDž$hh1h1j~uhU$h1t~h%$h1o^_tihI$h1ZY[tThR$h1E_Zt?h7o#h10[^t*ḩ!h1ZYth$h1^_u 1b=1tYh1h1hY$jct=D2thw5D2P h^h0,P j# h>$jUpV VWPh[$hx$SfU =1th1h$SJU =:2th:2h$S.U h$jUjoSc=1"Xh1h1h1h$jhϱ$h1L" hh1h1jjFj jh<7u`h$$S" h1S3dh$dP O _Zt 8tV&k [^^jj`RPHPuB=1t h1h1h1h$j h1h1h$j=1th1$h1 ZYPuh=1t&h6$hh1hQ$hh[ho$hy  1j 1X 1䃽X؍e[^_]g_UE= 1u]]UU-"wh$]UWVS] }Rh$D^Zuu ƅ=jh$p:jjf@jh$MZY9t x/t/@?/uGjh$MXY1iR4$SRPh$hu]% e[^_]UWVSƉˍPh$6ZY-"uu$VRPSS`"2u32PVSWh$hke[^_]U 52E]ZUS]SWZй-2؋]9USPEEPj EZYt=32ya 2=` 2/t` 2譳SPh$hh,22$ 1]US]= 1ujwXE]EPj 葰EZYtt32 z22a 2=` 2/t` 2+SPh$hh22# a 2=` 2/t` 2SPh$hh)2# 1]US 8Ph"2m ZYuIh#PNY[Åu0hh"2h22hh`!2h)2Dž44Pj 茯XZ4u^h`2h 42h$jaÃu32h"2h$hh22" h`!2h$hh)2" ؋]Ã= 1UVSh?T[y`1u!h%fYuPh$NXZ=:2t h-$&X=1t h0$Xh1h $hS! h=!SԳƃtK0SPh$jGNh_ #V_Y}E@ǹN1jSEpS}WSuVt ~u hPRD_[^tEPPRZYtbJ 8t@ 8uE@҈$t$QP^^_$h~$EPY[thEX| x$t(p,hl04t:$VSG^_Zt'EPV4Ph $hS` EpFjh$$ZY@>7h $h/$S['Vh>$WO'WhJ$S#$WePh}D$SSxe$d GPh[$ t0Gu'hh$[_th{$PZYu eXRhw&P% tjj h-",4,0RPj$W譟 S , tH$LDJ@t$SPWVh$hFP ^d :11󫍝DžƅDž1DžDžShQVN[ +1Dž$f=t&fy!f1f=NEf=FX!lj$1111#$t'wEH#$ȃ'w*A $$u(t#$A(u$H< uuƄ$jj h-",4,0RPjW՝ SWVh$hFP$ 41߹J󪉍$1󪍕$01ƅ0ƅ4J0,4f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`V~Y~ j!GjAej6Mjj h-",4,0RPj+R脜 (SGP+RVh$hW Ijj h-",4,0RPj$S( SVh#hW{ 0E@8$@}‰Ѝe[^_]UVSPjjuVjjh$O@t.uXtjjVSjh$(@u SY12h$SZYt PuU ^Zu S[ h$jԍe[^]U EEE EEhJEPOZYtEU EEUhEP#ZYtE1UWVSdNjEh$w`$ Y^C hW%w ^Zƅth,$3 ZYÅGtQ\tBJ@u xt@G522@:2$t.t"P҉^Xt@:2$1ҍDž9@:2PV3YZt]P,40V(ƒt4t(RЉXZuaRY8ku $uP҉XZtԋ$jjjjhSQRPx jjjjhSQRPx h$S h@:2PSmhZ!P h@:2PPBW(Rf^pT`~a9fhGPShwVP޽;h$ST hwShZ!S5 hwS衽(t tYh$V hVjhwS PhT]%S à ƅH1ɋÅh !S菻ZYu!PhT]%jY à uhQ"S]ZYthy"SLZYth#S;ZYthb$S*ZYth1!SZYtt hh$ hhT]%Vh hSVY ƅGw PV莛à twh#jyj:t1ۉ؍e[^_]UEEMU ]UEEMU ]UWVSR]} E$hgj6S u E$4jRHDjjSRǃu E17‰EuE@WV$XEe[^_]UWVS E Dž1D󫍕D1҃=T-254虆 h, 54¡T-2 Iuujj%B[^1t,DžfDžDžDžZv DžDž111Dž9tD5fDŽ5DŽ5H5=fDŽ=DŽ=@C8[y1҉tt1DŽTfDŽDŽDŽ@t1DŽRfDŽDŽDŽ@hjjjjjjjjjPPj;Ã4uh#jեDžPS{umu5hjjjjjjjjjPj趛ƃ4tBDžPV XYZHօxPh_Sa[u?t6hjhPh+@:2`+Dž=T-2yuT-2DžT-29Dži85Džy;F=T-2i8522/"2@:2ƀyǀLǀPǀTǀXjSPhCP@:2"PjShX-25@:2,, 0$4(804$ DHPQHDFPj$@:2()",, 0$4(804 EDH$=T-2pH DH9jj h-"RPjVގ jj h-"@:2$P@ RPjP諎 D28t$@:2VHDPh$R @:2$p ơ@:2$0RRVP@:2Pjj:6DžDž$PjZY6PT-2P5@:2 tP3[Dž~SWZYjƆy$RP,40W$$_DdžHDǂH5@:2hYM1_ $Pdž$^@:2$JZDHCǂ,ǂ0ǂ4ǂ8ǂDǂHƂ(@:248<=T-2tq5"2_22Y"2tu 22h£"2a1Xe[^_]UMw1vੈB ]UWVSDžDž@:2*)Ph$hS ~$t+h`j/^~Sh$hڽ ju\hW%@:2Ph>$hS hW%Shh$ǃ(hW%ShjlE0p1DžRJZYtuE9klEX{4Dž Ctȅtă{,tjjjRhRs8WPx yjjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CLPQhJ%h8ǃ]YcLu蜟XZ=T-2CLS:SRVYǃ}SRjj\*1jjW6:$$=SC`,tPhɶ$hV Vh϶$P&X ~$C`,tPh޶$hV CXtPh$jWd WVC\tPh$jW? WVsSTMR!t.#u?~$VPh$PW ~$$CH@b$CX,tS\tPh $hV Vh$P!W $q$h%$PV _X1$w$h7$PV Y^C$$hK$PV XZW$$^7${TtO$PPV ^_[$$01)tt1ɍJB1;1e[^_]UWVS @:2*PPHƅh$yh=!h"xۇPh$j$=D2t"@:2X赇SPh÷$5D2` u6hvD2Zt Ph޷$ _XjjL3[^h$W$@:2ZYDžD)SPBY^_PdR P,V dRhC$W$TPVAL$ TH\@H1;@td8Dh}5!$hW UklMЉAP|Zu GE98wE98wjh\n*_X@ЋP4 jjjjhWp8RQx t̋Ufuh$赃^u&@:2Ph#h蟏jj)h"jYth"PjƂƃ y0@:2Ph#hNjj)MSVk1;sktGZSX1e[^_]USM119tPklAx,tBP4 jjjjhh1p8RQx tjh1j t1]US]1~ 9r ][]h[]À=1tUjh1jI 1 UWVS jjj( 1iPYSPj E uZEi]M}EjhZ!P u[uuPz uBE ,DPt+E쀼u} uFjujZ @upW Xe[^_]UWVS}19t2klwFLt#UFhW%P ZYUu NPy#C19tklGx,uHPC171u0kl_${Tw$Phm+!h$EPI Ee[^_]US]EPu 5XYt$Utth:hRPeE]UWVS\1}󫍕E221҅aƅjP`[_1} tE pSœZYtbP,40S跶t;JP2YtJG89wtfE@ ]BujR_Z 2211҅t $;] t t B܉tEoÄhjjhhjjAjjjjh +虀4VPv- ExtSx u^~19v}O19t }?;tBx(u PYFËEx uZ1&1ۋ9vx(u PXC܉؍e[^_]UWVSu1ۀ~ tD~9v,ً1҃x(u9t;t BPXCˉMe[^_]0e[^_]UWVSQ8ME111ۋE9Xv-E؋MMQrPEPL tu}CˉeY[^_]UEPE P0]UWVS}EjjjjhSuPRx u1=jjjjhVu WPx tVShź$he[^_]UE8b]UE$1Ƃ@11fP 1fP1]UEPE ]UE E EE] US]$1)PCC0@1RC1C 1C1]UWVSÉME1sNփt[1tM}+t B '1Ƀs,t+uAqtB EE뚃}tB 4BB$EEZY[^_]UWVSHT1󫍵EPE jhjjhmjh51jj jPSj|Ã8VP+rS}1e[^_]UWVS<Ɖ׉E19S vMQRUSPL <]UBjluZY1҅EEEE9C M9MMQuSPL k}lE̋UЉQE܅t8tjPQHL >_4EG8EċUȉG1)hp讥 ZteP ;hx .th PV@xPh@1O@t1t +9|qP51_Zup Y11P51p_Ztã1 1ۉ +E%=ut1@ ;=@t1@ +lPhW%V 11<$1@1P} 1C1Ylƀ@11uF1fVhjRPe[^_]UWVSh8"_ujVL [^P*} ÉY1h9"P ZYthhPWP =whhW%Wۓ =whVWœ =wjW _ZuS[ SX1e[^_]UWVShw$V| ‹1;tDi sRQV u֊a<w~tPGjjP耘ǃ t3DžPhd@W u uW$Z`RhedAWWu؍`9}u Fۋt< fFaPh7$W{ jjW蜗@t s9'hh1}@uzjhB$h1A Džu၅=1u;jOh(1PUƅ_ OusƄ I荗Xh[$sz CRPh#Pmz -qjah[$sKz CPP CtC @C 81e[^_]USP]U jRUZYtU؋]]UWVSEEt1l$&Et1\$1D$1 $Ɓ1@#u11 1@9u1jz1jz1jz1jz1jzǣ151V(Ë1$U9sU։Ë1RUZ9sU։Ë1RUY9sU։WZ9sVh-"h$jj 1EEe[^_]sU|EPutGXY1uE%;E Uh@uÀ=(-2tuUh(-2hH$j t1T32h"2hd$h$hh22J h`!2hd$h$hh)2, (h22sZ1Uhu.UQ 1 1u0EEE jjEPh1jEP11USh|L$zhyjja h|w#ghh|w#hhm$j S S XZ]UVSP]u EPVEPL5 E u Vh$j觭 SSPh$j褘ue[^]UPEEPjdEZYtM32}2gh` 2Ph$hh22 gh` 2Ph$hh)2 (1US 8PhW%! [X1u?9t3hP SVZY¸th#S>ZY]U tVS Và +];]th$h$hh$ Ee[^_]UWVS EUMujQ/Y[tIËE URjSuPNƃtPEV=XZ]e[^_],e[^_]USj$uZYtFEXEPjhjjj EPS$‹M Vt9U wj$S믋]UEPM U?XUEPM U@XUWVS ljDž<Piƅmf Ph,$V&h <PjY$tݽ$Ph;$pjXZ$u!$Ph;2+ Wj&U  Hvw= 1uj>_1\+Dž@+Džjhh|L$iPj(Uu1 h;2h@+W -"=\+u.h=+h$AzZY-"u=[+u$WVRhF$h衈VS = 1ujNXDžjhh|L$hWj'OT-= 42+=`2=;2h_$Wy W蓺 h;2Wh$Sf Wh`2h 42hs$jˇ$VSh1$j貇Whl$j蟇W~ VS Y^DžWj)ySXZX=X-2tZ=32tQ=;2tHh_$W Wʹ h;2Wh$S9e WhX-2h32h$2;e[^_]USڸtjS ZYuSh$j軆 ]US1AtjS ZYuSh$j{ ]USSF9tuRfEEPj%DREZYtt`Huƃuj h@%fX t&jR h@%fYXKuh̾$jTׅXZ1]Ã=1uiU1 (;2$?2$ ;2t$?2h$;2 ?2]USE] tPeYSj=Q4eXZ+2E]FUWVSDž8DžZ^1Dž@DžDDž<jj54XB3;2;2P5;2h$jaR_32Pj Jtu1;2uc ;211W,t+u@*u !xt1uƂ1A뻉t/ ;2'tju_X1t;2;2u9uh^jK 0VR5;25;25;2Ph$h4^ jj[^1ۃ}t_1tVh$h}ZYHu%h&d^j^_th$j}Y[h.$j}hZ$j~}1t.}hv$jU}XZ }hW%LRPE* urh$cLxRP'* uT|9u;xt8h$h$Q^_th$j|h$h$TM蛙}uuh̾$jT|Y[ju%XZ1e[^_]UWVS+{t,t#W3PYZtWh#h}\ 11ujhXZe[^_]UWVSDžDžh/$&KPh#P ytQP_Hh$JPh#P} xh($JPh#PZ y6륋tP^uh#h-[jj [xP)vh# ƃ t Yh=!P+ [Z1ۅV Wuuh#h-[jjZoh<"W ZYu记$u藤 t/Wh#N VhW u<=uVb W ^_\vZYuEv^_uWh*Zj7ZYuGv_Xtjh,>[^1jh-,ZY X | V聢 ؍e[^_]UWS]S 1E CM [_]Uu uUWVSSu] V 1EStet_klЉE1}9z4u@l;Uut>FjlP肼‰FXYt(1}9{4ukl4 @l9]uް1e[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF9s wEtEȋỦEUEЋUԉEU؍e[^]UWSPU] 1׉US)ZUtÍBٍe[_]PUS]s 莿s$膿XZCE]uUWVS]193v8klCxdF@0 ttW X9vklS9zduBd@193v>klCx4uFtWZF 9vklS9z4uB4@sXCEe[^_]ϾUVSjhPju蛟Ã1t4uu S$ @uĬ0SQq跬0Z1 S?qXe[^]UWS] 1Sh|duu t#S;S t%iSR3ZYt3X1e[_]Uu hzd@u'UVSujhPjV连Ã1t(ju jSVV,S~py ۫01e[^]Uu hedAuUU EHJ Ju BklsM9N@uLM9NSPh#j :P覞 *20j->SPh#j GP聞 jD>h> YÃs2Z£2~ް-T1~CVƄ5T -߉TPh$jPh2ݝ j.>h2P5252GP:P-PhP$hh 2菝 Dh|L$ CXe[^_]UWVS] @:2$DVZY7V,(C8@4jP螡@ x 1;4}aGu CP@@<098v SklLT<R+A<Q@+QP$@ ;,(}fF뗋8@} EhojjhjjjAjjj4@hi3E4URP(uN4@}j8H艠4^_j 藜$YDPRH8EZYtpF)PSEDP0S1kfC C EFfF N)QL QDPM0fN fF VXe[^_]UWVS] @(91󫉝Ex klSPf@ 9@P 9uH B$jϘY^u 522$󥃽P@u$PP`$󥋅@PB@u $ Bp+9t&R$19tD0 Aо$󥋍98P p0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhhsjj7jjjjF)ƃ4PV V[*}5PB89B49t0u+QP u,p[1k lCx4KS 19t;@8 QPWRL Qe[^_]UWVS ]u F@klPvQ_Zu1FJ MklV)tklR8RD8lP) ~1C@PsXYtM< }C+EPWD UPQ)}1E@ USV$fCEfCFfC SVSe[^_]UWVS]Dž{ u'1u$RSPL uC H9rˋ,0 t4u׋$(  @ƋD;{ s$RWSPL ,0 4$(; |>9 |B9 99 QVu5P-21P5*2WV =@RPWV %@RPh|$jPTS؋ ,D@u5P-21P5*2WV?RPWV?RPh|$jPuVu ,VSjhmGe[^_]UWVS] EEPR\E^1t1Ƀϋp EDEjPxC$ZY1҅p9tD B 0T02fA }tAkfAAQ 1BB uBfBBv B <BofBBl )9Uth$h$hjh$Z jEjjhh{hrjJjjjuPh 2!C(4ys$趒C$XdE<}@C,Ss(X^_{,3CE1E}9}tLk}l{G0u:8t4GLt.MUGhW%Pu;ZYUMuBy GD tO@E묅u}u6VLYtk]yvpb)Nj0W)WPjhpB)Nj07)WPjhV Zu(V_uujVY^ƃu1s$fC$s( C(XZ11e[^_]US]t*hW%Se:ZYtj/S跃 ZYt xu]UWVS]u}tE)GWEURPh h1uG= uʋWO uEueEtMUjh$h1l UMutt-"E U EU$V="1)uMUjh+!h21 UMjQ1 t21tƀ1HFu޺'131<1=Ttn=8 te=Tt^=T = 8tP=T=1x Ѐ 1 u; 1u;1u11҅tt6.; 1Q;1Ettu&/1Uh 2|É$h 2URĠ Uuӊt3),T@DDžXDž\S ^@u.DžXDž\48@DS<<j1RP<@1RPXPS@D DyjVz<<X \[  t@ D@ ڋKWVRP61ٍ4@DD49@D8}48+@D6@948D}D@D+48Ή; }48@D@9D}0t'j8XYw$(@DL跄,謄XZ@DeY[^_]UWVSu vv0N ^$ t(N^9ȉ} )ӉN ^$F F$FV1e[^_]UWVSQMLqyA Q48AQDHLP@LCS$(WVSP|+48׉PT P-2 uPT1ۋ48DHSQ<@RP.Ɖ׋<@SQ84.)׋H9T<@u<@D9Pt"SQTPW.<@PT,0P9DHT}DH,0<@ ;<@}  @ƒ VWY_t1Ҁ{uh\$bXЍe[^_]UVS019tklYCLu@u19t klY{,t@klA[^]T[^]UWVS<Ɖӡ@:2t*)t!jhW%h$r DžjjPPjh+@t=ƒ u'@l+Pjp?_Z@t p+h`+j*@:2Ph#h- =l+@1hW%h$ ZY@:2t )uV{XutWPh Wp tىߋNA4jjjjhVq8PSx 5p+l+4$h$hSg WVSh$j((W8pYh$jXZe[^_]UWVS|jP!_ZxIǍxPW=Y^x- uhVWc! =t Ws"ZKWg"Xf}u1fIҁ󤉃EfǃU1e[^_]UShEdjjEP]Sh5$ @t2h-$SUZYu L2hH$S;ZYuL2]U$E]TUWVS8EEE@:2f(j@:2$u}jjjPPÃu1 @:2jjHDjjPƒt͡@:2$KS19};DH} DH5@:2$Eȃ=H2ufjj]Sjjh+;y EueH2_uh0,hM$ [^jjSPjh+E=H2EċEE;E}k]T EPVZYt E@Eut@:2840h$h6EPEPEPuDx!}tuuuh$h(P2EPEPEPuD}5H2 LMhhF s{jheWVdPVsss sh^$h(hMЉ P2hP2j, P2u1EEԋEE؋EE܃}t+EPEPEPuBPUԋPU؋@ Eܡ@:2$tuuuR@:2,jhP@:2$tKytEf(u;PHZHt)@:2$P@:2ǀ$XhhE^XkEEEE;}SEučL H2AEe1Puqqq quh\$hME$럍EPj-tEY[kUDH2DP2De[^_]_UWVS5L2t/uFujPg S1jthjXZe[^_]UVSPE X(uRpjƋ0_VPsjhS uƈEh9jj Ee[^]ðUE1Ҁ=L2t]M]UE} t=L2t(q1]U ԍhk$hw$j!EjjEPEPjh+k $@tE Eth$j XZøøUWVS,]EEH-2L-2uCSEUCSEUURURSЃ tԡP2@EU @:2;\`|.}t1hjqY^uCP@sK t9։}ȉH-2L-2 5H-2 L-2EEЋEE̋E E1E}E,EE,U}Fhj辏Y^UuE${ v t$u$у E u7fUu)8t$EU=@:2;\`|ɀ}tU uRIE (Ѓ Ѕu uuth hh6XjʎZuVh#h+$Se[^_]UWS0]}ȹ 1EEEE =L2ujjS@ jP4E܍EPjS@e[_]1@:2f(u_UWVSQE E1Ƀ1} uAu@uFI t }DZ[^_]1US0]U t/MQRSPL tsuuh9$j3]UWVS4}=L2PklUVE 0`XZE UlVSClPH 1CC,C0CLCPCT @:2$F( t19~ vJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉChojjhqjjjAjjjRVh虼E4URPu~V$.}/1Dž4Dž89uv<`RVSPL t$hl`d48FjHb)0F ZYw1<@(,9H%D8`RpWQL`R7}WS jj84@h jH^_u%D2UPh&$膺 Y[UjSѹZujhQ_X1J5jS[^&sjhs@:2@u ǀ@>U1]EEPV~XZ}y1N1҉Hùxt%| q1@ 4S-|GEE;xrB;Us E11ۃ}t E;]sP,C_PYVk5p2 XZ}1Ѝe[^_]UWVS0EDž}uEfA2jS`^_UjSHZYu}X0jS#^_uXMY[ƅDžDž9A2A2} tE 9WuE(u)tURZu#;s{ E, UHD9Ɖ}djj h-" WVjWhj蝳ƃ 3葳WVPhY$V V贯 ƅ3\P蓯 ^_00@ n8cw؉1@uβhh²jj h-"E,MH},DRPjVٟE$hi`RjPESYƉ<$T1 ‰$vSP S~[Xf S $Yf <$S WPV:9r$hd$h8$hh$3 u莱Z1hjjjjjjjjjPCÃ4tPS裝_X1;s <1;t4@YڅttVzZncX t S螨X1e[^_]UWVSljfDžv/ƅujh@%Y^yhh@%S p脟t0{8t&qWPh$hS Džp!shWS =vhQW Ƅ/QPha$hS{ j/S _Zt-xv9tH9s8/t@QYykߍxPWY} YZu^%=u0p: >(hQS n=@uWtZuhWP =hSz2 Y_Džp;/u1{pt}S#l<$ZplT =w9puhhW%S =whWS =v ?Vf _y VrYV@ ZVYX1e[^_]Ujh$Hjb UVSÍ|PS'{ Y^1xeEt\jSXZxJj \PS t SY,S\Ztf u Ⱦx1e[^]UWVSEUP] [ƃ}t1EV Zt{fx vX jh&$Sn uSuh$EPj @u hr"8 3Et}tESWuhw$ju YzV XEEe[^_]UWVS h$11tY+ڸ$xuڸ$nu#WS|y XZuWShy Y^1yah$腛hPS WSy 1u h$_PSh$j Sh$j7hSBy h$SȚhPP WPUy u'h$S藚PPh$jh$̚hPS Sh$jot!Ph$h$jKuh$S"hPWq h$SPWh$j,h $ShPW> h$SҙPWh$j,h$S趙Ph$jMh$S蓙Ph$j*h $̙hPW h $SZPWh$jc(h$蒙hPW h$S th$S Ph$j h$7hPW1 h$SŘp14+Ph$hW ztpWh$jC utjh%DXZte[^_]UEt2fP]USE@k $t!$ShWE 0 Cx2 ]UWVSh表ƍPhW@j @1jh$_ZRhW@P] 1Dž w\k $$u Dž"BVP諹 ZYu=t2DŽGjjjjhjjjjjj!ShyÃ4tj菨PSғSRXe[^_]Uy¡x2tRRPPPh$jUE @1]UE @1]UE @1]UE @1]UE @1]UWVS(Nj@E̋Mȋw1Ή}1lj)áP-21RPSQ蘺RPh^=#j]SN ]С*2Eԃu6VrURjP9jPPh2 S e[^_]UWVSĀE@kl} GNjE @] CuG u G08uw0EEEPj 1[^}|E MQw8P uEUPuYIG8EE u9pwk]lE X{8tIC] []19Mtklu ^c0AO0u uu ]u]u t;Uu}UEG0uW+EU] CS}t ]U]EUWE ~ -"1e[^_]UWVSlu} E 9FEklNA0tEpxP@EUH-2L-219| EU)AQ1@tA4$SwE@u9ukUlЃx8uP@P ExE4FVEU1;EE}wV9E]}hM9MvUM]+EUuuRPUUMNk]lMMUeʉT EUVEP$@ ]+CS EU11ҋM9MvV]9]v klTu9uv klDT ]u)։]u19Mt-;Mt";Mt8uW t G0u)EUAl΃}}9} 9swkulEpu6xEU+EUuuRPӥUMeʉu}9}EUM]M])ڋ}WE}9xvsCM] uuRP[MʋUeʉ;M}|;E]}ӋuEFX)M]ExuFVEU1;EE VEUF<V@9E]|F0EU9E]E@;Ew`;EkElNjEU+EUW19|WG 9|1GEUVF0trF0O0fEUӋEU+EUuuRPM]^k]lUыUeʉT EUVVFV e[^_]Ëu9ueEx8XpPX t 94X*UWVS4PEU 8119~.u2FN<uF EuPEXZC΅juxÉY_E1MQ}~ E;UڹUfB EB h5jjujjj(jjjuSjfƃ4uP\VgS8EEE܍e[^_]hj XZe[^_]UVSuE ]wi$$h>\o A[4h?2[~ S0pz t7z(t1hh$W~ hRW} ,9uWh#v [[$h:[ h0[h&[h [h![h"[ h#NjSPhM$v診e[^_]Ã=?2 UWVS1DžM2PZKM218t=suB89J4ƅƅ1M2k8|0<tg@PhT$jPޡM2Pho$h̉hh$R| h5M2VR| G{M2D(~&Ph$hW hWV<| M2D,~&Ph$hW hWV | M2D0~&Ph$hW] hWV{ PM2؃PVh$hˆDžDž88M2kt1;8 8tuÃuTM2B1LM2ǀ,ǀ<jWPÞ hW"2"P诞 =22u1"2ǀ22hI"2alj_ txL22tByu/229u22ы9u􋐀뺃a22OHk<˹1󫋅F@ BB )t B8#$t6B8DžDž$u1G9x vRPVL tLFj$t}_[Bk<W󫋅G@ $CCC C89X RSPL uCuu惽t݋rI__k<ι󫋅F@ BBB B8g?1fD @9v=;2t1( $󥍅P[< $󥍅PY=?2teDžDžDžM2DžP $󥍅PDZ=;2t1d $󥍅P XpxÍ1 B T B &2xHfF Dže[^_]UU J E]UWVS0ljUĉ1ۋE9}oFE̋FE11ҋM̃<tN9tKBE;UuSuh%jUR' 22Uօt1AMRP^ YZt MЋChj)XZe[^_]UWVSPtIMMQt>TPRL Mt.ẺEEЉEt E9EU} UUM|>XuC,@utVF$t#u0ˋEwCe EF(N,ʉF(V,FPN2UA#~ye[^_]UWVS 1ۃ=;2u1ylN2th$jW質 h=!W3 ƃQWh$jlN2ppp h$V h$V_XDžlN2k,<P,0uh$V_XDžlN2k,<P0uСlN2p$p pph$VNh$VC h$j4V j~u lN2tPh($hj pClN2PxZt{Wh$h0,W D2 Wh$P6 XR0PR GPZYtUOTtM8jjjjhRQPWxlN2؋QP :jjjjjPqTRWx Ph"V :XwJ0PR[ GPZYtUOTtM8jjjjhRQPWxlN2؋QP :jjjjjPqTRWx Ph"Vj lN2tӇVPh=$hOh;lN2thR$h,h lN2the$h h lN2D؍e[^_]US]1{u6{ t; |CN2`A!{x[]Ã=?2+UWVS`1Dž1Dž0N2PzZ22Dž$9H QPRL 8PV6 V /t hW%VHmY^50N2 RV YZ9uJt(tR菜 Y聜 Z9v}tt$;H s41V D 0N2$Vh$hP 50N2'!u-"PP XZt0N2PtYV节Ph$hEe0N288  RPVh~$he$tt;,($ PRPh$hd$!PRPh$hdu&0N2@40|81e[^_]1US]1{u({@uC4N2t${x[]UWVS222xtl$u ƃxYPYt0$xt=jjjRt)PZuD2Sh$xÅtD2ySh$e1=;2 N2P_N2pt::t/}9z@u'} 9zDu}B@B AH뽃=;2EËlN21ۃtP}tJEJP1}t(;1u$} 9yu}k,DPx@,0uCp뫃=?2EËM21tL}tF:J<1t']9u ] 9Y$u}t#k8D<@8=uF1ۉ؍e[^_]US"2;@:2t922t3229u22ы9u􉙀[]UVS0]u$MQu PRL t!B21:uJ Jt;@ =uiMȋu1k 9B2u9B2u9B2t(Bu;k B2]ȋủB2B2ǀB2ǀB2ǀB2e[^]UVSMU19B2uB2r9B2u;t = u1[^]UWVSGDž22Dž|?1$%$9p WVPRL } t} t!} tWVS jVSOx k|<$tjjjjjtVRPx|ǹx󫋅tfDŽDŽ| Fhojjjjjj |}@Pjj|Ph/Ã4u1}=PSd$S/ 9|vΣ2k<}Ee[^_]US<] EjP2ZxD1k8|<u$MȉHPCdž$X!uCjjjjjMQ3PRx } t @#} t&*$URPhź$h?SjjVe[^]UWVS ]u Exb$jjjjj}WVPRx Wh4$hR u-t4t|Z~H|e[^_]UVS]sjht$V| u*VhF$h{R P@?jh`A!Vy| u3VhV$h=R 0|1jhUA#V2| u&Vhf$hQ ugtX@Ojh5&V{ u$t9VRht$hQVh$hQ u ƃy1e[^]UWVSt1=+t=;2u!hpjlN2Y^u ;2=?2t!h8j0N2_Zu ?2=;2ujHjÔN2Y^u ;2=?2u!hj蒔M2_Zu ?2lN2XN2PN2TN2p\N2`N2PdN2hN20N2N2N2N28 N2$N2P(N2,N2N2& =2uL@:2$t>22t5xt$hZ2/jǿY^tjjDXZǃ=2 ؍e[^_]Un=?2tuh$jP N UVSuu1r$ugjjjVExÃtjjHDjjFPt$@:2KS;DH} DHe[^]UEx8thr"h $hm h$ @UWVSQ} E@E19u~aEX=mu8u?G8.=lu8u/Gx=guWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$Hr$zuubPrYtWWZtNjE@ u WV0_XWPV_ tjVS_E@ t VPZYVXjjSƃx2 e[^_]UWVSu uUYP}Ĺ 1󫃽PuPZt苅P$S_xt2jjjSǃtSYt P$SPHHLd 1Zw j $RjP8x u0hr"h $h h$蝬 R7UMeʉ;EE}M];MEEEZ;M܉E}u܋});uE}u}E9EEE|EXu}px EEċEUӸ;EE;EUuuRP[6UMeʉ;EEM]Eče[^_]USQMAQRPRPjjjjU IuEU11ҍeY[]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]UE@,1҅t;U t Bx@t@]UVSuEV,1ۅt;] t C1M619F$vDk F(1ہ8u4A<Ãt$A< J<ȃ;] uȃB_X詈S蝈ZYv菈Xue[^_]US]sh&$j4@ ]]_UWVS} EX,1t)C@WP{1 ZYtCWPk1 ZYt FӃe[^_]UWVS,u}E E thU&h,"$hh$F EPu[Z1ۄtbjDjvZYtQ"$u_ CC4C8"C$HuSud [uhB$h!$hh$ à0tSh$uuw $Sh$uu~w ƅCƅCCe[^_]USMU19S$vXk S(tHt>1t4Q,1t9E t @11tt:[]UVSQMp@19|h[$h!$hh$ 9ù|@89¹@|1ۉȉڍeY[^]UVS]1C49C s6SrY;C K$}%jjjjRPRPU Ɖe[^]UWVSÃ=2u1t9;t42E21;}tSB UP' ZYh]B"EPӛ XZt($$>ttVP& YZuG C<e[^_]USPQRh$EPjC3~vh!u!<Ejh!$P^ t0u|[Gh<"EP= XY:tjME-[h!j;EZYuu|X1]UVSDžPTRPRP) "TuPj(PXSZ` P:|@uKhmSPh#jxuVEs VSSd$ uhh#h!$hh$H e[^]USEP]S+XZ1}u!]UVSu EP]Su9* tEHw q11}ue[^]UWVSÃ=2uEt9;t22E=21;ut}Swb$ ZYE @ uC F4V8)C S$E+C,t9tVpXe[^_]UWVS EEM EEEEE@,1҅9t B닓uF t t9t}{09~u;S,tShjkY^u}22Mu6lj󥃣E0jMZuLuVK89N u;S4t EP @+C4S8u)F V$U؍e[^_]71e[^_]UWVSuM~ t-^,11;E t9vt@ڋut$1IuF,tF0j:Zu S(oXN C4S8F V$e[^_]US]{ tjjST u]UWVS\E E thX$h"$h=;2uhc$h"$hh$ uhl$jPJ& 2uh~$Pjy$jDjiY[h!;-XZƅ1Džh!j,ZYwƅDžDžh<"P貋 YX>tރuNtjXj jV8  t t/j jV7Kj jV7 u7thh$P9 hVP$   wh=#Vg YZuDG8PW<G4h=#V YZu)+h<#V YZu)j h "$V?M uhjfXZu,#k[1;WkXj`VC@P O C,S0C4S8 u2t)CQ RP ZYuƅu_, G 1*E u GGGO_O _$UWG@jhRjPJƋ_,tnP4tKRPPs0s,Vt'8t"P[ PaYX@8u ǃC4S8)G W$mDžDžSh|dVJ iR`ZuhYSh|dVfJ u܋19v̋G,tpH,9H0u0;u"H49H8u;t밉jSPfL BuVZ1e[^_]U;2t 1=?2]USYSYSY SY SY SY SY SYSYSYS1h?#RP^ ]UWVSEUPUfPfUP Uf@fEExsu>1ۍujVk%$Wzy uu wujK u]CuEExlu<1ۍujVk%$W3y uu wu#K uCuɍMU Ee[^_]UWVSu] t>u1}WEPEPEPEPEPEPEPEPEPEPEPh?#VVd4 uy 2CFU,U9u 2@Ce[^]UWVSƉӉϋ@VEUFV EUEUEUv1}tF22]:U)SEC KF t h4!kE UPw@ XZe[^_]USE PMk K( : uBu'@ ;Et0j RkU P: 1]UWVSUE}u NtGtRutGtvpS GPhYf&vSE FD64t(vtvPSZ2 e[^_]USR] = 2uj EPuo =w uU:tt*haX1kDN2N2ucÉ؋]U U1vEEUEPRWU EZÅt*UVS14{MFZuSnMXe[^]UWVSu>pX19|hM$h($hxh$f 9} ǀ!@89} ǀ@ ǀe[^_]UWVS0]u=@:2U։@E =~Mȉ\LJ`}@8;CC| CP1RPv{ tfURjSPL tSEċUȉúu@ǃ9|Ɖ׃!! t9׃}sjhse[^_]UWVS]`t0`󫍓0 Se[^_]UWVS,E E thX$h($hh$d hjF_X@)$u CEU^~1CCCSƉ׃s {$Cǃ?ǃjh>RP!@ǃEPu裌ZYt!EԉE؉E܉EЉC1҉؍e[^_]UWVSSÉ։ʍNF(E19t<v u1(G 9Muߍ uZ[^_]US]= 2uv19 2v(1Ҹ9tkDO2B=v1kDN2[]Ã=g2u ^$uPu+ 3}tPh$uu> ]Ph$uu> ؍e[^_]UWVS@Ɖ˹1jhPjV'4DžDž1DžDžDžƋ!DžuD1 RPhSu=fU=_tP9u9uI!ֹ󥉅RE^99:ƒ<<„t <{n0dž0Džff=Ut f=uP(,DDž1Hu1xȃ<u*UuF,U-w RXЃtt uQPP,1RW蠲PN PXx 8t<t+@,dDž $tf;,vPu1hj>ZYt'DžDžDž Džx LXu1fǃUe[^_]US0E E thX$h($hh$[ hj=XZE u CEUY~1CCCSǃ?ǃjh>RP@ECǃ1҉,K0SSEEZ@uSxAM{ uCC$9K }2URjSPL tEt%=u SX1ۉ؋]UWVSSӉMt]0uƀǀǀ6,0Mt,ƀ)߉)X[^_]UWVS uM}] MWЃ<E‹Ut&`t[t hZEW,SC { Ct{UǂǂƂ}DtP?DX}1`t05ǀ`1ɉU슔׃ttAuEEU‹}싊M9`uƆdždž{019t0DžuCw$q00e09u+0t!0uu;LJ0MM`UE0 Ee[^_]UWVSdE}Ĺ }0}@S€t E1}t ߃tu‹}9} uE@u9t$t}ha}[E1C1EUWSRP+9؉σ}1ɉEĉM11҉utfك 9E ty@tI`t?1 Mtt΃t}t 9E t-@Guˋ0Bu}E$1;]׉u0ƒt ]<*EċUȉEUE`EUEUЉEUEEEtR}tƒtO<tK,]CEEK1M];EEE9MEEE}u0u]su< MtBuhr"hd($hTNE9EċEȃ}}tth+}Y%UĉUẺE4,M9sMjPEpuMUy}t E$EEEEE1ҋM9MM}ẺUЋE,uWSE*E tE tEUEU9u ǀM܅t,DU9ttP:uH UDXZEtDEtT9]u.E9haCjjEP E̋UЉEUEċUȉEU1҉}ttBuhr"hT($hlZEM]M]։uE9΋u})щE"}REDh$R Ee[^_]UWVSE0E}Ĺ u }t EE @uhF$ht($hh$R u}E]$}EEEEE u v ut tu!]\JMEJ1ۉM]E}u] ]t3] ] €tu$}EE EE PEUE;EEEEUEUEUE9EEEE P @|UEU|UEUE9EEE}}uEgE`ut,1EUEUE;EEE}ދ0Љ/E9EEE|t1EUEU,EtDžx1tx;EE|,9t(9ME|}E1hj|2EZYEfǀUƀElDžpplxt9uE|N1+u}ủ}ЋE},ujPMEXU܃ t$4t9tP6u 4Y^E0^F1EUplRP3։щEUEM9}E,E+u1u}u}uĉ}ȋ|U9E}}EU+EUẺUЋEujPEkU܃ t$4t9tP5u 4XZ;]ue0u\E,9EE}Hhj0Y^uE822}usvu,fǀUƀ0Ë0u00MME`US] v$}tM M}E] ];] [}ME @EjQEpQMUE<EE1ҋ]M ;YA EEEEEUEĉUȋA€tuJE]EC1EUuuRPӉ9؉ʃ}1ɉEĉMȋMċ]ȋEEEEEȉEUЉEUU9UEE}EU)ډẺUЋE\^UTuVuEU܃ t,ƌED4t9tP2um MD4XZEDFEhaCjjEP U1?t9Wu} @u1Em1EE1Jtd9@˃tuLu0u}t:u1KMttt}t9tv@Fu֋u뷃;Uu1[,ujSEU܃ 49P1u* 4^Xe[^_]UWVSL]E EEEut,C,uC0EMċUPX{,5ωu1)U̹ 1󫋳1E;E}u}uĉ}jjjj1RPWVjEPS,tEUEĉUȋEUẺUEؤ{2jMQSMċUEG uaZuVh$suuuus($C,u*E̋U19}'SjRPuus,$C, X({,tˋC,tPC,e[^_]UWVS0ÉDž1@jhRPSuyPhd@ @tۋf=tf=Uƀfu fǀf< 󥀼t!,;duB $u͋0u< E EDžh1󫋅,t20t"uhr"h($hh$TG  u/ƁƁƁƁƁƁ} }t~1É1uvB? ӈD>1É1uvB? ӈ49 fDžU1 WVFщ#DžuAWVhPZx301$^uPAƙ9uI9uAH#؍SƃS+Y9m9a)XX؍e[^_]UWVS]Euh$h($h ,1uEEE1Ʌuh1&h($hh$D s{u}Ɖ 9uE}QRuuTK0S[Puu e[^_]UWVS]uh$h($hk h$C Es0hE?t SE<;}u拶0u͋EtP^C,t PY`1d!*FZus*X]e[^_]*UWVS}G,t PXjhPjw Ãt7WjRc%YXtRVS V)SZZWXe[^_]UWVS\E4h[E0hW,"jP]St jPSSjU S Ǎ@Y>w̋E0hW,"jP]S@ jPSSj! SЗ ƍ@Z=wʡ@:2EHDEU}~EERWuuSVRPމؙ9Uu9]tAˁ~ƉЋM\ǁ`@EWVSuE E0E8e[^_]UWVS]E E܋EE؋u@:20}481ɉUM싐HDEU}~EE}u?;E}9jh>uuE=~EE?EE܋ME؉8EtuU؉UU܉U ]e[^_]e[^_]UWVS ]@:2480h$h}WuVEPS$xuuuh$hWVEPS.tuuuSЃSe[^_]Ujj  j脺 j PUSX P6 $-"PSh$h0,! j( U=+u F+2fPftPZ9+UWVEE왉UE}ujEPj e^_]U0E EEEEEEEPEPu ƒ xEÍL$qUWVSQ@@u5jh2 22Ȓ2̒222XZjP Ȓ2̒2ؒ2ܒ2+22^_29y922}=2󥋅22DžDž=2uh%joj+(t!j jj> =2uph!P 2Y[tPh#hP XВ2Ԓ219߭ D !߭ٽf f٭۝٭y1d~dWh`#)PP= Ë52~-2t P Z)ƅ~:ƹdh-")Vh$Phg#)PP Ã11ɺ9}t @u4$WVhq#)PPy ؉+22+ 2y @Buxu 'tjjEPk  FCEyr؍e[^_]UWVSujuZY@t)Vu SS9u% 7؍e[^_]UVSu huà @tuuSSv؍e[^]U|EPuf ZYtM EUQ1UWVSPu} RUj S UuRjS tw)؉@))ʉ u C u  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U 1XV Sh'$0 e[^]UWVSWPE褰ZUt r$t@s΁ǁ u K tJDz u/ t+ <@uu RUR^UujB@ft Ks CAB><vD&0r UV YUw{t)1BȉCXuY t~z txj<TZu h$/XYǃXf@STP1.19Xv$kTрyus1TD@Du e[^_]UWVSSƉ׋|tQ9t3{ t- ufujQMP! Mt[ S VhI$. e[^_]UVSÉ1ut$PSʥSYjS>q"u|$PSXZe[^]UWVSÉ֋8 Ph$(.YXu$VSzSjj&C <uj$'XZe[^_]Á@|tcUWVS։ϋ@@tH{ t=  t1҉C[^_]UWVSSƉ tB׉M6iXۋMu hh$H-K   Y t6'Z@uhh$-Xe[^_]UVSÃPt3PT~t` PXPQ ǃTXXt3X\~t$ XXP ǃ\^ht3hl~t hYP ǃlZt1tV;C,X ǃXt1tVC,Xc ǃXt1tVB,X( ǃYpt1ttVB,tZp ǃpXe[^]UVSFjjjV>jt}LHPjVfg<@@t@s s t<@SVgXZe[^]US]jPͼ t@tkH ^y 2 7H ZYt&ǃSh6!h$*j$# ]USË>uQh$SXZ{LtS,YtFtSHt7"Jt$PSϐXZ]USÃtt1u?hvPxtPh$)RP{XZtu]Ãx t_USËu1S%Y t=uS`Z S+YuS)X]US]jP t*@t n h$(j! 0u jP!XZShHPn]UShSE0h u 86t"h$(YƄh0,S訣 XZ]UVS])RP uh|$'Y;t D8t@h, H 1tG ,yh,j  XZ,P, ShH$jVV e[^]UWVSu~ t %% Eu s&`u!VY}t u\1ɉ%@Eu s`uMV&Z}Mtutj`aY1e[^_]UWVSE<@ف` |8tf%ځ tWQYt ߉%ځ@ tW"&Zt 翉%ځ` t1r rr%e[^_]UWVSS]%Nj<smuf|0t0V=Y%t1҃w$R Vh$$OvSZ%tw4$Vh$[$ZYCth$m$j Shj+<ǀu!-t Ph$h0,2 EjEP40 @u h$$X<j4P4Wǃ4W$e[^_]UVS]h!#<Zr:|0t~ u h$VъYXvjXZe[^] <]e[^]UWVSD]u Cpt,PCMPhj@EP裔@uh$"#E_E{ VEPW3bƒuVWh%" ut#Ej@VCtP VWh'%"UCtU3_UXYt&MLHRWP^YMȍe[^_]UWVSÉUt0x11MjSYZMu C cS QuPRU3j^ t(;xUu;0tRh?%!1҉XZ{ t11ɉ؍e[^_]Ke[^_]ËLH{ t0Eh7"S2SB>S0]e[^_]/e[^_]US]C P|y)ZYt!SH9PHts$RP ]]]UVSS]31҃{Hy-tC$tUjjS U1>tutEC$u?tSP Y@u hL$ZjjASW @u hL$X]e[^]4US]][]9UWVSUMu { ;u}E4Wj ZYu{ ubFuE;E tx}tCh6%S葃MUWVSS#S/SA &;ut"C MUSuX[De[^_]UWVS] @?@tjE1t6HjEP4諬 @h$h$c:hd2%h|%hR% H|+`RL]!h%h%hR%| _hB%hK%hR% hB%hb%hR%h 1hj%ht%hR%J 1gD[h%h%hR%D8@uPh%=YCjjjk /Ph%1 >u 1ɉV$XZe[^_]USS]jEP4 uh$EY!wjPh$h%EE@tPSPXZ]US]E U{ u0C щ‰{ tG][][]UWVS ]]} u|SE|$XZu { tC Ph %m$%K^_CStP }|QSS[E fEPjEPuXEuh4$tYE 3Su!$XZu# E ~ WE|#YXt5{ tC Ph-%XZF$C$N>K>~>tgC**[FVtPMQVFE|PV2VP~ tWhC%7^_} ~EPuu# { tSYE Et#PHtJ}OHPZuXE e[^_]UWVS]DžPPhh@uh $hW%Dž_Xhf%Y^1hPF1׃ u Vh%eXZu= 87t3 8 tt Vh%7^_d`PSƃuh $[|tlPx WV!ZYu WjS ϋGOt=HOG P|!ZYt%Whjj >u5NG|HO9OH t҉WhV|XP|Sn!|be[^_]US]SޠZ@u: 87u ]] 8 t 8VtE$]]UWVSD]} uMMtFMPVZYt3Mv/p 7S UE $E!e[^_]xEC(f9t { tQPC Ph%f{(K>:Mu#M}tyEPVC*P Mt_{ tEj<}WQC*PdK PQMh%jt S*ȉe[^_]UWVS$}E EEEEEh'%Sd Y^uEE 1%+h7%SC ^Zu,E@8S Y@E] EEe[^_]hG%S ^ZE܅u+EhW%Sܜ Y[Åu EH1;]}E4a ZtCV<E[E1;U}>E UQM( É4$MQu< ]܍CE UB 뽋E@uh`%u+E E1E1EEPh $hu%uutrktA'NtP4tS6uE뾃Uu@뱃ptxtnuE뙃딁댁M냻yEm!<@EEE|tb{ tW+UK u;u}$UԋE4QM ZYtFuUԋM;UuuSjv E[jEPEp  uw|t\{ u[+UK u;u}$UԋE4QM苚 ZYtFuUԋM;UuuSu1v @u<D<E@t2 U܁ +;EuM܉7jD [^mEE;E}bM4|ZYt;x t5 ] t14E롉EE;E|*1ntC+;Eu㋇|tV[u4|0Y[t5E뭉|=+WRuMUuXZ؍e[^_]UWVS] U1{>tNf}fC(ffGfJuj蕀 ȋuFZK>s*S>+Ee[^_]UWVSu} t.hg %dPV҈à t$=hg %hh{ % @1 8thg %h#KYXhdZuh$$*_dpu^Džh%jjhPnWh %o@t2h%u)Wh %褗 ZYtfWS~[_ud;Y1 dtt>u?G Ph %[ |XZ{>u[C Ph7 %. XZ1pDPWdhnRPddnR =nwHƄn ƄoPRhhg %V@u-h$$h! % YXptjWdlà xpth %b Xϋxe[^_]á2tU2P2U2]UWVSM Ep}y1yy9s)}_+Yy tʚ;1Ƀ}t}[^_]UWVSǍ]SjEPGPShEU؋G$uʚ;)U܃tBP1;U]s @+UPH 9su @ JPM)H 뺃ue[^_]UWVSU} uh^ %h$huh %h$hhl % }ʚ;vh %h$h܉É΋P$t$9zuM9Ju Ju K(݉HS,tJuK0JjXtdUUrEB zEBEBC$t%9pw u}9x vHJHPC(BS(1e[^_]UE@]UWVS}] uuh^ %h$hI Euh %h$hJhl % u t 9XG@;GHv jPwDH uGDGHG tHtJOH j ZtNjtBGxGXp MHupMHt p ]X}t upUP@G1ۉ؍e[^_]Ujjuuu uUuujju uUSU] uh^ %h$hhl % u L at 9Xt0 B}t)x t#@@@t`@JB؋]UWVS]U Eu}xx xʚ;v [^_]É}u M[^_]USEU M]]]] E[]cUVS]u E1EEEE i@BU[^])UWVSUuuh^ %hp$h#hl %1 B$1ۅtK} t} 9xu7}9xu/t9pu&xtyz(xz0xB0C뱉؍e[^_]UEuh^ %hd$h7hl % U PP@LUE@L]UEuh^ %hP$hJhl %o U P4UP8UPv  DFu EPj @u?EEEE19s8vjEPC44o @tF1e[^_]USjTjZYtR@Pj\ZY@u SX17[C C CC$C$C(C,C,C0CP؋]US]CC4C8t7HtJKHPHXۋHtJHP.XC uKHtJHPYC$uK(HtJHPZC,uK0sDCDCHX]US]SX]]UWVS]uCh^ %h0$hhl % 2t,2H22Ct Ӌ`!ft1f9thWhi6@؍e[^_]UU1B$t0zHu%1t]UWVS\}_>u | Vvj 7EEEE1uMuB EMQUE UJHKuԊEEjPV苾PG Ph %G>PVW|(u W*O>e[^_]USEtSXjST[ ]USEtSS\[XZ]UVSEu Ʊ9tt ut1t 1@1[^]UWVS}] ?jWS s jWV߿ wmj:V芖 ZYDžt?EPjhjjj jGPC C8 }t UC8jVCPu  ,  DJu <:tFu}Wjhjjj EPVŪ C0E t0it.u$Wjhjjj j@P蒪 C4E t C41e[^_]UWVSp] F1DžjqZ@ST9 _@u&hn#[[^Džh}VE@:hjXZfh$`X@ t"xtuPpZYuËtC VPł Y_t[}~D1ۍVE4蠂 _ZtC9]uDžY19]A}uPE0Y ZY1E@% 1ۋE9X~9jPE\4Ƙ tCыE9X~ Dž1ۋE9`~!jPEd4耘 uE`t9uDžC1ۋE9P~!jPET42 uEP9utDžC봍Suy^_HSh %LCEPh9SEl4 ZYGӋEC jP莻 @C$@ jRT p  ɍyDž@RhiEv @t @u SX@C@C*RtE<@u1t(StY@uh % SL SwfC@CCDS4w_Z@t CLCDC pSvCHC@CX[^HSu3vZYt&Sh: %Y[DžDžDže[^_]UWVS<}u tAu}*EPV[Z1@u0tC WP} ZYt[u{ 1ۉ؍e[^_]UWVSS} E{ sWkZYSs F<t<t+nKCtjRPQVsWjuBC~uN ufF UPjURPVsWju$SE08 EXe[^_]UEU tt ;Pt@ 1]UE|t @$u@]UWVSuU `d$1jF PS& `‰t fthShi6<hSh~i^ tte[^_]UWVS4U 1z BXu#xu[vV v p }u>)u9X.t/t* u%p }u}t uH }8O\ zz9wqE|t 9st[+ ؃4[^_] f US]SpZ@u:jhj @tjhj @؋]ѭUS4t6r$B4Ƅ4ttu ux []UWVSljQHd Zuh$ÉEh]B"EP ZYtfPd Xuh$SK[_LUj@PVb Uuh$SUR q7SXe[^_]UWVSSƉϋ]jh %RUñ UuUMd} hM} M@u ð`jh %RW uRUl} pMuU} ðDM\u `UC}C0MCPu pE$e[^_]UWVSÉUQ藼 _E>"ux"MF-Vj賰Ǎ@ZYw;}VS藰ZY1}u>t tCE9uuHMt 9MrN\<~Vnt>0bt!  tt:xtBrt  C E ,MNMߋUDJt!M߈M~MDyu~~U}EjjEPha  E1ҊM΃0wGMLBu}t?jjEP)a t.S=~t%tCEE}u0@t+9Es 71}M;e[^_]Åu À tt @ u1Åt8t u@ t1UWVSljӅt΀9uj/Q ZY…tH@EEPjj jjj ju蘛 }t uh %-t SP#ZYuUUWV ZYUuVh %%^_tB/1t72[e[^_]USÍEPjjjjjjRU蕜U ҋMuȉ1j{Z~CC1HuCЋ]UWVSE׉M܋ER^ Zuh$Lj=P褅 Y^EuWh$h %:S+ES葸 Z1F}t^EEEEtHRUSu` Uũ}tDW ^ _uGE0^S;XS/W] Y_uf/uFuu lj4$ EBU$uZYUMt:u8 D8NjuEDzjFPu uh$SXZDMe[^_]UWVS]s i{X19s v WF,XsIC C{$Y19s(v WF,Zs$C(C$Xe[^_]UWVS*EPjjjjjjW };Wh%*XZ3)‰U썄5j_uh%Y34D3:j,W| ^ZƅtxuWh%Y[N9uHO5j5Zuh!KX4s%ƃ4EPjhjjjjW2 , }th%_N4)‰U̍EPQML Y^HMЋUu-i 774U䉔7'47j9Zi4ɉ 5 6D44t4u Ѐ ?6t 6@AEPjjjjjjWc }Wh%r[^BoEЋTP-MЉTj,WZz ZYt Wi P U$UAXUuh$[Wh/%RVs 1ɉ!V)_}uEƀp3h%W%h ZYuEƀph=%Wh [^uEƀph#Wg ZYuEƀpWj訠E[^PEtEZYuh$XMЉtWP^MЉx_X]Iuƃ14ḩ!W&g Y^uƃhr&Wg ^Zuƃ hA%Wf ZYthF%Wf Y^uƃWhN%XZƁt,j0d_uhe%x[L1 $ ECEPEPEPEPQEPEPEPMԉE^ jWuuuuuVIjWuuuuu4IjWuECjEPEPEPEPQEPEPEPMԉE jWuuuuuHajWuuuuuH?jWuuuuu~HjWuKCj=Wv ZYuhn%Xa@Ej h%W uG1҃uMtj h%W袜 ujh%W膜 uM12ujh%WT t@jh%W@ t,jh%W, tjh%W Eƅuh%X@EȋM̍UE@u vM1ҍE@t uH#XtTEPV2EPFP2EPF8P1uVP&%$t1ɉajh%W@ M1ҍE@Nu"X;EEPVp1EPFPc1EPF8PV1uVP$$]1ɉjh%W袚 tjh%W莚 uHEPjhjh\jju赉 }uh%[^j h%W2 j/ur ZYDžtGEPuj ƃ uOt?EPjhjjjjW" }t'uh%I^_ƃt GN*uh@%1}Y[bUE nj/Wr _ZuEj@PDO D@J@M @J@M #UEj/Wq Y^uEj8P<ɱ 6<8J8M 8J8M VEЋ\XMЉ\`L߃0  ߾% ƁQP 󪍓 fCPfCSfCVfC^fǃƃdƁSƅtF1ҍEjH@PL mLHJHM @Džu#EC EPEPEPEPQEPEPEPMԉEk jWPuuuu_Ai 8WhU%XZS PWG P^_lh$\[ E>tuh%,Y CƃuWh~%XZ    w @c O ; uh%>^_$ EM>tuth%/[  t @t;j/WHm ZYEЅt@EЉEƃuWh%_X EXEȊEEĊEEEEEET19MtCkPu*t,Uf9Pu#U8uU8PuU8Pu U8PUAjE@PV WTXQXkËEfCCt)EECECECC}t }uC1C j/u l Y^ƅtFWuj Htuh@%1XZf{zEPjjxjjjjVC }TVh%CC^_    \Eč`1dEčh lEčpEčEȋEEu< }tEHMă Eȅ h%f[! }EÅuWh+%8XZ EPjjjjjjWҀƃ }tWh>%^_ CDžtuhO%[ EEЅt@Ej:Wi ZYtCURjhjjjj@PEE E}t2h^%k_& j=Wi [^EEt@Eh#WZYu6EBuhw%_HM4hM%Wղ[^1u!EtHMh%W衲ZYu5 Euh%[OHMh?#W[ZYu5E{Xuh%N[ HMhNq!WZYu5E5uh%[PUh%WϱZYu ΀3h %W賱Y[u @h"W藱[Zu h!W{ZYt-h%WjY[u h%WN[Zuh%W5ZYuh%WY[uh%W[Zujh%WZYu Qh%WѰY[u@8h}!W踰[Zu h.%W蜰ZYu h'%W耰Y[u hPR$Wd[Zu @h %WHZYu @h3%W,Y[u h%W[Zuwh%WZYu^h;%WޯY[uEhD%Wů[Zu,h"W謯ZY tWh%Y[k}tuWh%bXZE s!t@uh %9Xs,}u&h&%X}u#WhA%6[^}urI݋E. thoB#SZYtS%> E_uEEċ}u9j,EȋE@PQb _h$u[^TEˋEȋE9vU9t{t@E,ޅt9tS^Y4Ef}t }tEEƅtFEPjjjjjjWzEЃ }Džt^j11yXUB=vhb%XMRUڠXjỦ+Y E1j|@Px uh$V谨XZxUЉt|J|ЋUpohz%_"vb N:Ws^u%EЃlWh%EY[@UЉlƅt @h()%WP YZEЋEt+h")%WtP YZth$WcP _Z}Ёu }ЁẺyh%V)P ZYth%VP ZYSE @ tV6j_u h%Yl5_QCuuh%nXZ+1'EH$MčH(Mȅh%@Ye[^_]UWVSEu} EEEE1ۉE싀 $tM܉UVPN ZYUMtCguFE샸$$uu u E"@EEEE} ,$EEe[^_]ECuu E%e[^_]we[^_]UVSuhj萠ZYu h $3^ǀǀ@ hH$P <ZY@t s s ؍e[^]UWVS ] }}+t\%E싇%`E>URh $Puut9jj5l.5PڋEƃut%MCuu%몾t' ]쉟 E艇e[^_]UWVSSEE] 1t 8t R%YPZ1t 8t RXPXE|u7jVu LǢ<輢P豢\%8tjjV= txTuxTjP僻`tV,`X\[dXhtV,hd/lXptV,plx_|tv|xաYtVE,詡T螡XZ]e[^_]鍡e[^_]UWVS(uVZ,2 (2up(2@,2jjji5 tPS (2 ,2Xjjj;5 tPS (2 ,2!D_ (2 ,2hF+PP =v1dž} 7C*j,j$\ZYu h$ÿ_ ǃ`j,jdZYu h$藿_ ǃhj,j̛lZYu h$k_ ǃphh$W =vh$h%?Y^PP3_Zh<"P _Zt u-PP1҉xW YD9t t ux\tH@ߋ\`ǃ\ǃ`dhlpǃdǃhǃlǃpptǃǃhP8V7u8h$h!} St=w@ƄS8V_7DžDž 1} 1DžDžPPYZch<"Pƻ ZYt u t:`R YD9t֊ t uʀx\tH@߅t$䟁1h#E YZuy} tu jh@Pl讗 t+lh0 Zuh$豻YGhhK%fE YZu;}uP?E _ZTh"E ZYuA}uPD Y_utDž}tuh%D YZtOPPًU DžDžzu}tSV+ XZ1+u8؍e[^_]UM U9w]UU19U t]UWVSlj΍BEGE ˍEMfUfV ZuM8ˋUvu9usC+M}u4 89v "  @G19r)SU9Uv M)1e[^_]UWVS} uWTuhK%h$h^Tuh%h$hh_% JHCH9t)]Au'RU;ES ;ZYM8Ut u3F|G|u t tBD+CDu9we[^_]UVSjjVw à tSVx S ۍe[^]UWVS8}1}عEX}ى‰:E pE؉U 'EPW _ZuUBtt U Btu VS ZYe[^_]UE UU E]rUS]hX$Ps h($àSs ]US]Sz Y1t Sh Z]UWVSĀuh%h$h h_%? Ɖj<|RSk CP x{8jEt*SPj ZYtbHT9KTuZ8PC8P3Y_tE1ɉt8SEPm SEPk 9t| h$SXZ]OVP9_@u| 8Vt h%ѭ[jjWl à jSWl EC S9;U tSW"m SEPi uqCTt <@% s=t8ڸ%Sj0ZY@u{ 8t{ 8t h$XSY]4;E NSVl SW@j 9t{ h$躬SXZjjuVk à uUEuh %h$j;h%u Ptt -{ /1UEuh %h$jQh%/ Ptt z /1UUuh %h$j}h% Jttt8z /1)z 1zuz uzu 1zUEuh %h$hh%y Ptt1t-5z /1xjh$P UUuh %h$hh% Jtt!1t>y /1/z#1zuz uzu 1zUWVSu] }uhA%h$hmuhM%h$hnh%耤 FuY<u9FuFPhC#WS% @u84WSPFDPlÃVWSPFP Ã1ۉ؍e[^_]UVS]u uhU%h$huha%h$hh%ң {t~tSN8t#)kSZtVX1tO 8vt t1&vvPVS e[^]UWVS(uuh %h$hFE<t<F~}1JF1 G!)JO9tuw au G@u1>1ɉUк#]tAutU@;Es 8t1q.w /\1ۀ=02uQ}ع1E׈E02S}W8WV thm%h$h'h% 02؍e[^_]UWVSW]C<t<uEE v /S؉ǹE ^y1ɰE tE )ѸFE+E y111=02u302SZ;E th%h$h`h% 02e[^_]UEU uh %ht$huh%ht$hh%ɠ fPUWVEu uh %hh$huh%hh$hh%耠 fe^_]US$tPh%j XZ]UWVSDE]SBZj0S:EEEE}WSz195$v/$H>v t  DF195$v/$H>v kt  DFWSDt u uSjE0EPlaƃ SXEt t 0e[^_]UVSuEPu V tVj ZY@u؍e[^]Åt3UWVSƉ׉ˋtPWh%Vu 1Íe[^_]UWVSU} u19s$@u9v8uh%hL$hC؀xth%hL$hh%X u1Y9s*jCPU tًUGJ:N9s@uЍe[^_]UWVS`։ϊB _`u1P`P2lXZ`S X?@t _t^Fh8"oT Yu%Ph/%S" @ Ph7%S @ujWhC%S @Tdhlh>%W, YZuNltDžplxDjVYZDžpDžphM%W_, YZWp Z|6hU%W8, ZYth$W', ZYh7"W, ZYh$W+ ZYjh%W+ ZYUh o!W+ ZY@h$%W+ ZY+h$W+ ZYpDžp Džp_t@F Phb%Sb @p\$tPho%S; @@<t p,%dur"Ph{%S @GVH~i&t %Jt,$Ph%S @vDh%S @FLPh%S @v$h%Sj @jV٭Ph%SL@~Lt?vpFMPhhtR@ttRh%S @k~tu8?@ǀh8$tP[ |XY#FtPh%S @uz u RuARTXQXtPZYX9Tth%Sh{ ZY@jjtP^ ƒ ttqXjjP^ X9u-BTX Ph#S { @XKjR뛉Xh$h#Sz @XujPSj @h$W( ZYu"d,%r"h>%W`( ZYh$WK( ZYh7"W6( ZYh o!W!( ZYh$W ( ZYth%W' Y_twpuhehxOpu VZ;ptp/jVY_llxDr",%r"Ph%SX @Wh%SB @VvZ%u6?w_%u*Ph%S @ut|:u%u"d t>(W3vY%uPh%S @u(h%S_Z@pu^h/h@hq PVh$SaP@d$@urpll@LlqPPVh$S@]pt puRdhtqh@tdhqPVh"%SO@d"%#ptH2pu)Vh"%SY @1dufwpuVS _Zҋtσ8tVYtlpHpDVh"%SPh#S @tXd0uS> S}Y^u h@$Z#_tFP`P u,h@$踚X_Džpc؍e[^_]UVSË2tPSg e[^]UWVS}u }t}utSP ZYtgEPjjjjjjSkC }u9uBu1;} t>Sv M ZYt)EPjjjjjjS-C }u9tG,Ëuuq` } u,FuFuq_ [TuqX1G];M IwE!e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]E;U5EEErE,@x^ Vu<9utBE%?B ȃ}uz}E؁}E9Ew E;Uv .^ "q}?v ^ ^E}DEt,O;Mv ] 78ߋM_.MI+MM;U"}v] G}}9]ttC }Ut;]tC } t}E[^_]UWVS} EEE]1E9E0EEPes2$$CesxEu$y ‹ ,DAu\ Et\t(x$B ,DAtesx t/unU\ U\utvif\\t0vM\0C0C0SttOCFt:u[ 7(esUEu EZY[^_]UWVSÉ׉UƍPS_YZ@Wh#Sh @}uSj=螗 _Z@u$p h!S]h @un@ s;Vu hVT6PI sVu S: 8 s Vu S9s.Vu PhV=@Vh#Ssh.#SsZYsE1)D0<0tu FuU tSPl Y_@uyu } ;K;} u@tPhYf&Sj % ^Z@u2tPhW,"Sf @G륨tffPhYf&t&ffPhW,"Sf @e t PhYf&@tPhW,"Stf t%7Ph#SXf @sWj.VWj tbVh#Sf @tP?tGuUWVC*Pv Uts[փVSk_Zu VS-lY[tDXLR/ZtP|^_/VSZYtXlR / _R 1ۉ؍e[^_]UWVS(E̋A tӉ΀ytu'R xVx}WZ$1FCtUЉ F tCU{uCCF t#UԀzu ztK|@FtC8F t CXUF0CxFftPE|褏CT_X#F tU tUUЋECT{Tt14~t1Q h$E|CTZYuҍe[^_]UWVS É։ Et A@E}E)ȉE9s'UW|5_ZYtp|UzuvRUY^U苃| lj}t21ME1ɀzuMjR褈XZMȍe[^_]UWVSƉjjj à @thWVSYC S؍e[^_]UWVS8tM F1Dž@jE PRsC fDž ˉ󤍕i6MI>u*󤍕i ؍e[^_]UVS ƒ1ufbe[^_]ÍL$qUWVSQH1Yuh%h$hCTuhd%h$hh&%Hv uh%h$hٍ>1ƅ@ CtDžC8PYCP ƋƒZu9F_u)CT@fCXPRYu tЃtЀC| t Cxt(Dž,usT1fDž Ffp׉މ;tHH trt󥃅 QfuCTpV}XZtHHt'CstHHt󥃅  t'CXsXtHH)fSPt  @؍eY[^_]aUWVSDžLDžP"DžTEXDž\Dž`jjHVjjLS @uH1 R?QDZtjjVPjS u@D4YX@DH@D;@9@w -G pC u]dىEuGuXu hh$x_5$R 8ti> 81th`$h%oXZuq1 td4u5uSU ^_u1XPhfB@s- @tXCP)DC YuCtP ZS3LX1ۉ؍e[^_]UWVS ]c{u)ss s@ SCSC ЉEԍENjuEEEE؋EEЃ;Cw:uu؋U;UvUUV3ZYCUuC} E܋M؍DCC;CrCCK-Ѝe[^_]UEEE EEPhgBu, UWVS`fy(u}$ $Xҍ4uV$DžLDžPDžPhBS, ;8 .$DžLDžPjRS e[^_]UVS ME fz(u2]EfEr*ufR.fUffE]EEEEEEEjEPqe[^]US]ss IXZ]]IUS]x@u$1҉g@th~B s* ZY@؋]UWVSM}]utDw v7 .E C[UU +29vF7 "101U 19t9u} A,[^_]UWVSS1tލ<}})v ~׃kJufЅt‰Z[^_]USS\t$jr^s\nC\]USS`t"jR^s`C`]US]PSCXZ]]EUVSËtBC><v:D&FT|tL9t(tNT9JTuu 螆 Ë@ˀ{>v P Sh4%f e[^]UWVSÉ։h,jBZYt:PǀcScufǀ,1e[^_]UWVS0ÉjRGs^_@u PhL%:[5h\sZYDž\@u PhZ%e_Xth, PjAY^ @dtVWv<u?(9x u1Wt cScuGhu @G @(FH>A<wNw*󤋅 t&x utmtdf@ tStJSjpFjPSX9Ѻrf‹fP@TȋF,|D0㉅ǀcSc_$1҅tkDcScubtuPOdt Ghu;Yt>)ƒfǀ2@$)f5XH~$t>~DcScu5tt,~<t )ڃYf@6Vt9)؃gf2CtGt2)؃f3ȉCC+f7Dž9vprfуuL>t2L7Pu uJƃv;#C,m\Dž9`9s 8 ttBprfуuL>t2L7Pu uJƃv;cC,VP)HFt0GWu*)؃f9ffC3tHGY u<)9CM3A3󤋽3\ tC)9C= A󤋽 \t tk@WuMtB)9C<A󤋵\tuK<>u+@t@Zu)؃vfPhPqƃ tjt jV_ZH)9QC t CfCt\SVY^Ot/t+V+ ZP)9 SKtu@u7Ft#@^u)؃DftC5t<)9C5A55\|@_)؃f|tȉCsx19|v\ ‹)9ws{|9v Rh%a~t <‹KL9K@떉S+)Ё+wDB% Rh%[ < e[^_]UWVS EcSct* V EE1EEEEtIeBlE؍E];] {GE܄t;}u)) /EeB,E؍Bl뮍CE{ECE;Ew}}4EMt}u [؃ȀEE9Ea}tqE}9sE1ۃ}t])ÉUuPo7ZYU艂}؉EU}u E苀EM}}uԊEE} tE ]}tM}E苰ua( 1e[^_]USSӉʍMQM QMZYt }t1҉Ћ]UWVS$Ɖiu7h%Xf,Xfth$QP6à +_iS@ Ph%hXh$PS6Ãu2' Dž8iW Vh!X wh$ Vh%{X I?@u j5SY^@uƅS0Zuh$XXDž lj󤋅e[^_]USSӉʍMQM QMpZYt }v1҉Ћ]USSӉʍMQM QM:ZYt}vȉ1҉Ћ]UWVSS}uh%hH$h{Ӊ΋S IuN Ut`t#Cty KsjSP> uh5%hH$hh%P P S@tCP-Ztlj1e[^_]UWVS$ϋEE EhM%R ZYu}[ƅPY# $'-Xۋuh$T[uQVhRSV5<@t-PeP ZYuh$GTXe[^_]1j60j4@uƅw x,~!j@,Ph@hWu9dWPh~!"dWPh~!SVhb%\R$v~!tl$u)cPWVhu%R(cPWSVhR%Q ]e[^_]j3UWVS] $tPh?"+ XZE1E9v31;Et k, 9t@v 6h%+ PV蘽G,1;uts 3h%h+ PSrF,܍e[^_]UWVSEvvE E] VEtEubSPh*%u- @E^P~bPhx$u- @tk;]sP;] us v| Iuj \ ^_@u8CT9UbI "ujv\ XYBue[^_]UWVSuE ]xKt tPSWhS@t-Sh#Vȫ @u07aPh#V, @uLt 5uuVj[ ZYVj [ ZY@u` 1e[^_]USS]u:t0ASu*JREPjZYu1 }vff]UWVS,E E@hx}ԋ@E܋E E@_tE@o'EPjyMԋU܋E RXZtE-"(EPhMԋU܋E (^_E̊%t7Ev$؉EE9]s ! E@Tt EEPj!MԋU܋E XZt֋}uE9ECEtu 輙Xu EEU9t M;At;A uEEIʸy,%=tс1utȉE@uFtEPVFEPFP9EPF8P,Vu誚 ]E@PEPjMԋU܋E ZYuEE9u 蘘XEEPW虦EPGP茦EPG8PWu ]뤍{D9Es, "Mu YEtENjM )كȉEEE^;Et u;Ft;F uEE}uBtEPRU迥EPUȍBP该EPUȍB8P蟥URu "EEu3E @hu$űE Ph%KE؁ Ee[^_]UWVS$}ƅj4uMY[@uƅEXuX uExlSr\Pu h%u苦@ujuM^Z@t'^2Pu h%uD@u-S2P\Pu h%u@ujuM;ZY@t2E@#P[Pu h%uԥ@@ ÉS[Pu h%u螥@ut Ex,u@GhElPhhSSu h%uL$@ut 1;j@E,Ph@hS讻Su h#%u$@ul9v VC,X鋇\1ۋ9`v VC,Xp1ۋ9tv V`C,X鋀Dž\9Ή⋍T1Pum`19t k,; tYBRPMUXZt5_ Vh%^Su u7 8},.Dž9`vhΉ⋍T1Put'CH>%h>%V蒫jEo=${HuJCt.Chu(SJ9Hu{<t;t CH%%CH_%;u CHf%CHm%{0uC8C4bVh>s4jESiRUWh%BsshUR6. @Uu Rh% C_X{hEu/sHVD6juVz*CdCh=V3Yu2ECh$yBjE; E>uxEulCtSJ9Hu tQCdPC`Zuhd$CBXe[^_]g_VhJPE<9e[^_]g_UWVSu} tuVjj:9thrb  CiP6׻VD t;{t5{<t/s$*RPF Ph%3AB1ɺVjj9VTs !C Cs!CCCC CC{Ht V2_CdChWVZYsd!CC C$Xe[^_]W|$wUWVStEUM]EEuZPSCYEHT%u$Pt :tQRE Ph%?EE@Lu E@L@w}GL E@L@EixLhb EuB_ZEEEm5H#EHT%u$Pt :tSS$QRE Ph %>MUEE@%E@htEEExdtj$Pu& tϋE@$Et‹E@XZEE@uEEPjLY_uE PhI %=XZ@NjMC EC ECCDCEffCfCUofCEh` fCC@EffC1ɺ:_fufC fC uShEp\SFu$E Ph` %*= [^441~4uX}teuuujEW5E7t̋E>uhp&uZYujjES5E댍e[^_]g_URE]UWVS]3Sjj4Ghu'PtSh_jc4{ tLPWhm %;%r3%PWh %; ]e[^_]*U(E]UVS]tXwNSh>j4v$LPC Ph %: 'FL]e[^]뀍e[^]U幱E]UWVS]{ Wh %:F0+F8PWh %:Sh(j|3F<FL$]e[^_]fUKE]UWVSQ]v F FXuHjjS! C Ph !%9_Z>FH;!%h;!%SJ7EPWSy! ut>t ShD!%9[^jWSI! t jP (ZYF MFuWS! uh5%h<$h1 h%v3  FdH PF Ft''N V$vX]e[^_]e[^_]U幾E]UWVS ÉU싰V Et9Bt E9F$E;E0nIPC Phk!%8FiP3Eu~@u1ɺjuS EtjP&XZESjj1EtBFH|$h|$S}<%@Y^ u-j>1XZShhjj;0Ee[^_]UWVS(Ë>Sjjd0V BuB EjEPS! t@tdu,N }vuu܍EPEPWS'5@t P3#uGP Sh!%6SXe[^_]UVSËuPˆP@P  ZP \W(P O>w*󤋅X s3 t)h`RR@PP\ Ph!%:\@>tZh`RP\*PP\ Ph!%2$h$V3_\ Ph!%A3\XPj4X@Lp X@ @TT t\e[^_]XP \VXGG tx@`j`P\XV cSctTt @RX@ @^XH p$p\lX@@[x(PV\P HtmXHQP XGYt?w NjP󤋅X@XGHWdOhj\0XZ h$Q1_X@ cSct PX@ @^TXx0`PXiP\0 jl [ut_Xw0P`dP@DžD)HLH9PDL}B\ Ph!%/Xp X@ @@$ )NjPXH0x4x8X@ u\Ee[^_]^cScuߋT uЋ\;CLt&P2Yu\ Phh%*/XZRs5s$?P\ Ph!%.\Ee[^_]C cScs$?P\ Ph "%.\C<\jj\L' t{@t \hޘr)\hj\&\Ee[^_]cSc%Te[^_]UVS]C Ph$"%-NhFLXZ]e[^]LUVS]C tPh]"%-NhXZ$Ph"%-h|$SxFiP3諧FL]e[^]USE] tB:t=tRdt9ZtE |$E[][]UWVShd`\Džp:d BX9CTtu`dh h@><w!Ph*PdP uhx  E\@\u8WD1ҋ|!9u$h.#%hgCiPh0蔣hhhsPjh!CPu CPu4\Gt(jjP`d_Zt 1u`dh#% `9Cs s `C Y^`C{ d󤋅h>tispCCCC C CCCC CCH>%h>%hڋjhC\HhhRjnt"hhRn<u$u`dh#%<t!u`dh#%[;uc\@t+jjP`dh=_Zt,u`dh#%7 \r)u`dh#% \CPuQ`9Cs0s `eC ZYuh $"CXw`C{ dC@hjjhEhE003Ph Ph#%_"be[^_]UWVSEˋuw62PSE PhC$%$v%62PSE Phf$%"e[^_]ÍEw )ىM1MMىuEe[^_]UWVSƉ׉MBȉE|ta9tXtN8tIU9PTuAC><wPC*PGP  u$C PF Ph$% uM6[뛍e[^_]UWVS(EEԋ] uEEu莳Zt99v&uEԃ EE 0$E$%e[^_] )VPS觓 PЃ<@A{ 7fCf9$9EЋ8@fff9f=DfC}1EC EKME1ɉطfuHEuaEЋptTfuEf@MܺE蟷f֋E萷f9tu^0PEԃ Ph$%-fKf)эTEPEXe[^_]UWVS$}^\cCubh$RS詳 u#>t=G Php$h!WsPRWt^\ue[^_]UVSE pjPu, uE$e[^]uN]e[^]z\uN]e[^]e[^]UWS`(ÍDž( 1DžDžDžDž,t @`jWP豯 u hT$YWSXZe[_]UE‹]#U1ҋE]UVSuV|Yt,sss S|t}tt:uh@苃t&jPRYǃtP;ǃZUǃXe[^]W|$wUWVS tu PZK>vur s(Vfu  s ure[^_]g_Jh> ljEEm5H#PP$C Ph$%>ShUWj(e[^_]g_UVS]ShUjt~ht j3 kXZe[^]UWVS E} _uD9~dG PuC Ph%%SFdh|$SSF Gu\utF tm@;GuePN+PC Ph9%%+t SX5SgYtߨtWC1E샸sSZvFFO WFIFX~C$E}tnUҊMM섄tLGEFȀ8t PD)ʃ@v F M@MH@E}uFHT%j3hvHSue[^_]UE1҅tB]UWUBv 2E JI} ډу¸)Ј1_]UEt9ʸy,сt1H%]USU MEttt9Xut9X []UEttPf1ҁ]USE|tju S u[1]USE|t$ttP] 3#P uI1[]USE|t$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u wm^Qt u ]uTIhFhu t ?t61t0t,cScu=cSc =cSc[^]UWVS\E|E}FEx .Eu1E@$h8$EP[ jju ÃE8uǀxhtxduh%%hP$h*h%% h8$uV E@dZYx tYu`Xu E1K|EPdB#B E}WSnE@d@ EWCPnC9SV'bjjEEP jjEP E }E8P>i_uqE0Y_^B$NjuuP_C| SEPajuEP. EuEPZY@E@$txtiu_XEuVSmVCPmE@dEPC8PqmE@dEPCXP[m SEP`^_u[jj}Ww à SW sxC|ZY uC|E@dEPCXPlSu ^ 9tS_SM\X떀{tjSu à ukSg_tߍC8EPgE^ujju ƃ t9tGuVniZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EEZEuF$tDu4Ghu. juvHSt3Q e[^_]UEt tH]UWVS]E EEU}uM MM$MM(Mu|u _RPE[ZKPwYu 0EjWum Ã}Ut}uQUj4,XۋUuE$e[^_] ECCC CBCZ t4;C t/C 647VPh*%jC P }t ECCECc%tOt;C uDKtHJSHwuSuà }u]e[^_]\e[^_]UWVSut=t7;Ct+N PjCPC PSF P|jR$ōe[^_]USEt6t,ttHJHPX]]]UWp0i Y_}UWVSQÉ ذtZָ($ljU $9M9 u*8$ljU0$99u!Z[^_]UWVSPL}fJ}xv6 ÃtCEH@hEEhPdfGd9h&%PS:Ɖ  8th$h&% YX?w,j@+Zuh$ YIǃ@hZ) h2@uhVV =wPƄ ƄPPhh&%Su,hh$h&%ǃXZh~dwdhXETE`\fu `\\@+hD/ 7E \@󤍵VN dPVV VlRV PLhDdhlt NjD}@ugPtXE Lh󤋽Xu M󤋽TuMfJ`fJf1e[^_]USQRe YYS]UVS]CTƃ CTCPtCXPC Phk!% tFuBC Ph'%vY^KtPT s((t hM%QmXZe[^]UVSËFt t=zQw/hX) FXSh{Q+FPje[^]USSËu>jjZYuEh$"XE@@PP ]UVS]1u>jWZt)@ǃǃǃe[^]USPE]UURP@RppPMRP>RP*RuM UuU]UWSU v -1}}1t $M[_]UWVSt΀yv  y ׋QTs1t|B$uRPuOXtȅtGpCxF PS]FPURURCP]FTt KthE&u WC8P~]_XC9@VCXPi]ZYEh '%XEo؍e[^_]UWVSSEϋt<u[98up|t1҉tH|Pu=PXZ61e[^_]UWVSQMAE1t u@191ɾtAut1uB;Us :t14Z[^_]UWVSE Eu}MEHfw Afv f9M1ۉ tf@u ¸ u u u u xKEU)ЉE9}E " u}uEEftbf@~:f}?M t1҉EU+M t1"t@+M t1u}11EEӋE E ֋U UM ًEVEUF1[^_]UWVS}E uuGT((*1ۃ t%jPG@P ut #wTۉ؍e[^_]UWVSu }WVu&WVuhttSHID9JDs؍e[^_]UVS]CtP.jVSjjVO7]e[^]&UWVSuFXPF PhO'%/Vj=@u30 81t)& 8t 8t 8t h$1XF@tEPV$ZYt$C@u NtHUJNV^‰؍e[^_]UWVS EEEE;} t!CtGUBC8} CTS%t =} uKtHuNKjC@P2ƃ tC9FtSzYCu+t'E Eu}u EPjXZEPVZYSX} ue[^_]UWVS} E|0tYuvtCPEPZY@t+C@3#Eu!CD3G#EuCH3G#Eu CL3G #Et뺉މe[^_]UWVS] uENj@t)9Xu9p tXp W PG 1jRZuh$Ye[^_]UExuP u U ffP @]UU1zuJ u fB f]UWVS8u EE]rBtEPVu#E jVu E}tExP EhjLXY8EBzPt"ZTEBǂ<BTtQz Z@}J tu@UPEPQuSU@uu sz tz j.EPB Hz@UEP]SY^@Ur@tXz 1  L @uj.EPB@UPjs2 Ut!JQPh*%j.BXUP UUhx$UR>XZ1҉Ѝe[^_]UWVSEEE EEU}uM MM$M܅uE䋀| RPEZYEuQE؋EXtjWC@P }jVWurP'@uC$C {4s(E@CEXECPCTEt CT{@u CACu<~*Sh$W tSh$W u  VE]1Ejj@EPVHÃ@$@ Et;EPVCPC PC@Pǃu SZWE䉃C SC@SDf~(uXF><u,F*CHF+CIF,CJfCKF-CMF.CNF/CO%<uF*V.CHSLS辿 V;CHtSn褿 !CHE{@2SK聿 1XjA@MPW; Mt uJyPttEAXPA Ph7(%8S 2j.CXPWj+ E@CEXjSD1e[^_]UWVS]} FtHtJN HPNXڃЃjPV t!t;E Ee[^_]4?V ǃSjje[^_]US]XE]UWVSQE 81EjG@PE@P tGT(1}tS}usGTtGXPuG PhV(%gTGT@tHOtHU JOWZ&E@PGP uGT uFtWXOT }@tÍe[^_]UWVSRu E@EhE@PE PuÃǀp@4uUr4{(s41ҋE'CEH$Q+B9vȉC$}O : v: K vu;F v] SX1BCZ؍e[^_]UVSÉփXPC Pht(%VSt VPeZY h$Xe[^]U URjUEXZUWVS Et_*uVjXZ؅t_t @ FUMvjXZYUt0Mt&@}wFH r*NjM;jC CUe[^_]UU t,t9PuƀRhjjUEP`у1t0wt*tRh$h)%D UWVS EEE stqpCuKF@D9ADwgt tUt tC{du~du7u~hu(SEVZY9E~FC3^Z6|Ut&HJUPEC]&e[^_]UWVS0}EPj*ZYEEEE9{EnCTE܃{dtojPEPw‹Cd 9v t/uECPG Ph)%pCd EE)9E}шMtEEsxF @u jF4PEPN 9v trVTtRNXR$u%QPF Ph*%Vje@u蝫 81t蓫 8t h$XF$F fTE)}9MˆUtME6#ju܍EP&E̋CPE܋CLE؃ }Ef΍4u9us KuĉуuĄ@u[tuQ}vKE؋ptAu(t.9us!+u9u}шMtuU EEEE)E7}uƃEЃ}v1ɺ%]c}tWhuj}}t3G Ph&*% Oj7*hU%W?Be[^_]UUt&t9PutƀU]]UWVS}u1-0t9~t6^xtuu S u؍e[^_]UVSEu1(0t^xtuu S u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EZEPQdžZYtU9pu 1ɺOGE|tu6@t&jPlǃe[^_]US]t9XuPxtJT8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`ty @tѲ1҉[]UWVS@EPjgE _XEE 9CEuhQ*%j uVϯ CPVhW*%u2 @uksXsTVhb*%u2@tuuVhs*%u2@tCtPVh*%ul2@tS$C`^E- uE-"y!t #At-"! u-"]2#@u-"_t"x-"uRWVQuVh*%u1 @*sdVh*%u1@C1C9v WsPF,Z拀d1C9hv WGPF,XCPECLE}EfE9EsD SM@ukdh1}9t 98t(A, 1}9t398tA,}čOQ}OQhPB PEPu2L UU)U0sx1t8FT%u'~ t!GFXPWEPh*%ub0@6ċCe[^_]UVSu Ft%tF9CuuVCxPuݍe[^]UVS]Sjj1҅t#09Xuƀلt@j3w$%Y^t=t hU%S;XZe[^]UWVS] 3EC@EFEj.}WPj }wWh*%EPSuE u h$nEx f  M CS <E! }wWh*%9E=tWPh+%c~u F Gh>%u8XZEE>j^_E}xx j.EPEP E@xxuF|Ɔ ƅ~ƅExPu~uFL^h$[<uv[.MQRPh-%EpLU;PPuuSVP tV3E@P_ƅ~ƅ~ƅRljދME}xPE~ElE ElPhc+%WETdPj#CuF`VdfCfFdŠtuluh+% Cu@uFtCt=6wFhE@h E@h0uC tuFldžƆFphuE@xZYHTtff`hu uh+%h9xs uh+%upۉ℔`t^E}1p9t 9t B,tlp uh+%FlpWuh,%+@<<x<`t uh5,%!ENjtEtj覻XZE΍e[^_]UWVSRƋ19XkTKfu{u#{u{ u {u{t_fuCUhPCPVUt3ǀS( KfHGYe[^_]UWVShEwi EnEEEE@|tXT@uXTBEAEEE}rEf;EwH;Mv#ߏ E Ph.% _X1u<}M)AEffEftftfu f9v#v E Ph.%[^LʍEĉu)f]MX1ۉ9t,kMTfMf9HujRP Ut@CЅuE?@u+j EPjEPlPE Ph.%葿f}tHuΉuȋ]ˉ]̅tB9v>j EPjEP"uSVPE Ph.%蚿(nEEEEPM1ҋEEYtE3Eƀ>$f}uEȅWfEEEPjuWƃUЍ M))Ufw#Ӎ E Ph/%XZUܹUʉUEȉE9v'萍 uuE Ph /%衾qEX|ۍEjPS uCTuCTcT{4u EC$U9S tKTS C E}}uuE PhE/% f}t4}W`9ruuF`E̅t}Wdt9suFdE}E؉EjhPu!ǀS(fEfEĉ{(u ECE};};GhGhEe[^_]UWVSljUMu w@ Phm/%謋 u1ɋUY艋 EChCdC`ǃu uVj蛞XZƃ>VuMUZYu];t}tG Ph/%a[^=SDtKHuh/%h0$h h/%ƃ>VuaZYe[^_]USUE MvɉME BE[]衊 1[]W|$wUWVS4E؉UЋEu#@u5C|t @Tu!Eu@EEƃ@}t'QuЋE؃ Ph0%u2ǃ8 ǃ80%ujjE؋觳EPj$$8u ǃ8"0%EPj sHsDtf}t C`Q=WvC`C`XCdChǃV8u ǃ8*0%8u ǃ810%8u ǃ880%8u ǃ8@0%{`t|s|C`t>FTu4N !Bt(9…tFXPE؃ PhH0%ǹ 16뻉t%PE؃ Phj0%褹CdC` u;t0EEm @ !}fEހ fEm}mދEȉC`{duGtsL舙CDCLCHCPCth>%P1;Dƃ?K`qw$*t&uVQjACdPwuhH)PjE؋Chtuh,PjE؋E؋C|PNX}s|NjFT rHV t%tFXPF PhE-%ܶ F$uvFXPF Ph0% VT s(F$F VjjF蚯-NtHN sV=XVڵY>E؍p C`;u PVh0%MuVh0%,KdSh tRQPVh0%u{)uVh1%ud RVh %uPjE0XZEȄuA}t;WVh%賵sHsDhWE00 @u Wh%_XE؋_|t{CTƒ t ujC@Ps胶 tKT CT uVh,1%;XZE؋<r}؋t4r.j蜮Y[8uE0 멍e[^_]g_UVSËt jR|PS t j3XZe[^]UWVSƋu5h%qf,XfthWPG 8PV Rh%+hWP6d.f?@=RRPO. @{TWj4j% u +)CTSXWjZY@Kht_Dž+9}+uF Ph!%_XDžDsDܓ誋CDZYu h$'XNj󤋅CHK1҉P6$-sD聓CDCHh 1؉e[^_]W|$wUWVS,h1Džh#fDžBDž<"#K8Qff@H@@u DXDpHDž8 wk t]HuNNPj VS8t1@>u @ Ph1%[^Dž8WËDX4Yx8<8DPltfNu׋8 E&󥋅@@@><@D&׈S<ƆfC@|tv9@tFtv P Ph4%2 DP4B@>u-H@t@u<@x Hx@NjHu@NjD@4<4tf',t4 t41u G GG_S0, ,@fӀ'fGXZϋHuC5t8fpf ЉH5tGH61/H2f Ye[^_]UVS]t{wqSh&j蛘FFF F XF}@u Sh$h!讟 ]e[^]e[^]USPhj@@@@ @ @$-@u Sh$h!# SX]UWVSƋx Wh 2%贞 CCCC CC$,uZY@uWhD$h!語 VXe[^_]UWVSV]CTƃ CTCPtCXPC Phk!%M s  W|t=JT(t~CPt(ffEf"MtCTu{ tȋ뿈EV Rh/2%vXZEt?ue[^_]8VY[Ee[^_]]xe[^_]UWVSuVh j'~ ;u WhH2%Q Whn2%XZCCCC C X@uWh$h! e[^_]Éue[^_]UWVSu{Du ?~ Wh2%PśCCCC(C CVjj0sD}CDCH "@uWhl$h!Y e[^_]Éue[^_]NUWVSu@u{Du ?~ Wh2%PCCCC,C CVjjfq@uWhX$h!襛 VVhR-j jƓe[^_]UVSËsS^jSZYus S[jS|ZYue[^]UVSËƆ?~DtLt=C Ph2%֚F|YZtHT @$@ 11҉WmvL@{FDFLVHVPFDFHZt ht$SYXP3XZu)C Ph2%7Sjjْe[^]UPEP ERh3%)ZYEUS]Shj萒C PhF3%؋]US]?S Rh_3%P褘 ؋]tUS]?S Rh3%Pk ؋];US]?S Rh3%P2 ؋]UWVS] E1E9v31;Et k,9 t@v 6h3%q PVG,1;uts 3h3%q PSF,܍e[^_]xUE@|tPT(t1]USEu1X|tuu SƖ u؋]UVSE|0t-uvX|tuu S~ u1ۉ؍e[^]1UWVS} 7G@4j.DSFPjG4wSh3%軗}tE@<"jWu`< u h$iG8@Pj48FNj< tjgHDP< PhK5%芒<);ZBPjR48tKfBuA0΋jjZYuE$e[^_]RWh7Pa@uu-@t1uv@= uE $EtETt'TPu!EfHfE벀u t?u]e[^_]3GhLJXE1E1;UtkTf~tEB>IU;.u:Z 8Z 8LjWh$h!謋  P|tFBPtfftft BTuz uԍC Ph6%\^_؍e[^_]$@@@@ @s Vh6%轊ZY@uVh$h! 0SSh-j j؍e[^_]6e[^_]UWVSu} wt`P1Gu;t7ƃ@.H'jVw_ZV uk1t1hDjfÉZYC(C,C|C|1;fǃ<fǃ?VjhÈSjjV uF Ph6%ɈVh49VVkX1e[^_]UEtfǂ<:u]P]s]UM E]UWVS ÉUϋt <@UMtSjjP+ u }EU S.Z8m @@@@ @@$@u Sh$h!軇 SV^h7%SY[P3XZU(vLgFDFLVHVPFDFHYt.Et(E%e s=tu6%WSWXZvLgv4gvuQtBuC@PvXZtSh7PC|tuS|PW%e[^_]UWVS]}wS EEEE싰1E9v V{G,XEl1E9pv VLG,XE싰p1E9tv V)G,Xu h 7%EP轹 c{EpDv"GE܍FE؉fȉM;MvS  ffكM䄔1lpE;Ut 9t&E,fufvGuP|ZY1UM9pu"U싲19t79t B,t)Euuh%VEP Ruu0N Et+]SRWRh%PE PuuE0 }}u+uucXe[^_]UVSÉыS t%[+YD#$<$+Q$T$,$e[^]UWVSÉ׉1uMJ~D>Ph9%[ YX؃t w t u F1G1ɸ )E9M~ u"u!UM7PhXf&:[ XZUMA΃^Ѝe[^_]Uh0,h9%jyT ԗ2ȗ2t9W|$wUWVS21Bȗ2+у @4f@4 s f2.s f2P s1f2f p2f 224 1s22 ut12ؗ2 ܗ22 2f2+Of22ff2f2=2tjV Eȣ2Eȣ2ZY+XT2 4X2U1E2]5\2`2jhT254ƃ x9u h1%zXVS52h9%Y @4Hujh +j 22󥸤22 2u2󥺼225+=+u؉}mrq+E؉ 22 22E22=ɚ;~ 22-ʚ;222 p#we[^_]g_UWVS4ƉU)'h:%W Y>F h:%(FfVRVRPWSPh-:%W j.]SFPjuj.hm!SC ShO:%aW j.SFPjĹuj.hm!SB S蘳F^(ZU)ڃ<,wJ<w1tR<CSPSPh:%<+hg:%"<:tI<Y[) {)uj{,ud,u_jh4CP=g uS$t*$4t!9tA4C MPh<%CC(=L 9weA4cPh9<%0M #Dž\jhP 8^ZtuxtA4-hX<%,A48PWhi<% {  vEt7t1x)ux/uu@ (@uBL 9rh<%~)tT 9ƅu~.u݃ u؋THT<T@fPf;2m Tf@ffPЗ2 @З2+=2T@1ۋT@ ʋp)Љpyhl@Bphl)ډhl݅ڽp ߭ ܍2vٞv؋ З212222+v+2v 2P@4ЋPPt̗2 З2 ˆ@4@4 tjh +jݝ 8PWh<%J (h<%I A4݅ tSݝ8׉fDžF mPh<%I Y[݅8=2tRR$h<%uI ؃Pt h<%[I XT\\9H 28tQRSh<%I  C@\<jhڗ2T Prb PjT@f fЗ2CЗ2@4s̗2З2 @4@4 83PWho#ZH T@‰ff8 ft2ftGfTffRPhJ=%TfPh$=% TfPh7=%z hp=%G ^A4i Tp_@<'<vj.SVjST@49%h@%PG T@f fftf_fehg=%Txhu=%F XA4tET@th=%h=%F X%P1P 4f89HTH)T@u!F=w  txhjr#q f9f4f 8=189 ȋPPԋTp_A4t3t uh=%h9&E XT@t h}/%|E X N h=%šY1H1ۃHu ˃j.RVj蔧uj.hm!R0 Phw$D XZHuu h=%D Y Sh=%D XZ eTp\G뉅8T@;8T\\9Hv+$ ,DQu$RPJD \Y[ǻ\P9H sZPh-"ha$ D H;\vaTHSH\Zuhjr#C [.8utS9 YƄ \x1A49h#~C T@Z<t <uh=%h9&[C XDžP)T@ σPtj,:B XT@uWh=%yWh=%Wh>%B _XtSj,B h >%B T@ZY98sj,A 8T@Ph>%B I\9H7j,A h>%qB _XA48PWho#FB T <x2<w><tG<T@PPh>%P $7%<{T@<w*$7%h1>%AhI>%:hr>%3h#,h#%Ph>%.T@t <uhE#h>%ڝ^Ph>%gA Y[THDh ?%BA T@Z<t%w uh?%<uhY?%h0?%A _hD?%Ph~?%@ [^T@PPh?%@ THrh?%h?%h?%h?%h?%h)%h?%h?%vh@%lh%@%j.STPj趢uj.hm!S+ Sh.@%#@ j.STPj耢uj.hm!S+ Sh>@%hN@%? h]B"? T@fPfZYfw2$8%he@%hv@%h@%h@%h=%h@%}9Huh@%nh@%h@%\? S1ɋHL t Shű#h@%&uj.SVj~h@%> [h@%> h]B"> T@fHfZYfw-$$8%hp=%!he@%hv@%h@% h@%h=%> XA4t2T@<n48%h! Ph#Q> ^_@4 A4uh, [g v狝t݃{)!C2t!#t1 h@%3thA%= C YhA%= C HC SRRPC Ph#A%= HS?ǃxPhHA%n= XZ hVA%`= XCPhiA%P= Y^19~gVH4?YZuVhrA%+= XZCj.RPj臟uj.hm!R( PVhA%< F땋L 9؋ԗ2З2t9~B4 ,t,9З2 =З2P5 hA%j&UWVS]u)p4tPCYp4t4S|1 t4@$W;p4Zu1 Vl45 ,t;C@P;:uS tD~@tB\u JDN@uȀ:uÉ1e[^_]UWVS}EtNA<:u11] 318uFtuՀ@t&:u:tu:t9uPx@t1[^_]UE +]USE] u:À|u%u@C8t;EvHt:t @|u1[]UWVS0}!}u_=p4tUu Wi[^u@5t4P9YcWP 3 D3XZh|9XDžu*Etw3}jjju" Dž1ދ9@Ѐ  ]:3aV;)ډ)ށVSO=ZY.S@^t u>[. jh@P@E DžhQuƒ ?tuXi . 0S?. 07ȉtrVDžDž\Dž  1 0‰뛋1<# u SZYF +Džj=ho&S ƅÊt C<:uCE@PVuUǃ tN}#t uE^i>[ tGuC:KDžhDžtB<:u):x:t:G))+9++++Q`:ZYu)=Xt uBXÉ >)PSQg WRVY =Yt u_)؍P9s(PSp9Y^uS<* Z:Ë(Sz<X1:Dže[^_]UPjujM UEUh4tP1 h4X`4l4d41UWVSDž=`4uE `4=h4u[hܢ$`40s7 h4ZYu?pbP5h4賢^_tADud4p4t=l4ul4h4u@ @uP; h4`4P`4@[u 1Xhܢ$P<ڋ ,f\Yf:u#t =d4t|0\Gd4B|0\u d4K1ɍt:uf:\\tAߍP5h4sZYu*h4t B @R? h4XD댁NJ|Äu :t@PFjWjM E}Í@ wwCe[^_]UVS]u \u ][^]UWVSj=u ue ojd-1^EduO|' $Mu5])CdPV5ZYuV9[4uEdEx}:^uS:{{\S:JЀw1GOT9t`0vT{T JA~DJw:$G%   :E)x}tPV4XYEe[^_]UWVSVj=u u jd/[ÿdu% =:ӿdŠBt/:t*F Ou)؉Ǎ@dPS/4XYuSb7Y')؍POtUPS4XZɋUtЋEЍe[^_]UWVSj#u u ƒth :0uB h!ShW%P$+1=#4t e[^]UWVSSÃ=D4tZ1t `4<!jlơ`4!d4)Y9sRU|lD4Z9Uu584441@uu(4!1ɉ1t84أ441e[^_]USX?84944r84É84 -t1[]ËPt ЋuËPt9t‹@t;PtÉÀ= 4UVSh-"h-"h-"hW%$+h-"h!hB6!hW%$+$+ !=!4uy!D%="4u1&!=#4u!QRPhW%Ӌ5$+W%=4u #($=4u_#X>!=4uZ!qS&=4uW%SQRP֋$+U㡔4h-"h!Ph X%Ӌ$+ U(4h-"h!PhX%Ӌ$+Uh-"h!PhX%Ӌ$+ Ul4h-"h!Ph,X%Ӌ$+Up4th-"h!Ph;X%Ӌ$+ Ud4Lh-"h-"PhLX%Ӌ$+U(+'h-"h"PhYX%Ӄ h-"h-"h-"h^X%$+e[^]á04u d04UWVSQƉӡ`4! 4)Ɖ| })ߍ41Ƀ9t ^NAt!\ @0+3,+%H,+ 4I9@,+44444444ƅø h!QhX%P$+eF 8= 4t h1} Y0+9,+},+Ɗ ,+5p4 4 4z=45|454+ ,+I x4l4Ph4tPt4 (+d4P`4 \4‰X4< T4#=4tBT4T4)УP4=4t4DžDžDžj PhR  L4jcH4D4@4<41044Zv4(4 4~.9s(4d4=(49v-(4#t!9v(4=(4u (4$4(4£,4u.(4 11,48t41ۉ؍e[^_]À=4u1UVS$4,44e4194v-$4,4<uO$4@15(4$4Cˋu,4[^]etuxUWVSË11Ʌt9s8xx݉JBB t FuDQ?;x ,H19qt)~ u#F @ A ʋBu9Pu+2ptFprt ;uVP@ A p1tNqpt ;uFH{t ~ e09u/VtBPVt ;u2r3Fp‰@ A A0qtNqpt ;uFA@ [^_]UWVS EӋRUuEP@u~ }tBtu;0u P}u;^u}Kt;u}9uq}u7 }yKtyt3Iu(‹C{ }tBt ;u Pu}@t z )u99Pz u> B @ HtAHJt ;u QuPP ɋZty ut{ u B t{ uCtA B YtSZYt ;u K}QJPH J @ RtB P HtAHJt ;u Quy u>A @ QtBPQt ;u J}AHt{ ugQtz uA H‰et{ u=B A YtKYZt ; u Su QP Q @ tB JtAHJt ;u Q}BPEu A [^_]UWVSË11Ʌt)x9zr9r xӉJ BBBt FuQEQ@Kuq Ktq t5I u*‹C sutB t;XuP P}}\t zE}92H9PzuBJB@HtA H J t;AuQ Q}BP PJɋZtyut{u B t{uFtABYZtS Z Y t;SuK KuQJ PHJ@RtBPJHtA H J t;AuQ Q}B yuBA@QPtB P Q t;BuJ JuAH HYt{ulQtzuAH ‰St{uBBAZYtK Y Z t;KuS S}JQ HPQ@QtBPJHtA H J t;AuQ QuBP Eu A [^_]UWVS EӋRUuEP@u~ }tBtu;0u P}u;^u}Kt;u}9uq}u7 }yKtyt3Iu(‹C{ }tBt ;u Pu}@t z )u99Pz u> B @ HtAHJt ;u QuPP ɋZty ut{ u B t{ uCtA B YtSZYt ;u K}QJPH J @ RtB P HtAHJt ;u Quy u>A @ QtBPQt ;u J}AHt{ ugQtz uA H‰et{ u=B A YtKYZt ; u Su QP Q @ tB JtAHJt ;u Q}BPEu A [^_]UWVSË11Ʌt#x9zs8xxىJBB t FuDQ?;x ,H19qt)~ u#F @ A ʋBu9Pu+2ptFprt ;uVP@ A p1tNqpt ;uFH{t ~ e09u/VtBPVt ;u2r3Fp‰@ A A0qtNqpt ;uFA@ [^_]UWVSDÉ9H49@4jS @4Z9u739u0PS_;@4u;D4)D4@4jVS 19&…;B d4JM<4MVSv ZY@u:N j@}W0 h!WhW%P$+=#4t 95d4u'…tXd4B<4e[^_]1e[^_]UWVS EЉʋ`4!Ë 4)){ MA$L>D=!4tMjRP M95T4sxu@)lj| <ˍ>;X4NsP|$u<Ӊ<ËC9v&MEډEMˉSڋE9svs{uF=!4uE@ t d4EX d4؍e[^_]e[^_]UWVSÉ։ʋ} 19t yA@ 4[^_]¡L4tH9JsuË@UWVSá`4!9t; 4)z}؋|u 9t )D@}؋]E@[^_]UWVS$E؋`4ӋE!؊ "4M9EN0uЋ 4])ÉWtu9])ËsF€}t Z}؉E)+FIu*w H%w)H%wTH%1;SsS |C@C;Fu ;u Ht FN UH9t9vztF}Fڃ$[^_]}t Z}؉ыU؋EЃ$[^_]E؉EEɸL4f}t KZ{SC 0404$[^_]UWVSS9d4t d49vzc<41tHNj_0E<404=049H4v1ɉÅux}u9@4va \41uÅuP=D4@u1jMNj`4!‰)Y9tPMD4Z9uō3@4t=<41tO9s?9u@84G9r8 39s1KE<4 04=04}u릉؍e[^_]UWVSÉU4EЊMES1t}9ztJrs‰Љtt¡X4EB}}1;Es9x |u(9Mw M49s;Es E9BvBCUEUrEes t C Jd4ƅt]@X4T4)NF D DC 4T4ƋUL[^_]UWVSlj9459t4vE1 @U49p4r h4!M 0+ED'~E ,+1 @|4Dkt$tytȉMËMIF1ۅtËt Fo[V Åu pFE SFƒt )у}TCCKÅu17 4!MʉXܰ="4u =4t 1ߋMZY[^_]UWVSQ`4!u1WyEtƅUu0404,BZL4="4u =4t1Z[^_]US9P4ro[][]dUVS uuu=4uÅu6=4t h-"h-"hX%P$+p  1ۀ=4t Eu]j EPhR  ؍e[^]UWVS0] 8Cuw2E=4S h-"h-"h%Y%Et!9\49v 9w;5P4w=`4!E!ȉE9E؉EE;]wE)ЉE؋E9P4Eԋ 4EE܋U؋EE`4!s 4!u&)9ut }܉| FE܋]+]Sf)]]})EЃEE9Et]܋EЉX]̉XE])SUЋE]+]ZދUt}܋ 4VEaX="4u=41}M=d49wEE`4u!;]w )2E)U:DžEnEu04=04yK#MuU)&)ʉM؉U܋EBUUU)ڋMt E$EGwL4k="4t }F1=4u}u5E =4t*贙 h-"h-"h^Y%P$+4 Eu01ۀ=4t&EEEEEj EPhR 詷 ؍e[^_]UWVS }] u=4utttj ةt19uU;5P4w#Åu(2Åt%="4u9H4wJ9@4vB1߉81=4t 覘 h-"h-"hY%P$+& 1ۀ=4t Eu]j EPhR 螶 ؍e[^_]UWVS } u!=4t1ۃ}E }~EEءP49E t49U s=9UE m1 AEU1 @9Mp49E w-9Ur@9Ew;h4Ӌ 0+U !E!99Ev4U !9EtU Å="4tE9E rKE9E =4X`49Ev^E ؋u؍1ЅuM="4t9u s+M UU Z%=4E9E M )U1jE!9EE9H4w 9@4u !EEE/‰EԸL4\4PVj]!WuIÃUu L4YrBL4="4tE9E s+u U ڰZ$=4E9E M )1zE Åt9`4EuE؉ߋu9E s M ߋuMETAt)=4t0| h-"h-"hY%P$+ E Åt} 1]=4t"EE܋E E]j EPhR ] ؍e[^_]US ]=4t$]EEj EPhR  t ؋]]UE]ø@+ø@+UU ,fDP]UU ,fDP]UU ,fDP%]UU ,fDP]UU ,fDP]UU ,fDP]UU ,fDP]UU ,fDP%]UU ,fDP ]UU ,fDP@]UU ,fDP%]UU ,fDP%]USM] 1tt1;[]UEU ]UEU ]UE]UE]UE]UE]UU1;E t <t@]1UWVSuE 81ujPVZt C9]s؍e[^_]USUE 1 t @B9Es[]ڡ ,UEE](UVSME ًpVPy;P| uE ][^]4r0 [^]pUS4`I%uh ZYuC u1]UE H w dI%]1]UU1t <t@]UUM 1t't!@ ,1t ft@]UEt ,fDBf%f]UEtt ;U t1]UWVEu U ^_]UU ,DP]UU ,DP]UVS]t-";t$-"0 0PVSh Z%h0,3e[^]UU 1}w+t:t1]U"}3t-"]US1ɋE]  Xw Zw 8u tA18H[]UU+Z%9@&v ,]UU@Z%9 T&v+]øUS] uSh0,&S h!SY t( 0Phı#h0,-h0,j A%XZE0,]˽ UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-øUEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]11UEuE ]USPEtPt +wu PEPà uE 1]UWVSQpu5 ,11ҋ;Ms$9D~tk y8 T CՁ~xu@ u4@4Z[^_]UWVSQUB$X011`xwG0w(XtVWh.t0tww HupW9}1M‰&tY3`txu*uσ@t39}NjEZ[^_]UQEEUEEPEPpÃxuUSӉʋ@ щ[]ÃxuP4@4UWVSSMxuRÉ֋@9Cr4P]Wp-u90-[9H:9<]<-3K ,9)LC9@S9R{uC4C4S93=@{uC4C4O{uC4C4D8DzK@9U׉DR}^f.E11= ,H9}"uQMpZYMt UGjE@$E@PEp  u }G W$JO$f4P{uC4C4H98:x]9w{uC4C4<]t<-u{uC4C4=ȋUC9r{uC4C4S9sH9v8=ux]u {CK9ȉurM8-uP9vx]tx-t  -f9tÃ= ,f9~+{uC 4C49}-UG1= ,Hf9}3f9*jE@4E@PEp0 u MA0Q4f8fpBQ4E~{uC 4C41Er UGu ox]u3-U;Cr{uC P8]u 4C4{Ex8tC @tEH1= ,HfE19}#u4у9tfEfUBf}t)Ex,x4u|x$uvx<up@(ffEf}t^U܉zC P U܋pEp(Ep0Ep 1}U܍D2 9Eu'C HC M+H 0؍e[^_]@e[^_]UVS(P BteVҋ ,ftQÀt , t? ,ff9t00XUՉMfE]U׉PEEЉ0X([^]É([^]UWVS ]CEB2\u?;Cr{uC4C4PƁ)/[*.th(>.90D<1ɺi {C @t.U{EECE^ ]U{1ɺ(~1ɺpwS B@xz@ wML(hES9s#H9v 8\ux)t)\W wCDLpS9sH9v8\ux)u {uC4C4xЉ}<t1M8OdBM@p KC @DbE xt{uC 4C41{PsCxU|Ut K9cUP}*u]CH+MuHK+MPCH+MuX^K+M`[^9}\x{F{9sO:,uJr39v<r ,Drt+M M9~{uC 4C4PUSY9s$H9v8\ux}u1LH9w 9w 8\ux}u{uC 4C4 o붃$e[^_]UWVS]H {?SB< $V%^[v\y{|;Kr{uC4C4S B@pr@ w|(h;Cs8)t~) wCDLp;Cr{uCP18)uA4C4 -11ɺ/C H @$1ɺ C H @(뽺 믉MC pt&sEECE^ ]M s1ɺ(c;Kr{uC4C4Pu1ɺ1ɺ]CxUtUsCE9jHրvL<{t SUUw&@@EjP |EZYuS<[ ]lpDžtEEU1DžxEEeEtEEEEEEEװEC ChCC C$C(C,C0C4C8C<C@CD1ɺlEHCEt\p9lr'tu DžtDžl4Džp4l;ps.Pll]ٹl1ɺllEPSCjP|C u l!|CtXC0C\11Džh1\d\`%=0ywC=Fw=9=w= =(9\=ppw/=Xw=H=`=hD =w =xtY=w`= H{u \hFd8‹\d`%dd`%=`txt K  =u;sZۡ ,uࡤ , Y[^]Z[^]UWVSljM֋E9E SEHE%=wG=(w== =ti]=0=`=w=*=ts===>9uu14fFf9;9utF\9utF]C ЉN9wuG 9wuG9wu G 9w s9wv~ 9wts> jE@D9wvZ ,E‹]fDCÀ_t f^9wu G9w s'NMEDHu}_tz u E@_f ,9wuDQu _.FfDA9wu_t f _f DA_ 89w_ ,DJu _F9wu G9w ,NDJ_9wu Gt6< u ]CuЋ ,DQ<_9wN ,DJu/_t*ED%EEu1]C]u؉E9u`@E]%=Xuruuu uMOuL]E=Pu^GM90tL0uuu E)PMt" =HuEG]4M=8GPx u )MuMA}dnM)M9\uG PV: D@EME9uuEE=pucG؋PH UM+W PP uuu uMƃGUMTL =xuuE\uuSuM@ `SUT\%=uK=huYG؋HUM+W Puuu uMƃu'GUML\% e[^_]UWVSEUME ǾM]EM9ME@EEM %=pz=8iwL= 3w$==Lf=|=(4=05#=Xw =H=P<=@=`=h=wE=w=xA=D==fzk=tlw=t#=t1s=hfwWf98f=|MEsf7E]fyNf <f%fUB ȋU?E!! ؉ʁU! ˅UJ+UUM{! É!2tiEȋUt %܉!A5! ÁEȋU%=t! ! ED؃[^_]UWVS0ljUMȋEEEEӋG(E܋G0EԸMjPh{PM U}tEfEu9w t9wuGt u^f]uԉù}t]܉]Eu9wt6fuE fEE;Eu }tuuf} uRփuf}uGur$u~ E1f} uBu$YE1f}DG:f~u|}J(M1f}u1GuEf}u GuE}t!ˉMVPuPM UqMuf~t)f}U ,DQu9f}_t2f}tU ,DQuf}_uzf}t> ,MDJuf}_u&f}tf}tMDJu f}_tyfwVPSPM U ,f}t:f}tLMDJf}_ ]DZf}_ 8uF,MDJuf}_f}u*MDJuf}_tVPhwPM U%ŠM t }uF]]M9Mt2;Et-VuURPM UUUfufuP}tPEGEt?E@E6f}s1f}f} 1$Ee[^_]UWVSÉM}U;} @EE܋E4Xt}xtHu1%E#EMt %E݋E@EXw30tqwtg(t_ MHpMx h{E+C WEMjuWU+ju uM‰9EtNGjuWU RuWUljuWUju uM‰9EtNGEEjuWU tMM9tEuWMUY_juWUUEju uM‰>9EtMIˍGE@u܋0%tjVuMU 9Et+VFE@4֋%=uNVuMUbXZEE {E+C GW u}DEe[^_]UWVSljM֋E9E NEHE%=wC=(w== =teY=0t=`=w=)=tr====9uu13Ff9;9utF\9utF]C Љ9wuG 9wuG9wu G 9w s9wv~ 9wtt> kE@D9wvZ ,E‹]fDCÀ_t f^9wu G9w s'NMEDHu}_tz u E@_f ,9wuDQu _.FfDA9wu_t f _f DA_ 89w` ,DJu _G9wu G9w -NDJ_9wu Gt6< u ]CuЋ ,DQ<_9wN ,DJu/_t*ED%EEu1]C]u؉E9ua@E]%=Xuruuu uMTuL]E=Pu^GM90tL0uuu E)PMt" =HuEG]4M=8GPx u )MuMA}doM)M9]uG PV E@EME9uuEE=pucG؋PH UM+W PP uuu uMƃGUMTL =xuuE\uuSuM@ aSUT\%=uK=huYG؋HUM+W Puuu uMƃu'GUML\% e[^_]UWVSEUM܋}uE fEӉE؋M9ME@EME%=p=8wN= Bw&==fEf=|*=(F=0H_=XKw =H=PL=@=`=h=wF=w=x^=f==f}zw=txw=t(=t8=f}wdMf9M?fEf=|~E}fEfffEefEff}yJSfEff6?')f}'f}EMA UE%E)E ȉ‹EUJ+UU LE%tEtzMMсt ڍDM C LE%EMȋMI tE؊DEC [^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉fEE9C t9CuCt E@fEEE9CtffEE fEE}t!puRU UuEEf} u@Euf}uCu p$~11f} u@u11f}Cf~u|}p(Ef}uECuFEf}u CuMFt#ljEuRuRM UƒNuf~t)f}E ,DAu9f}_t2f}tE ,DAuf}_uzf}t= ,MDHuf}_u&f}tf}tMDHu f}_tyfwuRPRM U[ƒ ,f}tBf}tTMDHf}_ uDpf}_Ɖ 8uJ,MDHuf}_f}u.MDHu#f}_tuRhwRM Uƒu ր>t}EEHQMuRU U9UtYtU}̋U֋M}HtuuuREPűM UD‹uufEfE}tVECE>tDE@E;f} @f}Ef} 01Ee[^_]UWVSÉM}U;} @EE܋E4Xt}xtHu1%E#EMt %E݋E@EXw30tqwtg(t_ MHpMx h{E+C WEMjuWUju uM‰9EtNGjuWU RuWUljuWU]ju uM‰G9EtNGEEjuWU! tMM9tEuWMUY_juWUEju uM‰9EtMIˍGE@u܋0%tjVuMU 9Et+VFE@4֋%=uNVuMUbXZEE {E+C GW u}DEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉fEE9C t9CuCt E@fEEE9CtfEE fEE}t!puRU0 UuEEf} u@Euf}uCu p$~11f} u@u11f}Cf~u|}p(Ef}uECuFEf}u CuMFt#ljEuRuRM U0ƒNuf~t)f}E ,DAu9f}_t2f}tE ,DAuf}_uzf}t= ,MDHuf}_u&f}tf}tMDHu f}_tyfwuRPRM Ulƒ ,f}tBf}tTMDHf}_ uDpf}_Ɖ 8uJ,MDHuf}_f}u.MDHu#f}_tuRhwRM Uƒu ր>t}EEHQMuRU U9UtYtU}̋U֋M}HtuuuREPűM UU‹uufEfE}tVECE>tDE@E;f} @f}Ef} 01Ee[^_]UWVSÉM}U;} @EE܋E4Xt}xtHu1%E#EMt %E݋E@EXw30tqwtg(t_ MHpMx h{E+C WEMjuWUju uM‰9EtNGjuWU RuWUljuWU^ju uM‰H9EtNGEEjuWU" tMM9tEuWMUY_juWUEju uM‰9EtMIˍGE@u܋0%tjVuMU 9Et+VFE@4֋%=uNVuMUbXZEE {E+C GW u}DEe[^_]UWVSljM֋E9E NEHE%=wC=(w== =teY=0t=`=w=)=tr====9uu13Ff9;9utF\9utF]C Љ9wuG 9wuG9wu G 9w s9wv~ 9wtt> kE@D9wvZ ,E‹]fDCÀ_t f^9wu G9w s'NMEDHu}_tz u E@_f ,9wuDQu _.FfDA9wu_t f _f DA_ 89w` ,DJu _G9wu G9w -NDJ_9wu Gt6< u ]CuЋ ,DQ<_9wN ,DJu/_t*ED%EEu1]C]u؉E9ua@E]%=Xuruuu uMTuL]E=Pu^GM90tL0uuu E)PMt" =HuEG]4M=8GPx u )MuMA}doM)M9]uG PV菻 E@EME9uuEE=pucG؋PH UM+W PP uuu uMƃGUMTL =xuuE\uuSuM@ aSUT\%=uK=huYG؋HUM+W Puuu uMƃu'GUML\% e[^_]UWVSdEUE8e p >E F E ЃEF@EFEF= ,-tEt}E EE GEu E ZE EE E}9}l ~,N4tMF8EtCFU DEED$ED$$F0ƃ}ĉ|$UT$E$D ƃtdE$ D ƃt'D$ED$$/1ɃىHm UD$|$E$QD 'm Um 8D$ED$$/l 8t[^_]l UWVSP 'Dž/devDž/XtyfDžXXƅD$@$A0t-ƍD$D$FtH4$_ 4$0D$D$ D$D$:>$I@Dž0pL0ƅpD$D$$U/ƃƅtXL$D$$3uT$$3te4$/lCk P [^_]j 8u+wً$0uD$D$$m.b‹5/M1M utD$E$mmMt#ED$D$$sEt&ED$D$gt$o] 1P [^_]1P [^_]\WDžUVS $ED$ED$ E D$ED$E$ƃt# ƃttEUE$.[^]ËE$-E$3[^]UVS 臨 Î# ;`z D$D$$+Z tB`v $ ǃ`z $o-ǃƃ`v 1 [^]h 0ǃ`z $4-ǃƃ`v th 0ǃ`z $,ǃƃ`v Gh uUWVS<d k"uD$/4$4 D$@4$+ƃD$T$$7+g 4$@,Ƅ=D$D$D$D$ D$D$ D$$H ƋtVu~8 us<[^_]À`v uR Ɖt$?D$ D$D$4$o=f ?똍`v f vUVSإ u@v 3D$/4$3 "t$`v $J!  `z D$D$$:W BD$ D$D$$ZY !Ѓ`z D$!D$$j1[^]FRD$D$%@4$,)D$t$`v $([  Ɖt$?D$ D$D$4$n=e ?)$,ltƃ@v Yd 8#t'd 0gd 04$mƃd UE$؉]fffffffUWVS 苣 ÒE@ E։υEE y ]]U ] ED$D$ $D$ЉMʹ;MM }#UM T$L$ M $D$jЉ9rgMϋE eƉϋMڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEUWVSLT [D$T$|$ |$D$$5ZD$(H*)R)L$L$|$}<$YteEU +D$T$D$T$ \$(K)R)ƉD$T$)iD$T$ L[^_]øUWVSFDF 1[^_]ÿ'E {UWVS֚ EEEEMM11rEEEUU1EE%E}tZ"us!tU=qw 9}u`$EEU nEyE"tU4q{9nE;ErEEPUXMčAEċEUAQ `$EtEEYE M)ȋUč‹REUF3EuuU1"]]Etqwu<~9ErEE$$kE$kEĤ[^_]EEOME)ЉEM)ىMċ&zPU@AEċEUAQ }E&MċAQD$ D$<Y $\$щ‹E*FEĉEME)ЉE])ˉ]ċ&`!tсqw 9 $9EwEEPUXMčAEċEUAQ `$EH EĉEP@ I] ApAhQl,MċAQD$ D$E@$@@(ME)ЉEM)ىMċ&CMĉMYЋAԺx9ڻpQȋY;l9ѺPH<h9иUxB4EEE݉ EEEEU E?EEEutEU9EwEn{EPUXMčAEċEUAQ `$EUĉURMAt M 1uUT$$JtFu̿[^_]UWVSs t:>t M1uU T$$ItFu̿[^_]UWVSr çt:>t M1uU T$$NItFu̿[^_]UWVS 9r @E $bEE%EEET UUT$$EtRt:>t M1uUT$$Ht.FuEEu-E$DE [^_]Ãt׉ U1ku}9t<$1 D$|$4$ EUE먃}tEEEUWVSq u Ex}u 2t)D$4$Gu+UE@ [^_]Ëdz t 1[^_]Ét$L0D$$UWVS}p ÄE D$E$R1 D$ED$4$NjE8tB0 8"tntdz uOt$ E D$00D$$щ[^_]0 8"u썇v?t뱋dz t[^_]Íw녋E D$0D$$UVSo ÇuF$AF $A4$A[^]UWVSDo KuE 81҃uU$q9Ef4$8NjExD$E$=MA ^EM H0T EED$<$NDž?nED$=<$ HME u D$<$.Eu+E UJ UV tUN}9~t!ȉ1OUN}9~u oSEKEE edz t4}G$6@<$.@EE[^_]El|$L0D$$ <$?E$?EfffffUWVS88m ?u- D$h0D$4$7uD$:4$K DžD$jD$4$lF$(- $7D$$OD$D$|$ D$D$04$ $6)D$D$|$ D$D$4$ ||$$xƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $i  $D$$ |$$ƅOD$E D$ ED$D$$K$D$E$KPD$$\.}$ =$<3+ 8[^_]À>/uEt$D$<$!t'D$<$a* 8E D$t$E$ }8[^_]ËE D$ D$E$l E D$D$D$ ED$D$0$a EE D$t$E$ }g* E D$n0D$E$ Dž1D$ 0D$E D$E$2Dž1]) E D$n0D$E$b 1-$m) t$ D$E D$E$?2<$10D$E$FID$/4$q-}( E D$0D$E$ DžDžh( E D$I}A( E D$InUS(g ïEEED$D$ED$ ED$D$E$3 x E([]øUS(ED$D$ED$ ED$D$E$ x E([]øUS(f D$ D$$?D$D$D$D$D$ D$D$D$D$ $U x D$([]øUSWf ^ED$D$ ED$ED$0$x E[]øUSe E$t*Ue UЬt Ь]ÍЬ]UWVSe ñ}|$E D$E$' 9v [^_]8& ?|$ t$0D$$Ь[^_]UWVS9e @}|$E D$E$[ 9v [^_]% ?|$ t$1D$$Ь[^_]US d E$t []ÉE<2T$$ЬEUS d ËE D$E$#t []ÉE<2T$$ЬEUVS6d =u4$.t[^]ÅtEt$O2T$$ЬEUWVSc u} |$4$2t[^_]ÅttE|$ t$P1T$$ЬEUVSc Ìu t$E$2t[^]ÅtEt$i2T$$ЬEUWVS-c 4}|$E D$E$ u[^_]É# 0|$ E D$x1D$$Ь[^_]UVSb uE D$4$0t[^]ÉEt$2T$$ЬE[^]USkb rED$E D$E$ uE2T$$ЬE[]USb ED$E D$E$͈uE2T$$ЬE[]UWVS,a u} D$(D$EUD$T$EUD$ T$|$D$4$ щ‹D$(u Љʃ,[^_]ÉT$ L$$" L$(EUD$T$EUD$T$|$ t$1D$$ЬT$ L$$Љʃ,[^_]UWVS,` u} D$(D$EUD$T$EUD$ T$|$D$4$vщ‹D$(u Љʃ,[^_]ÉT$ L$$P! L$(EUD$T$EUD$T$|$ t$1D$$ЬT$ L$$Љʃ,[^_]U-` 8U!w 2ፀ]Í}]Í]Íą]Í5]ÍY]Íܷ]Í]Í$]Í0]ÍƉ]ÍCg]Í0]Í/]Í]Í]Í]Í$]Í]Í[f]Í0]Í]Í0]Í]ÍP]Í]Í]Íl]Í1g]Í~q]Í]Í]Í]Íq]Í0]ffffUWVS\^ EЋE0t8x t:t:]z EE\[^_]Íx@ uƋEЍmE EЍ93Eȃ}U EUD$ T$EȉD$E D$E$](Ex;E vEEE EEEEEO‰E̅uuEEE<EEEEEG:~=u*V]6ȍx8LO‰E̅ GEGE܀F~bEUM t1҉ME;E_U +E)Ƌ}EF;E s E>E;u s;EPM]L$ \$EȉD$E )D$$U]r&UU]EÉ]PUԍt;u s EEUE@E\[^_]t̋uEE<EE1ҋ]];E++E)Ƌ}EF;E s>;u s7SM]L$ \$EȉD$E )D$$U]?%UӋMˉ]At;u s <]1ۋU WUUMM:;u sUM؈ UU  }9E+E)Ƌ}ܺF;E s>;u sBUMKEUD$ T$EȉD$E )D$M $]A$]UMEÉ]tUUE<1;u s2}OM׍WO 5EE,׋E;u sD] ]1뺃}<Eԉ}܋]O ;}]11끋E] DE~EЍ43E%UzJ ;f-GEG t1ЉEӉ]EUM t1҉E!ȉEE!ЉEM E;EU+E)Ƌ}EF;E s E>E;u s;EPM]L$ \$EȉD$E )D$$U]_"UU]EÉ]PUԍt;u s E;u sBUEHEUD$ T$EȉD$E )D$ $M]S!MMUEƋ]ËMH;u ZEGEd}/;u s ̉ȃ}E;u sHMUEXEUD$ T$EȉD$E )D$]$]]]MUEƋ]ÅH;u REGm}5;u s Ӊω]EEEEE<E]|ED$ ED$L$ME )D$}<$]sE;u Mjlj}EtEM]EEE<EU]MԉEA]CS]M9M}+M)΋}F;E s E>E;u sHMUEXEUD$ T$EȉD$E )D$]$]]]MUEƋ]ÅuLH;u EG}9;u s ӉωM]EEEE<E ]}]E9EM++E)ƋEEEF;E s E>E;u s5ExEUD$ T$EȉD$E )D$<$]}]ދE؉EU]ԃ;u =EEE;u E=EEE]1 ]1=u8ExE]MԉNjEE9EM+E)Ƌ}EF;E s E>E;u s;EPM]L$ \$EȉD$E )D$$U]UUEƋ]É]UE;u -=CEEEԃE;u s E=EED$ ED$EȉD$E )D$E$]ƋMM;u sE]E;E]98M+E)Ƌ}EF;E s E>E;u s;EPM]L$ \$EȉD$E )D$$U]rUU]ދE؉EU]ԃ;u m#EEE,EEEE,]MԉEE,MEE}%EE}E}EE,E;u vE#EEEE,$EEEhE}EEEE<E<}EbEEEE,EEEEEE,EpEUD$EUD$ T$ED$E D$E$]fffffffUVSN ãuED$ ED$E D$4$D$ED$4$U[^]UWVS4LN SUEzljaED$/<$^ t8|$ِD$ED$ ED$ED$4$/t~4[^_]ËE ud(vE|$ED$ ED$D$ED$ ED$ED$4$u4 8tY4[^_]ÍE 8uދED$|$[zD$ED$ ED$ED$4$pAED$ |$ED$ED$>3D$ED$ ED$ED$4$+ 8Pt&q \ USL ÈEU MpY]]] ]][]USEU M]]]] ]][]UWVStL &D$L$<$ t$WD$<${1 Dt$D$$3ũED$ G3D$D$$ ̹uED$E D$4$S1t%}̉|$E$艝ED$|$4$/4[^_]UWVS4f> m40E D$ED$4$0t%}̉|$E$%ED$|$4$4[^_]UVS > UB8} t B84@:t1 [^]%B81 [^]D$D$4@<$AH81 [^]UE@:]UVS h= o4t^+€,T$XT$$24tE$04$ $S4 [^]Íe$ u뎍l3$?$RUWVS0< ·uxLjE!xEڋNMEE܉MM E ,Eԉω4$_ƒ   UUFD$ D$FD$4$ZU9Ut{E9uN=?E܅ҋEԋDPEmED$L$4$[.4$D^ƒ6X;} M8Mtt}ED$ FD$FD$4$wdD$ FD$FD$4$VdEP9FU뗋F;EED$FD$4$-EEXUD$ ED$FD$4$cEH;EUE9FM;} D$ ED$FD$4$cEnT$UFD$4$,U:10[^_]D$ D$FD$4$TcD$ ED$L$4$4cED$FD$4$,\FD$FD$4$cD$ FD$FD$4$bFD$FD$4$.,}tE9} uD$ FD$FD$4$bFD$FD$4$+D$ ED$L$4$ZbNAD$ ED$L$4$7bN)UL$MFD$4$~+UM5UD$ L$MFD$4$aUMU D$E D$E$]U g8 rD$UT$4$~]UWVS 58 <u}ED$E D$4$*tE} u [^_], [^_]UMU E~tEU M]]UWVS 7 óu48E D$ED$<$2*tEu } [^_] [^_]U [7 VE 4~)tD$ED$$Y]ËEUWVS6 }EEuED$E D$<$)t'~#tuEE }[^_]E[^_]UWVS6 ÔEEu48E D$ED$<$ )t'~#tuEE }[^_]qE[^_]UWVS(6  E}WDU498GH%EW,OM܋M11ۋM;Orى}}}:R][<}49%yu/}O,} 9+Y<[ω<]fV% EFt$E@|$]fF9uvJVF]9ulÁ;][^ Pf~E9uwtVE@,UʉM+PÍ@‰ЉЍD$ |$E܉D$E$]MEE܋U9B~ R,1}<$]1([^_]ËGcE:U4 %4$]UVS3 4p 4$ u N8@[^]øUVS3 îu4$u N8@[^]øUS$3 ÐE UD$ D$D$D$T$T$ D$D$E$$[]US$03 7E UD$ D$D$D$T$T$ D$D$E$$[]UWVS2 ٭}M uUtA$M U 4tUF$U 4tBU$YU 4,048<@DHLPEtE@$W 4  $(EtE@$ 8 4TX\`dhlptxE tE @$ 4|UUUUUUUUEE$tE$@$ 4U UUUUU U$U(Uċ,EȋE(tE(@$ 4ŰUЋUԋU؋U܋UU䋐U苐U싀EG@t ʋwHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉ`T|t ʉt ʉ\|Mt ʉt ʉXUUt% Щt TE̋G|GlDž|fh}$ E@,@1fB;<‹fbBz t$#uE@,@B tfB\$V PF ;uϋ;42f|2yW}$G,HfD11f|1y.ODfHD$G|$duİ[^_]Ë$OE@,@|+d|p9ihf+fG9@)fL09@4 ȋf`Hp tv$uEP,@D 9YE@,HfAAxωt$LRO HG ;uϋxt9pe9l<}\h$Py DžEd$+xy DžxEP$y DžEԉL$y Dž4$y Dž|+t+p}9Qp9pE@,@Dž4fF9ffF~ t$_uE@,@F rfF0X!4N HF ;0$uDž!pdE@,PЉdU/UB,@NjJHOfG93<JDfHD$B|U${uDž5AAA AAAAA A$FFF FFFFF F$O,B0B4B 8BE] PHց3`46tցX4;1tFPDSC@|t tL@uS1[^]C1[^]ÁU UT$4$H]| ǀhz UWVS8b iu4E8+…24E̋24E؋24EЋ24EG 4EG$4E܋GT4EȋGX4EԋG\4EG`4Gh4EGi4EGjE0Ћ2E̋2E؋2EЋ2EV EV$E܋VTEȋVXEԋV\EV`FhNiEĈVjE4$d!F41ҋ2‰T$$V 4V44$4$ 8[^_]4E4E4E4E4E4E4E4E4E44E4EUWVS5 <}D$4$KƅEdž3E Fdž2dž2dž2dž2dž2hz 3ǃhz džd2džh2F`dž2dž3F FFFdž3dž3dž3 $3dž34$)5t$<$ko|2PJpdž2D$D$D$D$ D$D$4$EFD$D$D$D$ D$D$4$F4$7`4$njD$D$D$D$ D$D$4$蝞F tjD$$4$=#4$x4$4$,FSG4t 3t4$)4$n@[^_]Ë|2t$]2$f29tDžu拆3$4$1[^_]ËRhD맍e$ DžUWVS }|2t$6]2$Vf29tƅu拇2$ <$_3$"3$498t<$[^_]<$[^_]ffUWVSK Ru +9uǃ, >ǃ0 <ǃ4 ^ǃ8 vǃ@ #ǃ :ǃ 'ǃ #ǃ #ǃ$ #ǃD -ǃ< -ǃL _ǃ` |ǃx oǃ@ -ǃH -ǃd <ǃh >ǃl *ǃp !ǃt f|2E@EuTAtcҐx uEt(VT$TT$ D$D$E$1 Tl=u[^_]US ÿM1Tl =u[]UWVS, Îz EƍME$+FF(9u݋uD$$8CuxuD$$$3}T$$ǃ@ !ǃ, +ǃh !ǃ0 ,ǃ !ǃ4 -ǃ !ǃ8 .ǃ %ǃ@ 0ǃ %ǃ `ǃ %ǃ aǃx ǃ fǃ ǃ gǃȊ %ǃ hǃ &ǃ$ iǃ %ǃ( jǃ@ %ǃ, kǃh %ǃ0 lǃ %ǃ4 mǃ <%ǃ8 nǃ0 %ǃD qǃ #ǃ< oǃ #ǃL sǃ %ǃP tǃЌ $%ǃT uǃ 4%ǃX vǃ ,%ǃ\ wǃH %ǃ` xǃ8 ǃx ~ǃ #ǃ@ pǃX #ǃH rǃp d"ǃd yǃ e"ǃh zǃ ǃl {ǃ `"ǃp |ǃ ǃt }E|2E@Ez Et@u(x<uD>E tAuЃ,[^_]Ëu܋E䋀t+MQT$TT$ D$D$E$El }Wl}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$>@ $<h $^} $vk $#Y $:G $'5x $## $#Ȋ $# $-0 $- $_ $|H $o8 $p $rX $yop $z] ${K $|9 $}' ^US yz ]l JHJHJ H JHJHJHJHJ H J$H$((9u[]fUWVS8K RyE܉UԉM4E02EE荆4E 4MfEtE$0E$xǃP=EE\ 4U  4%y  444fǃ EDxfxzMf8@E f>f,4M<%y 4; 4ufǃ EDxfyEE4D$ D$D$$44 49)NjM M؍4T$ |$ED$E܉$}ƒ*4%449 4Nfǃ 4f18[^_]ÿ)hfEEԅU$.tɋE$kNjE@ @U/tE@ 4 M 44%y  4f r-/; 449}Pdž4υu1N$uF$`~ MUtpPuE[^_]Ë}UWVS k¹tI3t1$U vU:t :t#:u1[^_]ÿ[^_]Z[uJmt݄tރB0tqωvE;tzu봄tVUWVS0 ÍjUu :u|2tU$EUF@fu|2ML$ MD$T$<$,|2M{EPJ(N$JN 3a3$ّ 5D$D$$pUFT3$訑 D$D$$?UFXF N$4 4VT4VX4|2P3B0zp12džl2E䋺M싊TMtUUdžl2ELɉMEEM܉UtrD$Eԉ$UHE܋U؉$ڿMԉ $ϿE܅tH1IH 1$耿p2džt2EtEdžt2džx2tdžx2E؃0[^_]Ë@@Dǀ@l@hǀǀǀ<HHpF$B(Ft#U܉|$E$g Uu džl2EU܉D$E$g Uu l2MU܋ED$E$g Ul2EtD$<$[g u džx2EtD$<$:g u x2ED$<$g x2t|$E$f u džt2EtD$E$f u t2E$D$E$f  t2|2@@FXFT,F@ftfL$ D$D$<$y|2EK1"4L$듋E>džp2džt28FXadžp2džt25U d4D$E$]US ÜdE4H$ 4H 4HT 4HX 4Hh 42 l2 p2 t2 x2 |2$>[]U dM4tJX41]ø]fffUWVSLjMEE_ɉME9tBfx ft0fu9QuԀ}tEAE 9u[^_]ËAM L$M $MUkUUWVS! (cƉMDPfx 4[^_]Ëf=t|fDVƒ4EftL$&E@f9uǁNF[^_]ËEFF[^_]fLVuMED$<$蓶ljUU$ 英UtZf@f@@ f@@f@@MLMH MM;Eu3$%$8,D$ D$D$3$t $3$Ҽ$UWVS O VaƉ׉M$豦 tDLMt5$LVp9uϋ}E$TF [^_]UWVS `Eu^9t)fxf8u@$9u׋~#1E$]ַE9߉ $]軷4$賷 [^_]UWVS X9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS Ò_}fǃ $ͮ@f9uǁ2ǃ ǃ ǃ D4F|2RtK$K =w3D$T$$F 2:;u[^_]Í3$ܹ$US g b^E E4t+2UT$$UTE []ø []U ^UM ~*4t2t z1]É1]ø]UWVS ú]4te3339}}<31 [^_]à D$$褱‹t!3333뱸빋33D$BD$$F 33]\331o%U \E4t%2UT$$1ɋUE]ø]U \M4tJT41]ø]UWVSU \\}<$ƃuOG @tI 8u?43t-4D$4$oǀ3[^_]UWVS [EU42E4EEtE$oE$ ǃ=E5 <%y  fǃ L~fq 1fq fKfLfEMyUU$E$HNjE@ @aimE@ t} <%y  L~f  X yt싓 9Jf y [^_]Ã}fG 9 < 9fǃ  [^_]Ë <%y  ; ?fǃ 1EuEE$NjE@ @UfB  [^_]ËEQ). 9'fǃ [^_]1Ef` [^_]Ë ,D$ D$ D$4$k $UWVST [Xu4MV8у$Jq33+M MEt4:E F8V<tf11‹F؃ [^_]dž3441 [^_]ø|$$r UVSG NL4$FtHh4 Pi41[^]UVS L43um44ǀ2233t?@fuT$D$$؃ [^]1 [^]UVS X _K43um44ǀ23tK\33@fuT$D$${؃ [^] 1 [^]UVS ûJ43ui43t]2uB23@fuT$D$$؃ [^]Í21 [^]UVS J]C=w">t4X4U31]UVS >4@@fuUT$D$ht@$w t Efu5 PwtU$Ѓ[^]Ëǀ3[^]Uft44UWVS,% ,>  }4@@fu|$D$ht@$v 7E4U؋4Mԋ f49Pu9HtL$MԉT$U؉$LMԋU49Pu9HtL$T$$L03@fuT$$b 3@fuT$D$$蛋($ $W,[^_]}f&9tU؉ǂ39}ԉǁ344$EEEEEE D$}܉|$$Y ǃ %}D$$CW  ǃ US ; t[]Í}D$$V  ǃ []US ç; u[]Ë D$$V ǃ []US$X _; t$[]Í$EEEEEE D$ED$$W ǃ $[]US$ݿ : $[]ÍED$D$$W 9Etǃ $[]D$ D$$ZW ǃ UWVS4Y `:43=3@fT$$_  4H$CiD$D$ HQT$PT$@$肠 4@|UE؉D$D$ $Uԋ@t A:|Uԋ}؉|$D$${|$D$Uԋ@X$Y@$S D$ D$D$@$裎ǀ303@fuT$D$$H؃4[^_] 4@|ME܉D$D$$DU 9Eǃ 4M듸  D$$FS ǃ  14[^_]MtUԋM؉L$D$8$Uԋ@WD$ D$$|T ǃ UWVS,n u7EEEE uԉt$}|$$?EEEED$|$$P?D$$@43tD$t$$ ?,[^_]襻 643tZUS耻 Ç643u33@fuT$$[ ؃[]øUS " )643@fuT$D$$耄؃ []USͺ 5403@fuT$$C[ ؃[] US { Â54@} tI|t7T$D$$4ǀ3@$O 1 []ËxtT$D$$64ǀ3@$wO 1 []UVS Ź 44@43tB|t1T$D$$载ǀ3@$O [^]ËxtT$D$${ǀ3@$N [^]UWVS  4E42tt_ [^_]4@tǂ2T$D$$޼@$/N [^_]4@@ttǂ24@jǂ2U6 A342$]UUE 9B| R,]1]UWVS}U MxZG9}SxO)9E9}5O,EO(G\p;}@ ;~9Uu1[^_]É뷸UWVS}U MxZG9}SxO)9E9}5O,EO(G\p;}@ ;~9Uu1[^_]É뷸USEH~X,19t t[]1UWVS}G~tuE4EEEEE+E$轆U9UMM)π>t5UE܉D$ |$t$E؉$蟄Ey8[^_]1EEԋ@t[u׋EԃEMEEEЀ4uŨ8[^_]UEԋ@u})29ǃEԃEtUt$D$ lj$$e E)uUMwMȋ}uԋ6sOtft}})UEQut$D$ }<$d E+u)auuEfUWVS,) 0*EU܅E܅ϋM93}D¬ ,@t DB@u<$4o ?M4MMM}؉E$Ut7)׀>t.ED$ |$t$E$aEyĸ,[^_]Ë})t$<$…t܋E܍HD@u4]Xʉ1,[^_]ø1US (Ew"جD$$1[]øUS襭 ì(4t3tUT$$[]øUS a h(4t&3tU T$UT$$k []øUS (4t3tUT$$[]øUS Ҭ '4t&3tU T$UT$$ []øUS臬 Î'4t3tUT$$[]øUSC J'U 4t*3t ML$ T$UT$$[]øUVS &40toƆ43u'3tU$z3$#y[^]Ë|2Ppt%T$$5D$|2$[^]øUS [ b&U4t$3tD$T$$ []øU &U4t~;3TR4]1]USѪ %4t3t$T[]øUS蔪 Û%4t"3t$St W[]øUWVS K R%40Ɔ43uj33~BE14uJuE;3|Ճ}tO3$7w [^_]Ë|2Ptt&T$$HD$|2$' [^_]øUm x$U4MMM ]USF M$4t3t$A[]øUWVS  $40E E4ED$ D$MML$$}tiP$U sDžtUU UED$ UT$ML$<$C}t&E$U6Ɖ<$z [^_]þUS? F#Et3t$zQ[]øUWVS #}3t$q3~#1v4$Oz;3|ߋ4$6zج3ǃجLJ3D$0$u4th|2PtD@@X~:Ƈ3$-|2@PX3@$31[^_]Ƈ31[^_]øUWVS !}3t$N3~#1v4$,y93ߋ4$y[^_]UWVS]3e3WE Q3433U U׉UU+UUVU11]]9t0p9uu9u]1]39114uu;3|ى[^_]@,3WP\4u u )׉<)} t7։L|A1[^_]ǃ3UVSϤ utNFX3|2@@T%D$4$ E D$FX$1[^]øUWVS _ fEExD$D$<$8zƅt.)‹M tMMtyu' [^_]ËE tsEt_utXEM`4 u/1MfT$|$E $yE 01 [^_]f%ʸ [^_]øtUWVSj qu EE}4$xEw`}E(1M19rEtfEtЪE1[^_]Ë$xHu } 9uuE$sxt؉EPE 15EE1 ;ErEtfEtȪE%M`4 tMft ȋMEMH]1  9rEPE 1u\EE1 ;ErEtfEtȪE MEB[^_]ÉЪE'Bfm뚉fm7fmȪEȪEZEEEPUVS EU tt%B B[^]44XZXZX Z XZXZXZXZX Z @$B$ [^]UWVSk rutv4$7rVȉ‹9u F0$rF,$r49pt]9p tJ9pt2t$S$wr4$or1[^_]@u@ 9pu@9p uUF4$(r>9UtU?$9Uu~X24H90t…#ȋH90utJ$q2UWVS- 4lj֋@X|2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$|UtB8tt<$bu 1[^_]ËGX|2W@W@@@8t ։w@и[^_]UWVSC Jlj֋@X|2@Ttg@ tg@tg@@tg@tg@tg@tg@tg@ tg@@tg@tg@u<u@uH%t4@@8t g@1[^_]Ãg@t<$-t<$6뮸[^_]US  MU 4t*t X@t@@f%f1[]1[]ø[]U诛 U4M u][]U胛 U4M u]]UVSU `] 40Eu/ځ] ډ1[^]ø[^]US U4t-HX|2H@H@[[8t ʉP@1[]U诚 4U]bU葚 4U].UVSr y40tFFX|2@Ttf@4$<4$M4@@8tf@U1[^]USEM Ut*t X@t@@f%f1[]1[]ø[]UEU Mu]s]UEU Mu]@]UVSuEUu0ÁE % úډ1[^]ø[^]USEU t-HX|2H@H@[[8t ʉP@1[]UEt@@]ø]UU E]UU E]zUVS辘 utFFX|2@Ttf@4$4$4@@8tf@U &1[^]O Z4PT%t t t@t̀t(t t8t ttLt 1菗 4PT%t t t@t̀tt4tt t@t@t(t t8t ttLt 1봐UVS | Ãu4$V D$t$4$ [^]UVS ? Fu 4$V D$t$E$ [^]UWVS  uU 48x1u 9t <u‰T$t$<$w [^_]É4$,V UWVS 襕 ì}40E D$ED$4$+t<$U D$|$4$ [^_]UWVS K Ru}ED$E D$4$ևt<$U D$|$4$ [^_]UWVS }u4E D$ED$$Uvt/Ux0u 9t<uƉt$|$$G [^_]ÉU<$T ƋUt$|$$ UWVS ] du}ED$E D$E$t1x5u 9t <fulj|$t$E$ [^_]É4$iT UVS u Ux2u 9t<u‰T$t$E$Z [^]É4$T fffffffUWVSD{ Â}E0uċEG,@4E@U }4 ?E EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$BuD[^_]à E1D[^_]É$vhFE@E1҅t4}$\tMTO HG ;uu֋}E  G(MJ9~R 9}ED$ D$ED$<$.RE@f=$gGE tPM E;GTMW,M M Mč@44MEEFEȅVE@$6gEyEGM+;EE W(M@9~F t$bF E@ffW@EE ЉE% GH% ȉFEfFE@Eȃv?}$ZMLO HG ;uu҉}NEčPEE~f}ωƋEW tEMȉ$aG EMȋURQWWfWfwu}G9MwT91PO(LE @ 9}GPT$ EĉD$ED$<$EEGT9tBMW,M P GG(<$1D[^_]ËE;GT*G8 r<$<$ EE 1D[^_]ËMčQMĉy19Nu)MAHFALfFuEy19E0A,4v4ADfFt$A|M$^_uEOT9tE  EEG(B9G;EM+GHFGLfFfFMPG9MGDt$G|$^u6t GH ${MMċu6W,4R49EJMȋGDfFt$G|$k^GHFGLfFMȍA9G~ f~xW(ʋE @ 9}L$ EĉD$ED$<$oEEG8 .E MG19)ȃEG8 (48u E<$GG8 <$jEEċuϋE UW(@9*#M O(LR 9 } GD$ EĉD$ED$<$EEGT9tBMW,pM E<$EG8 5<$uUWVSً 8uE0E,EP@,Dt@ 1Dž<H4pHTDžPELED$LD$,D$ 0D$DD$E$<] )~_@D$ t$E D$4$8^ÉDž[E H @1?<[^_]U聊 D$D$ U T$UT$4$d]UD$D$ ED$E D$E$1]UWVS u}U } v}} utFXHX?)щMEVT9EK1ܬ 9}5D$D$ D$\$4$u˸E N@U ʁE% ЉEE$ _V(E EH9~EH 9}NDȋUR t} tE fdVHMu5 UPFP9t:4$^1[^_]É%W ʉPFP9uƋEÃ} 1[^_]É4$ E  E;FTt,UV,U } 봋x1F8 4$EF8 .E vFU9)EUWVS談 òuEE}ED$E D$4$0zt&EE}EE u[^_]j[^_]UD$ED$ ED$E D$E$/]UVS 40E D$ED$4$yt&D$D$ ED$ED$4$[^]譆 44@8tt J@Ëu_ j 4Rt4`@U( 3U4@8ttJ@]Ëu]U E 4Rt`@]詅 4PX|2R(tt H@ËuZ e4@@UEPX|2R(ttH@]Ëu]UE@@]UWVS݄ Ɖ׉$E4$ED$FPD$4$Sw߉|$4$#ED$ML$4$/w4;0t 1[^_]$ Wu48uFUE@8 t ]L]U4 /E4 A8 tu]ɉ]]US EU 4 x;Q})Å~ APQT1[]øUME A8 tu]ɉ]]USME Ux9Q~)Å~ APQT1[]ø[ f4@t 1- 84@t 1UWVS, ƉE`48}t490FHE%Eu~}FP 9IE@)u9~U܃E؋E؉+U9EU}CIE@RωփtftE@EmEm;E|4}G,U4"E!umEm;E}̋}E܍D8E9}WEE1҉fF;yA,U4v4ADEFFfFt$A|M$ARMu,[^_]ËFTE9E؃)E9UX8ϋAmU9"9}|,u؋}GD$ D$t$<$;w}ڋE@t$^E$j1,[^_]9|E@T9E@E)9U)‰U9~xE:RE@I׉΃tftEEE;Et4}G,U4"E!uEEE;Eű}9}uFEE1 ;wG,U IODUPHfHf@D$G|$PPu E)9EE9EB}w9uRGD$ D$t$<$29uu'E%ffa BU~ Ut4]q1]UEU t]Z1]UWVSE89tX@EO+Mw~>EP,G(UW,u4}y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UE@]UE@]UE@]UE@ ]UE@]UE@]UWVS$\} c}GDE498GH%EGEw, UukOM PG44u4 9uw{fF9uvjffEF% EFt$G|$Muƃ$[^_]ËW;U~iUEEGGD1EoGD$ ED$ED$<$<$1$[^_]E1$[^_]U| *4$]US | E] @ /t+t"` A@ d 1[]1[]øUWVS]} K(1~&1 ~փ9tT,y)փ9u[^_]UWVS0d{ kE,E4E@ ` E14EED$D$D$D$ D$T$UE$t!UB UUB(ɋU~CUMT$$Vt=9@ ~#tyڅlE)e)Uǃ@ 10[^_]UWVSZz auF$EF(E~r19~(~fD,tN L$y؉D$D0$KuED,yD$ED$D0$ tT,U9~(E[^_]E{UWVSy í}G(~"1D0$D0$"9w([^_]UWVSmy hu@ 1~019t% 9d uDŽ` 9uۉ[^_]ffffffUWVS x Ɖ׉UM$J~ }VF +B F(EEFFUVUVFT4$E ENF,UExF~c1fGM9N~EMGfGFD$LG |$F|$Hu [^_]ËExED$<$JUBEE9FbVn1 [^_]ËEED$F,$FtF,U)D$F0$FnF0VN +J N( MN,~+zR,9W O^F9~ HOF؍ 9f~dUEO$G ^V 9~ ЃG ^ ڍ9$~"U?9u1 1ɉ)1)UWVSu E],CKPp9~ NKP֋U 9U }u S xH 9~ QS x E9]}K} E C EC$E491[^_]1)w1)э<C:}4494949K9U 9U u S E489E9E E)}u E4] X ]X$1[^_]Ë} Eu 9"E48;}CU 11)ȍ4#1VC E1/U Uks fE~M ~49B$t ]1]ËE 9B ]UWVS s !UE 4Ex$9}h4P H4 9unfH$p <19} JBo4P H4 9u80H$p <19}  S%D$E$u)4P H< 9H$p <19} E}x$} x 4}:4} :2u #vt@:u$cvuE$*؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )9)UWVSq E4ǁ3~fU ~_;A$tRU T$$D$4$u/E D$$,$[[^_]ËQ 9U u1[^_]fffffffUWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]øUWVSo }M OGXU ;P$UWUU;P Gu )ƉuW u)։uwt]E 9F{M;NsE9F kEE;F`E GEG <$|$4$jD$<$1[^_]ÉFV EFUV 4$69uUUB8} t @B81]Ã࿉B81]UWVS n E} O E+H O(w0G~a1҉׋U J(B,4B]+C[,H NX^F BU D$ $]AFU 9z [^_]UWVSEPX|2uH8ˁX8p x;z t[^_]ÁuكH8Hz$P9tC9uՋMQ ztɋQuut duH8 uX8UWVS m ÕE׉UM$7ƅǀǀǀE$7EF,D$E$Q;ljF0MF4EFXFF]^EF^ F$EFE F F8F[^_]1[^_]ËK K+M щMS+U<2USE] MEP UU PUU[]USE] MEP UU PUU[]cUSEU ME]] ]][]EHD뜋M4)+E E ÉEE~ZM1$[^_]Ëu$[^_]D$E$] E D$E$ƋUy4~)EDž}1딋E4E)ЉNjE EUWVSZg ]]49D$D$C D$CD$ CD$CD$4$ƅtD$$[^_]Uf D$D$UT$UT$ U T$UT$4$B]Uf EU ~@~9u?9 G:uGE~G,E111҉}]tË}_+^~, t]C+F^,"щ;U|}EE̋@SPSfPSfPSfHfP$f@fuFD9FLfGfG|$F|$]~/EЋ@E]F:EE̋@VDVLfPSfPD$F|$]'/tAEЋ@E]:EfEE fEEfE~SEL[^_]9=$I8@F8EAsAUWVS] @4#B@Ơ4~tD@Tt5MUL$D$$a4!A@U!‹MtD@t5MUL$D$$ga4!A@U!‹MtD@t5MUL$D$$a4!A@U!‹Mtc@LtTMT$D$$``@M`4t-QMT$$kKM`4uӋP@#Q@tA(t7t.UD$D$ $N`H@@UtA8t7t.UD$D$ $`H@@UTt3t)UL$D$$_H@U t8@t)UL$D$$_H@ Ut8@t)UL$D$$C_H@U@t8@ t)UL$D$$_H@@Uƀt8@t)UL$D$$^H@Ut8@t)UL$D$$^H@Ut5@4t&UL$D$$O^H@Ut5@t&UL$D$$^H@U t5@t&UL$D$$]H@ U@t5@t&UL$D$$]H@@Ut5@t&UL$D$$g]H@UuLt<@t-Lt#D$D$$]H@[^_]Ë@@tUL$D$$\H@UzUVS X ÎƠ4Rt @u [^]$EID$D$@$j\ [^]UWVS X ljօ$4@ufUGFGfFt$G $(OfNfU~(FɋVPfHf@uUf~NGuHW#d2u `48tr$IW tu֋$Hvuut1 [^_]4Oxu f~Gtf~GvvÅt$HW u륁T$4$E$oHW YxUEPT$ PT$P T$P$11]UWVS EM]Uuuu uu y1y1ɉ]yEUyE+U]\+U}T:Uԋx}x)׉}9~]؋X x)߉}܋U9~U܋}9}x5}9}x-uU܉UU؉U] UUU [^_] [^_]UWVSU Ñ4H@U7Ǡ4P zt*1`4tM[^_]~Ǡ4T$D$@T$)YH@Œ4# H@zD$D$4@L$X`@AT$UD$Ǡ4@$X4P@#щP@~U8Ǡ4T$D$@$BXH@„4# H@$|B[^_]UWVSS ƉӉM$V,4;]Mu;M t:E D$E D$ ED$L$$<5[^_]èufUWVSBS ME4Eԋ3 u4uZJpM XHUE@8@u B8@ B@ ]|$D$4E@@D$VEԋ@@@ D$}<$]Ig8E@xhtXEԋruju^E48 N,1119| Eԋr2Ep Eԋr* E@1 EH,BEEfEE1ۍ= }}䍇 E\4E`4E4Ex4|E<} 9MM]YH,]u^M I, 9Y|EuFD}]FHDfDED$F|$!uFL}]fD~HEԋu؅~E@,uD0MA,u0EЋ@0;q#EЋ@ M̅E@9|HM̋Z]pMR,M I M܋MЋISEBuU]Z[L]ȅ ]]\R zO;uh}Eu GuE܉D$<$]. ]ԋHPt$E؉$EM؉HpuEHuȅt]9]Eu092_y1ۋE49|E@EčP;U9UU܉NjMԋJuE܋M;u:uEgMċE܉D$<$]FMGEԋuM9rtGEM9HrE9ZM I yHB9uEԋEH1xE@EX };G}G(9~E 3tEuBuNxXuN x99fE]]؋rM;YI,^E܉D$<$]:@GƋMԋJuE;u~'}xLuȉG%9Eu)G)ƍ)Dž~ED$<$]tʉuȉ}yEE@@LE9EԋHt E@8!auЋME@8| ;}o wEP z@tP WU^]̅o@+ẺED$D$ E؉D$L$Mĉ$].U܉MD$ȉM܋})D$ M؉L$ED$ $]-E@M܋M܅w ẺD$$]qx}|$D$$OM܉M1҉eNjE@ɋM MMEu;pEԋuFEBFBE0tE]D9GEP;U؉UMMȉ $]Y EMЉÉ؉؍][ )+E;EUwB_y1ۋE4E9KU܉KTĐ[^_]ËEMuFuVX@#d2SM苅xD$D$Eȉ$]ANEMx ϋEԋxEP,u2 R4UT]DFfFt$D U$xD$E܉D$ ED$D$$Xt ]bD$D$ ED$E܉D$E$]1U؉|$D$E@$]6>U؃9u1҉U|$D$E@H$]=U9uzD$D$ ED$E܉D$E$]Xt$E@$7_|$D$$=E)ED$D$ D$D$E$]E@t$$^|$D$$#=D$E܉D$ ED$D$E؉$]0H" } D$D$ ED$E܉D$E$]J1U؉|$D$E@H$]<U؃9u 1E@U|$D$$];<U9u HzHZxpvu;t#t}}O}Ћ;JZLLED$ED$$]#]|$D$$z;D$D$ D$M܉L$M $|$D$M@@p$1;D$D$ ED$D$$M@ủt$$]m\|$D$$:EЋ@D$D$u@@0$],\|$D$$:D$D$ D$D$EQ}D7ED$D$ D$E܉D$E$]E@t MЋ ;ytẺD$$][|$D$$9D$D$ ED$D$E؉$]AE@ẺD$$[T$D$$l9D$E܉D$ ED$D$EDYEUЉ|$D$E@$]8UЃu pE|$D$E@$]8u8L EЋ};x EUЉ|$D$E@L$]K8UЃufD$D$ ED$E܉D$E$]t$E@K)|$D$E@L$]7u"u9u\fuNu5f _f1}䍿 E䋀 E@uЋrt)1upt$$]89}u܋EĉD$E܋@$]2UWVS2 ǃ]419X‰Pt0C:ud11ɋCD$ CD$C D$C$Iu)C9u4 Q+Sx.SQ+S xSB[^_]ËKxSt1҉S1҉SQ+S yU1 Ҭ4$,]UWVS1 ǫu] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$t[^_]F9u4 Y+]^y1ۉ^IM+MNy1ɉN[^_]UVS0 ut$"vu[^]UWVS0 Ϋ}GDE498GH%EEwG,MpGE9r?lMfF UVt$G|$twfF9uv/FVM9utс;MuN uf~xɃEE9GfD$<$zD$D$<$x"1[^_]EU/ 4$]ffffUUE 9 u9H9Ju1Jf3Hu$R @ tuR@tt9 t1]Å]UWVS%/ ,U} w to1t6~RutF$gu1[^_]ÉU$!t8U F@RuDžtÉv$uG 멃UEU  HJHfJHfJ@ E]UVSD. Kutv$u[^]UWVS . EP~`EE@,MpE@~1E~ t$MuEEU9BփEEM9A [^_]US] t.UӋE ȉt %1ȃ9u[]ËE[]UWVS]E 111 ȉt %1ȃu1Lȉt %1ȃuڋK t.1<ǁt %1uۋIu҃9u m[^_]1[^_]US, ÞE@ t$D$ $nx)D 1[]É$M1[]øUWVS4;, BU@ D T E苃P E4EHApEЅ4EE싳L tbyFEԉЉUy E܋EE9u9}yU)E܉+EE%9uu})}9mx}ԉE܋H U)y+}Uԋ}94}ԅ}ЅH4}}܍|9,~ EԅVXD$D$EЉ$ /ǃT E̋P EEEH1ҋL }u4E8P ;H )EԋA}܃;}9P E;H BW4EEU苳L }d%Ey EyFEE4E8=4-)EԋA?P E;H E܃9E9@ D$ $k)D VXT$D$$\-E@pP ǃT 9H OuJ 4lVXT$D$$,D E8uuE@@l8 P ;H MJP Alu@ 2D$ <$j…yD )ЉD m@ t}艻T M䉋P 4[^_]ǃT P ;H iT L 9 ǍVX"t$D$$+T ;L ~aD jT E@@xu@ \D$<$iy)D T ;L P EЍVXU?P t$D$E@$4+D P ;H T u؀>L u)ʃ4E܍ EԍVXEgșǍry );uE@M؉L$D$${*T L EE܋89~1$ D M$QE܉EP 4u܋R,r@VXE؍ E.@ D D M쉋T `9L E܋P,P 4v4~}}uE@}؉|$D$$Y)T D {;EVXD$D$EЉ$")ǃP ǃT UN;H@uRFuLf~-$XT D$P D$F $yVD fPT E@$ 5T D @ tD$ Eԉ$f…yD )ЉD 늋@lVXT$D$$(P P E9H UUԉE?$ i=@ t'D$ Eԉ$ey)D $ 4ǃD @ D$ $uey)D D E)ȃ9E@VXD$D$$&T 9L  ǍVX"t$D$$&T ;L ~bT E@@xuƋ@ t2D$<$dy)D $ /$됉ƋP @ t*D$ $7dy)D $ L 1EUWVS z! ÁE苃L 4U29|H L T P 9H 4EǠ49H 9XL 4u@@hqUMEQML EU9kEu)$ Eu ǃT E98.@@ltˋM t‹ML$D$$$뵉H P pFh9}dL L$T$$EƅtDE;T t4$~U D$D$4$ $uU1H P L T [^_]ÍGEP T Ǡ4P :U4MuML$D$$#tMUt'@@ML$D$$S#@@lu$ uP ǃT 4EH 9p))ʉH P 9:H 4$ 넋H 'ǃL U[ fUL UH U T UP 11]U *UL UH U T UP Ej1]ffUWVS %42E4E4EE09u9uN~sF,EEE]F~JCH1 9F~59uuS9~S 9}͉9F˃EE9FE@E^[^_]ËuF~݋^]v,EEU~&XC]с9u9u9uuɋE@Ey 4BH8~NHD~GBlthtËuu拐tt 1  4@ xUWVS( ƉEYk4EBH8sˁ'}4u@D=u4džX 4Y\A`Bt%]D$D$ $pEBt8]D$D$ $A4l2!P@EBlxhjǁh2ǁd2BxT|2@@Tt ǁd2t d2t d2t d2t d2 t d2 @t d2@t d2t d2EA\~fǁnǁp ~fǁzǁ|~fǁǁ~fǁǁ~fǁǁ~fǁǁti~fǁǁtL~fǁǁ~/Rnff@f@@ 9uǁl"ǁp"~&l"l"ff@@9u}䋇X %ȋl"p"LJ` LJ\ 2E4E4EE@EE8E98tE98t܋E䋘X _HG~MOw,EE}؉ϋ~HQM% ؉9u9uuԋ}D$<$]wbE@Ei1([^_]ø4ˋtǁh24Ћtǁh2^tttǁh29UWVS EU MfUfMf{4;7jf 49N9C4h2tsp"уt:]f9l"p"fl"}fn"U1[^_]Ép"ufl"ufn"1[^_]f:ftlfufEf*ftCfRfEGfufEf/fE$1[^_]fEfE}f9n"Cp"fn" fEfE_/UVSG BEM ]f4;B`Lt f1Dfh2t1[^]ftU4ftifufftL(ft;fvuf1fuffuf1ff1f1f뛸nUWVS$Q XU} uEEEƉEljEf4;B\ @ fnfpufr4 I ytX|2RtE}|$}|$ ut$D$$y9T$D$$1$[^_]øU Efx?4;B\}1@nU f pUf rEf1]ø] &4 ǀǀ4t%X ǂl"ǂp"` u1U勀X %1]UWVS }M 4h2t^ffǀ4 t)X fl"fn"ǂp"` ug1[^_]f3fthfufto'ftVfmcfuؾfLBX %1[^_]þ뜻닻x 4d2US \ c4h2tu=4@t(T$D$$N4M!A@ []UWVS 4\ tM 3H@ȩt?u f4h2t Q@E % ЉA@[^_]LL f8f|,UL$|2@$ 6L$D$$dUTfrT$|2@tLL ff|UL$|2@l$5L$D$$UTfT$|2@h$?5T$D$$U$UL fxZU$UL fUWVS E4rNQVy ;V|"< tJ4$\[^_]Ét$$UWVS ÞEu NQVy ;V|"< tJ4$[^_]Ét$$UWVS9 @4x|$E$ Ɖ<$謣[^_]UWVS } |$E$Ɖ<$r[^_]UWVS ĈMU 4xLxHX9Ap9}:x}x,;u!<79u7PH1[^_]Ëu4&ԸUWVSEM UxLxHX9|Ap9~:x}x,;u!<79u7PH1[^_]Ëu4&ԸUWVS UJtvB Ez]Zq uBy))xDx@qu96Y9}/quq,;]~ ]#4;UuQAAʅu [^_]UWVSEEEăEċG$y)E$ymEU] urEEEEEEăEămyE}G$ Uy)EE9E>E3$yO}mEE}zMEj E9qU&FHGGfGfG;}FD|$F|$(uEE$E[^_]EfNMVUEĉFEȉF4$规MNUVE9FTtHEȃE}U}<$Z4$M1[^_]E34$_}봋E$'QU |Ut4]1]U_ j|UM t4]1]UWVS 4 ;|}40E D$ED$4$tt [^_]61 [^_]UWVS {}MM40E D$ED$4$WttM[^_]1[^_]UWVS v }{u}ED$E D$4$tt [^_]}1 [^_]UWVS %{u}MMED$E D$4$ttM[^_]!1[^_]UEU t ]1]UEU Mt]1]ÐUWVS ƒzÉUM ,ljEDWp1҉]]3 VTJ>v]D{u܋]4.tF<*t*Ѓ}‰ DOu녉1uUWVS( ÚyEUM؋ufUވM݋U1ɋU EEԋ} ,Et$$UEx}P$u܀G$FUt}EMU E3M Mt~MލQf sS,9DžPE݉Et$E$Uu2Eu1([^_]À}. I}ԅ~Mȃf wC,9Dž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVS\ [wUE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ $t$D$$G[^]ûu111[^]U vd f D$ ED$E D$E$]Uj uvd f D$ $D$D$E$]UWVS  &vU:GEG<\5<^tKЍtǬ ,}Z%}2t}<,P{44GuGPҋ1~9%ì ,%Z<\w<:{8LZ{f؍[)f )ډ׍ۉ)ډ֍^0E(MMTSu<.t<*u QUAщMԄ=1RC=}u-EPU%EPUpEPU}W0EPU%M܀dtEPUEPUdEEC=AE%p0%@p0%{@2}%*f@ %-EMHEHEEEC=E%p0%@{10}@%/%{@ 16}%@*%p0@%{10@}%m%@+EMHEHEEECC=}hEPU%EPUpEPU}W0EHM%EHMc\EEsC =}EPU%EPUpEPU}W0UE0\;EHM%EHM+EHM%EHMcӋEEE%p0%@p0%?EMHEHEUMU܉ȉMNjE%>%tEU܋M\; U%+%;EËEE161D<\{C=EPU\\UVS[ bnƠ4tp t~9t $Ip EED$D$E $uIp tG@t  d4 l @xh [^]É댋E[^]Ép @uUWVS( ×mUEtBEE4E}<$˲UT$ D$D$<$0M辵N)) AU܉e)‹u) Auܺg݉ҍ)ƍ43OD$<$mEtTH tCp$1҉}܉ 9t-~fuUE܉D$$HmUuF([^_]1([^_]ËP 3O([^_]UWVS(@ GlUEtBEE4E܋}<${UT$ D$D$<$/ukLЍB)@UeЍBM)@M>Љ)43MD$<$5lE܋tRH t>p$1҉}܉ 9t(~nuME܉D$$kMuՋFy([^_]Ë3M@x([^_]UWVS( jUEtBEE4E܋}<$'UT$ D$D$}<$9.u-?L) RЍ)Ѝ:)43MD$E$e2EOMEu4$HUĉT$ D$D$4$](-?LeċE) @E)ЋUBEeȋE) @E)ЋU BM*SRЍ)AUD$4$dUti}tu~cu ~u GZEE3O$:E13M$J;A$.<뜃}t EE$fffffffUWVS[ bcE1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىU賨Uƍp@Hπw09}맋E D똉UpUUWVS Ɨb84z4y@04G4<11 $rD$ \$$(‰0,1ҋ(tC,1,}Q90t<u90u狕,P)1B t[8Ƭ ,(׀%#Nj4P4H0@,Z9t`J4K4Gu4V,F4F,[^_]EO8Ħ1[^_]Ë8t 4m0$84t t@0@400$8߯4G,rG00 wW%uI%选L$0$8o%4C,0K0S4ƅ`%( Dž,aDžDž$10:~Jwɋ8HPʋ DOu80,B<]38Pዽ0ʍ|YЉ0'V`)ك?w:QJ fɋ8,R狽$V-.,uy0Dž0Dž,xDž$i0lHP,90Ha1B<]]:CEPEC0EP&Vҋ8REEP, s G04P4H0@,\:9g,|$ `L$0|$Љ$8 K4G4510O0PD]}}P!n~uЃOPD}cA<vRŤŠEOp~PTENEPUT$08覡9ϋ0sȍx4K4[0D924@,T$ `T$|$ȉ$8荪4G4EEPkN1.V?;epPF%tʉEEPu4P4H0@,Z9J4K41%V? ; pP}F%tӉA<A<4T8EOsPDEF~EOBPDENO<'u}5D$$<D$t$$iE$/Ut`uE[^_]Íe$.|ƅVEE[^_]Ë}ut$VD$$xEuUD$$wM$\-@ x tAMut$vUD$$w$SxEx tU*E=ED$D$ht@E$HtEftUft IA(QuEtxE1$zt!D$D$$s>RB($ztD$D$$@>RB1rUD$$v}UD$$evhUD$$Ovt$UD$$5vUVS REtD$ E D$ED$E$ƋEt$+[^]fffffUWVS òQƉEωD$$YRte4$ƀ?uT)9tXzztED$|<$c…uۉ<$迖9u#t$ED$<$Ⱥ[^_]1[^_]ÉUt$ED$<$蘺Uu[^_]UWVS PuEUt]t]v [^_]É΋ %1ji˃1҉9rExtftEx(1fWFu~9Ft"FD$<$]ljFFutftuFPVD  ЋuXuËuVf;o{CftKWҍTRӉEf}]}^ Qu F 8v;Mu܋E}f8Pf}w} H u yf}uHD$$%]衡}G ExD$$!]n‹EPu!f8tGPft>}w}  ft(XHuu҃f8pxE;x L@$X|$D$$]貇Ex tpE@$E11EV HnsefwrRPMu v@@@ 9wND$$]}G 11fCvuF F$t$]F$uyf fE@$$]ʣEx D$<$]e]C$i$ffsuVT@@rRt5p @}t6JrHUsMu,@ lJrǪ7f9@ @'UfWUWVS,( /KE׉MT$ IVD$D$ E$诙=v(詐螐8,[^_]D$E$ ƅtʋE$UU܉T$}|$ D$ED$4$ t6Mt/U:t+E$Ejǃt<4$ ,[^_]1E܉D$ |$BD$4$ uދMU믋EPEGǃuE䉃 D$|$E$sE=D$E$ ƅUWVS։Dž)t Hv8s<:ut<:t؃u)u΋[^_]É׃rtftƄE$t ɋuDžfDž{UWVS  ôH։ǃ QV$xp48/$3…tSDžD$$Nj$蹟tOi\<$ $cV$o…t!$2 [^_]Í$ot(D$ qVD$D$<$T'$~V [^_]Ë$u [^_]Í[V$.o,!/$M2lj$<$t<$‹|$$B$$<$XtZV [^_]ÍPV PUWVS "FEEu EEt$$vt NjM‹E%E<$_}tJMEEt5`V1uΉD$E$bFt! t EE[^_]Í`UUHPE[^_]dffffUS= DEEu[]ÍED$E $[]UWVS֋N u f[^_]Ë^Kf JN fJy8VӋ6suu[^_]äftuutYyZfUVST [DƋ$ɛF$辛F$賛F@$訛F$蝛F $蒛F0$臛4$[^]UWVS C}wu G9r [^_]Ått$$tw[^_]É4$UWVS ǒCU MuR u+ftO؃tXf;0t&nt(suXDu1ۉ[^_]ËEx DC볃UWVS  CE 8@ Eu BsfJH΋BD96t$B@U$!UtB@rDJH]fBHxzHz@utftEBHJ@XZHun&sOf.BL[^_]ËB@u1[^_]ËED$B@D$$UuE(E tȋED$ D$upJH΋BD9vE$tJH΋BD9v1z tFJH΋BD9`U4$ UED$ D$uD$E($BHB@z tzu0BHJ@BHXZH]J@BHu$f4BHxzHE$z@u stftE$BHuhuOыM~fBHJfEfE$UWVS[ b>E 04$迃EE @E$蠃EE @E܅$聃EE @(} GW8DGH}EE$;EE @ fyQU׃?UMf BEut%ˉǃEEMfUz}u܅tȃuduWEEE PE] S u V0] S@EM+[^_]äQfGft懶t&^fSU뷨uhu,u8ECEAyEffzEDf<Jz]>UWVS ;UM M ,82uDG@ƉكD_@uut+H8]t \t'^t]XtȍH8]u E[^_]Xtp}:tYuE[^_]ÀEu2>t؀xtEE[^_]ÉZUWVS赿 ü:uNE|F9vSt_|$$ώtC~NU fFF}t7]fFF [^_]Ëu1[^_]É<$萉륋}<FUWVS< :E@ EE@ 0t$$iU4$[E@E܋uFI1D$|<$Kt~HM|$E@ $$E~ExDED$E@$袍UttMA 0ωփsztft$赐u}n|$E@ $$E}~Ǎ@ED>D$E@$.Uu;$`EE<[^_]"eMAOMփEtfEtǤ$E܉$E@ Eu~,F F(F$F, uuFSPpx3My ɍL L$ T$D$E$6t}uPpEE$PEx@}܋@LEuF@FHFDFLuefxC}111D$ T$L$t$D$ED$ ED$D$E$tYmtZ7GED7MntsuHP|1둃}t>px111zx@11jEE܉$TE<[^_]px111;frEu/u;Mu$E r}fm볍u$E0ECUWVS 6UJEtB9vwt$U$Ut]rJ] fBB ]fBxzE:us>u.u'EBB [^_]Ëu1[^_]äftЍt&u%u0t׉4$蒄UYEfUWVS 4uVzF9vHtT|$$t8~VM f FHNMLF [^_]Ëu1[^_]É<$UWVSln y4ED$,E$ D$|$]a~xD$|4$]pFHM4$]ty=t<$]Zy=F Et$]=y=D$$P]߆ÉE\@ t$$rUt E mt E :D$,E$E{ EEE荈vMvMvMǬ ,}ЍvMhv}LvEEE u<.tjDy@u뼉EĉU܋ED$ ẺD$ED$E $U܋Ex}]tD$ED$4$]ËE8^E qEx fPpڍwJЀv<ҋMЋ DQEċED$ ẺD$ED$E $'Eă\9uuME1҃U]E1҃<$}U} |$ D$D$D$D$D$ fED$D$E$D^u xumU bUWU LUAu 6M +fEx DD$ \$|$E $g,EĉU܋ED$ ẺD$ED$E $U܋Eă.$} |$ D$E؉D$D$D$D$ s4$tf]Gr|$t$E$^f1$E)ύ)ȍD$4$L(u [^_]ÿUt o'E=w ~]1]UWVS : A'u4$lUT$ D$D$4$}-?L) RЍ)ЍwGEeM) RЍE) GM*S)ύɍ~D$4$;'u [^_]ÿUWVS4Q X&ufF(}ȉ|$$Kt4[^_]É<$;11t9ufF(4[^_]UWVS %u f4fV Ed4 4$:V(EfD$FD$ $U a=UwDE |)ʉM싆t7T$UD$E$`U9vUJM|M))‹FtIT$UD$u4$`U9w4[^_]1$d4[^_]ËUыU|UVS螩 å$utnF$ |F$|F${F ${F$${F,${4${9 t 1[^]ǃ 1[^]ø $ @ $ @tÍfffffffUWVS˨ #lj$U/iD$$ >Et$UT$U$s+9UuED$$ >1[^_]ÉUED$$ v> $-UD$y-UDhUWVSd "5EU1ҍEEƍ EE> ;uD$t$M$+Mtɋ$,$,MDŽhU}+:!d[^_]Euu 't< tPvcFuM$+$+MDŽ UWVS< !Ɖ58}11ɍ tufuπ@t:H@u~D$@D$/$[V:tP:uwUBu2$gW $UWVS`茟 ÓEM 5U1ҍpUMED$ D$D$@U$UhUCtSD$$ 75EED$ML$ED$!;EUT$$ u>4M+u}`[^_]à Wut$L$$!4 U$#ED$#UED_|UWVS`- 4EU5L$\1ɍxwbtNT$E UD$ T$D$D$@T$$T$gT$t>$ uT$ U MT$L$$QL$\+u`[^_]øUWVS ` gExw|Mt_LVƃtA#ƍ U$b"ED$S"UED [^_]à u$""Ɖ [^_]UWVSl豜 øEU 5M9}1uHM$}m:m8@}k6E81nXE-} )|$t$E‰U$U֋}$ uD$ UD<\ t$T$$fO}M+l[^_]êEf:FD$D$ LD$D$@u4$d}tPf>~$E~LVF9u1`f7AM[,USj qEPw&u t[-$"[]US EPw&u tZ-U T$$Z:[]UWVS这 D$:E$&tp tE D$E$[^_],Z-[^_]UWVS I PD$:E$&tp t"E D$D$E$p [^_]ËE D$D$E$ [^_]US Ø EMPw&u tXY-L$U T$$m []USd kEPwt1[]à u$7[]UWVS "D$:E$Y%tp tE D$E$[^_]X-[^_]fffffUWVS蟗 Ǣ}E1E xtC1Utt ƒu@u[^_]UWVS| !E|5x8}1 > E|EE Eƒx  EB A E;uuˋE%@ ED BEP ExE}Wuwuw EEEJ΃ 9MuEЉ̉ эuEE@tuEщ ʉ ʍ  ʉ  ʋMxEEEEEtE@EQǃ 1)UWVS\j e uE EM5E]11ȉ܉ %Ev㪪UUUU UUUUM% ؉E1EE EEEƃ4x  EF A Eu1E1EE܉}ԉMԋEƃ4x  NjF A E؃uƉ}ċEMEEE@ EE4uȉEEE܋E؋uu؉EEċuuĉEE}]1#Eu܋113^1݉]ԉMuEȉ} }3 3 }3 }3 3 3 }3 1EċE }3 3 }3 ]3 3 3 }3 1E؋}؋Eĉ1#MMԋu܋M3]1ËD1M1EƉu 3 3EE䋼 3 3}E3 3 3 3 3 3 3 3 3 3 3 E3 }mBuumEME% ME%MɁ ȉE1E1 EME0Ãx  NjC A EuƋE8upEu+0u)1\[^_]ЉEE E4UWVSP (Eԋ}] ]5EЋ0u1;$]܍u 9u$EE<_tuX< P<:fF]S7 l:c]ĸEE]ԍ ]]$(#?8D$ D$\$$ 09u몍uEEESD$ D$$$Ű]$thU9tD$ )ЉD$T$4$[f}2at^}sha1 f}1}argo}argo}argoEԍ ]Ћu+3P[^_]À}uE؉D$<$NuыE<*uE؀x0uEԍ볋]MԈ ȍĢ ME@Ẻu Ȁ`QŃ?u49uE ЉE;}uɋuȅEjX]PE]ԍŢ ]ȋ]ԍ@]]u2NŃ?}t}<9uȈ ˃r2u`ƀ@~NN҃?뺀@6Q<ًuEẺËED$ L$t$Eԍآ $`EfM ȃ?u1@K?1@K ?1@K0@EfM ȃ?1@K?1@K ?1@K0@CEf?1@K ?1@K 0@CC EwQ҃?}n2id<~2E؉D$<$1l}n2d+݀}E؉D$<$ ?E؉D$<$+}n2i뜋]UWVS+ 6E5E8}1EXEEƍ}S1J 9uZ9uE$}u+7u[^_]Ë]eUWVS,诇 E؋}}5E0u1_EE}ƍS1J 9uZ9u} D$ D$ED$$uJ]܃8uE܋}Cу9uF9t܋}܋Eu+0u,[^_]ÿ]UWVSDچ E E}5:}1DžDžDžvP88U+1D[^_]D$D$D$ D$D$$@D$$ @@D $9ʉsÁ tщD$@BD$ $ |$ $?2 9ȸe?!~9ȸj?J9ȸe1?߲9ʉa?+59ʉ_?x}9_Dž\DžXD$$贖D$$蘖(D$$rXP4R 9ȉ )ڋ09<19vD$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$}$D$$OW(,48 1؋ 1 0<99x11҃DžRXDž@9Dž *DžDž Dž UWVSX _Eu 5U1D$D$ $kDžDž4$-8$u D$$r$BDžD$$`r8vuUx=uOT$$|D$$r Dž|DžDž DžDžT t$<$qptLtm$SDžu+0sİ[^_]ËT$$[t$<$qoD$$pDžDžxDž_<Hv2Fpꋽ0~Nz) ЍN!ȹZ) ! ȍ~й9) у! у+у>׃/׃? ȉփA! =ЅD$$mot$D$ ِD$D$p$ H$P4$>||$0|$,D$(T$$D$ T$|$xT$D$t$ D$D$$X@D$ D$$ƵD$D$4$訵D$D$x$芵D$D$p$lT$$y6T$$lxۋuDž&ЃDž| $%D$ D$,$I$N|UVS{ uv$Ԑ‰)Ѓ[^]øh`UWVS4{ ï]荻4}u u4D$ ED$E $goEE8$E $]Eh`)‰UE E h`9t$u+E E܋E$]i;NjED$ut$u t$u܉t$ ;D$D$b E$mD t$|$ ML$D$E$ }v/lj|$t$ ED$D$<$9]uىE D$E܉D$ED$ED$ ]荃DD$D$b}<$CU^D$O O ȉD$$EPU9uD$]    ȉD$$EPU@D$D$4$ԱE4[^_]14[^_]+M MXELfUWVSˉU 3]3։3 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 13<43 13@43 13DE] [^_]UWVSEfM荰uHE1ɺ1f9M ؀u1;uuEE}u]܉EEEC;]uE䍐UEE荘EEEC9]uEE9EuɃ[^_]ÉTUWVS t Uɍ4 u9 @>0UZ9]MUQz  H? >H9Uv` ˃0]]9]vDZM  >Htu߄>u}$2a$E؉D$ OD$D$G$<G1MԋU+u[4[^_]Eru؃aAJ383UWVS$^r ]5E1ED$ WD$D$ U$U;UT$D$ $-1t؋M+u$[^_]ÉUWVSq @EHE 542u1EOrphEeanBEeholEderSEcryDEoubtx2,P$=axƅ;a$G$@萲‰,<w4$s1@?G2W`UȉDы@Fxltct^f Ј;`tFFx>$u ~1QH t $t9u+p @4$Չ |$$D$4$D$D$4$ЉL$T$(4$讉u4$r|$$D$4$草L$T$4$q|$$D$4$[t$0,$ŊC(~T$,D$<$ ׋,@@@ Ƌ(,D$<$t&D$uڋ$D$<$蛈uڋfǃ@ $1ƃB $D$D$C <$D$xD$G$b(D$,$謉1 D$$D$4$ʉʉʍWUUUUʍ׉ʍځ$I$(tsD$,D$4$藇t$,$4$=(:D$,D$4$C7 D$$D$4$"뉋 D$$D$4$DD$D$4$@  D$06 < ȉD$$  D$17 = ȉD$$a  D$28 > ȉD$$  D$39 ? ȉD$$  D$4: 5 ȉD$$  D$;T$$k P @D$D$,$e}+8uu[^_]À~$Dž0Dž4Dž8Dž<:DžDž Dž&UWVSme xMMu5U1҃}@2Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\EU҉t\61T22;Er䋅$}D$@|$<$~E D$D$<$}|$$g<$}D$@t$<$}D$t$<$}|$4$%M+[^_]Éu4$1}ED$L$4$P}t$4$~Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\ETfffUWVSKa RutJD$ED$4$(UNjE9t=8u8!8"tE 81[^_]ÃuE 1[^_]!UVS` EU ]~Íу? H9u[^]UVS` EU ]~Íу? H9u[^]ffffUWVS8;` BƉUċP,x0 9s1V8UEV(UȉMԉEE܉}F4EMĉM9s}t$}ȉ<$t8[^_]É<$uEĉ|$4$Eă8[^_]U_ ˜Et t&t1]ËM t6J]ËE tR]ËE tA]Í]Í&]Í]UWVS#_ *u} 4$uw[^_][^_]UWVSd^ u}$}(E($)EEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$*…uA}4)U4…u'tE(usQuAu:M,ftE0uZUE(D$}<$<$Z0UЃd[^_]äftt&uqtӉUE4D$ ED$E0D$E,$;UxE(D$}<$ E0D$E,$p <$/bf{vE(].U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$,]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$S]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$z]UVSRZ Yu4$4u1҉[^][^]UVSZ !u4$ u[^][^]UVSY u4$ u[^]o[^]UWVSY ê}u <$ Eu<}wAU/Eu%Ot12 ׃9uyE[^_]EEUWVSX!Y (U$ljEE$X#ƉE<$K#EE EEEED$UT$}<$W5t.1EU$&+U$+4$+EX[^_]ËuE$"EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVSW ø}u <$ Eu51҉DEu%Ot12 ׃9uy E[^_]EUWVS?W F}u <$ Eu8Eu%Ot12 ׃9uy E[^_]EUWVSV }u <$ Eu8ZEu%Ot12 ׃9uy E[^_]EUgV bE##+<ፂW]Í]ÍԨ]Í ]Ím]Íצ]Í]Í]Í]Í]Íا]Í ]Í]ÍD]Íh]Í]Í]Í]Í]Í]Í]Íѥ]Í]Í]Í]Í/]ÍB]ÍY]Íp]Í]Í]Í]Íp]Í%]Í5]ÍE]ÍZ]UWVS U EwjE$+9NjE $9ƋE$9E|7E$8E}E$8}$8 [^_]Ãu$|ffUS YT dU T$D$U$蘌 []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVSUu 13ƋL3L‰L=u[^]UWVS>S Au M]مt2u#E@UWVS$BJ MMU 58}1ZA@yDD$ HL$D$4$JZ 1ƋLÉL=u苍A@D$ HL$D$4$JZ 1ƋLÉL=u苍9z(@tD$$}+8u $[^_]Ë蔮UEU Mt t]b]UWVS\H uU 5E8}1V(F Bу+?Ѓ/ [^]UWVS É։MM<}R)Ѓt u }E9usytgMM11EE@ƃ?'كCwU9UuljMt)?UZE [^_]EE [^_]UWVSEUEEEEU<}EHv(UB]9}}EMڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/׃? ȉӃA! ="}w"ЅEuE}8[^_]1[^_]UWVSE0 w+׉1ƒ0 w!w ҉9s1ɉȃ[^_]9t}0t ȃ[^_]Ã9u׉UWVS N# Uu} FEFED$E$?$ulGE$UzljD$UT$E$bu=}F8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=ustUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSXx! }EE5uU1D$E$ƋẺ$,Ef} Tf$OME Eĉ4$w9E/PMMȃ>MU)ƒ$v=AMEruE̋@8D$-EĉD$ D$D$E҉ljEȉ$+<$9ƋM@}uȃUGMыE)Ѓb$m=QMUx}E̋@,D$EĉD$ D$D$uȉ4$4$X9NjM @}uȃvMыE)Ѓ,t=QMUx}E̋@(D$EĉD$ D$D$uȉ4$4$9NjM@}uȃ`dMыE)ЃL,p=QMUpuE̋@0D$EĉD$ D$D$}ȉ<$<$B9ƋM@}uȃEЋM)уf$xqE̋H@$)ʃf$}̋O $ZcE}+8-EX[^_]Ë}Ȥ6}f}ȃ%fv)fffvfE}}o \kE%)E}f}ȃWWUȃAyuӉ fAyuӉf AyuӉfAyuӉf菁UMR)уtu]UVSU ṽщcw[^]ffUWVSu |$$ lj4$$XF$\F$`F $dF$hF$lF$pF$tF $xF$$|F($F,$F0$F4$F8$F<$V@т歉$`VDRQ$dVHl>+$PvLh$TPPkA$HpTك$LPXy!~$@\5[$$X$\D$pT$t$x$|$`$dt$h|$l$$$x$|$h$l$8$<$$$p$t$p$tt$P|$T$$$$ t$<t$D$D$ D$ D$ D$ D$ D$ D$$D$(D$,D$0D$4D$8D$@DŽ$XD$X6_D$\:OD$`+D$drn<;ʄgDŽ$@ɼDŽ$Dg jt$H|$Luw$Xwt$@w t$8wt$4wt$0wt$,wt$(w t$$w$t$ w(t$w,t$w0t$w4t$w8t$ w0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$4$_p 1D$ ED$,D$$,] FT FP,u,D$$袳1(u+1uN[^_]D$4$xtFXF\FPFT문hUSEU MtttXT XPu []?1[]øUWVS\ }ED$} 5L$T$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$TƋE9FT FP1F@VDF@VD1FHVL t$FPFT)ȍT`D$D$$նV`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$sҤ!D$0 贤"D$0+ 薤!D$06# x"D$0yZ!D$0[ <!D$0= !D$06 !D$06!D$06d ģ!D$0m覣!D$0 舣"D$0j!D$0kP L!D$0M."D$0/!D$0!D$0Ԣ!D$0趢!D$0r蘢"D$0z!D$0{ \!D$0]6<>!D$0? !D$0!!D$0!D$0ơ!D$0P訡!D$0芡!D$0l"D$0m.N!D$0O0!D$01*D$OD$"D$0"D$0֠"D$0 "D$0讠"D$0蚠"D$0膠"D$0r"D$0s^"D$0_J"D$0K6"D$07z )ك\$0ك,ك\z ك\$0݃s,t$D$$yLt$ D$D$$l8,D$ D$D$$l,D$ D$D$J$l.,D$ D$D$d$Zl,D$ D$D$$(l,D$ D$D$ή$kq!D$0r,D$ D$D$8$k),D$ D$D$$kC,D$ D$D$$Qk=,D$ D$D$\$k,t$D$$eJt$ D$D$$j,D$ D$D$#$j,D$ D$D$\$xj,D$ D$ D$د$Fj,D$ D$D$$j,D$ D$D$K$iH,D$ D$D$y$i~,t$D$$Ht$ D$D$$miK,D$ D$D$$;i豛!D$0,D$ D$D$6$h,D$ D$D$$h,D$ D$D$J$ha,D$ D$D$$_h,D$ D$D$n$-h9,t$D$$sGt$ D$D$$g,D$ D$D$8$gj,D$ D$D$$g,D$ D$D$¯$Tg~,D$ D$D$$"g,t$D$$hFt$ D$D$$f,t$D$$%Ft$ D$D$$f,D$ D$D$o$jffffffD$1ffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09vvK4)ȉU9vEEϋu)փUtftЋu))։‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C01[^_]ÉMD$K(t$H( $P ljC8U뿋EC4C4S,9tcC09vEC01[^_]1[^_]äC4C,C01Mf7C4u0u\ u5ufEffZP;US]|‹C@ CCCH u`@4?@@@@@$@<@@4HpHTHPǀǀ[]ÃK0똺UEtH tP$t Pt;t]ËJ4?wB,B0B4]UWVS }] tWxt/ui1ۋB8t9Z(tUD$G($W$UB8r Z(u8G@,@0@4} [^_]g| ۍCv [^_]UVS N]E81}8CC twS(s$tbD$D$$ЉƅtpC@8@4?E D$$tEt$S($S$CE[^]ނK$C C(1uиɸUED$ E D$D$E$]UVSEM tWX tPP$tIPtB;u>B-4?w1x6(r@1 w#EB?EEE@>D$D$$]|]CUB0C??E Ex6E܉m؃E܋E@N?EX څQ}wIu]Uԋu}؋MBǃvUԋUu}؉M܋uȉ+E̋}G}G OtBU)U_ۉD$T$ $]4uEHUJ0P E@D}؉ЉЉ9EЍUBE@Q?ẺE^XEt]ЍuFPFX FTF\FG?}  mmUԋE@H?UgḾu]^ N]ԉV}U؉WߋuԃZtftE@t E@ | )UUԋExD})щHD3E@UBDB:?)uV$tB]CDC;?}w@EUԋ]u؋MBƃvUԉ]u؋E@$tu؉pE@t @  E@7?EE$E@~E@,}wC]7Uԋ]u؋MBƃvUԉ]u؉M܋uE؉F<]EЍرUBFQ?E@D?mmUԃ} wC}Uԋ]u؋MBƃ vUԉ]u؉M܋]؉ڃ}WdGh w`]؃mw  EЍUBE@Q?Uԉ]u؉M܋M+M} ]ԉu}؉M܋M+MwmMcMt1ҋ]9UtlL}G$t p$utwD;p(sGD} 7<u‹E@u)։ u}6E@??XE@ E@  ED$EԉD$uF$]4fFEM+M̉}]1ҋ]9UtL}G$t putwD;p sGD} 7<u‹E@u)r u}yuԉ]}؉M܋M+ML}W4w8])9)W,ƋEPD9vȋ]9v)E)‹}WD}9u}ExD@1>E9]sBEUԋu}؋MBǃ9rUԉu}؉MܸЋu!UBDBDu)]>f.ẺEEEE@O?DUu̅E]CDuCH?  )uNˉMMYluftYtu9uU}؉E܋UzQ?ft EЍ<}GBQ?[EE MM ЉE#E؉EPfU@0;Uv|]}}ԋ]U܉uuGƃE!MEMMHfM@M9w}ԉ]]܉u؉U܋um؋})}܋U]ԉU}؉M܋M+MfEǀPPHXӋE!؍4F9EsR]]ԉUU}؋MtCǃE!u4FE9wՉ]ԉUU}؉MMvm)E܋]sDE@M?UUu)ƋE@DzEǀPPHXӋE!؍4F9Esu'q}ExHXL@K?1o9]sBM>Uԋu}؋M^Bǃ9rUԉu}؉MܸЋU!ЋuFHU)]\m)E܋UrD REǀ@??}L}wCM]ԋu}؋MCǃv]ԉu}؉M܋Et }@$t@0E؉B))9E؃EЍر}GE@Q?EPD@B?} EEEEЍ׳UBE@Q?A@ EЍUBE@Q?E8EЍuFE@Q?mmU^]9s:]ԉEuNs9r]ԉȋuY])1au]؋]M܃w'EXM]fDQt9uE@l}荇4GpGPGXD$GXD$GpD$ D$GtD$$]54UBGQ?}ԉ]u؉U܋M+MU}؉E܋M+MT$UEԉD$uF$]]FUZEԉu]؉M܋M+M|EE؉ED$ED$uF$]]FEЍUBE@Q?} ։u]! ; yf}q<;}vsM}UU܉EEX]؋]؃#]M]u4NfMvM9wEԉ}ωU܋EU؉M)ȉU)E܋U艺EBDEXL@I?cE@l@E?13^]9v:,]ԉEuks9r]ԉȋu)M)]utsrY]nE@R?EM{U-E@G?} JM+MEMEP$t EEt E@ xE@6?EE7EfED$ED$uF$]'[FFEE]C rT$EԉD$UB$]ZUBuB}{M+ME}E[fevPFEԉ}U܋M+M E@l@F?1`]C T$EԉD$]C$]Z]CuC}EUP }̉xUԉ]XE}؉xuuEtB0M[^_]äftt&ftt&u-uYu5urfM yf떻UUWVS 襯 ì*}u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$0[ML$M L$$[9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS,訮 ǫ)}̋EE5}Ћ]1ۉuEԅwu܋GE^@E܁xS?h@S?ك@H t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃB 1]UEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]UWVS蒦 !E}M|11 rtE xfDU9u|fh]]ZM)fJutu@]Xf@htuEu01Č[^_]UWVSLء E̋EX߉]؋0u@DEEp u@+U UE܋C,EC0EC4EċC8E[~l^`FpEV8T:NXFH1#VTVHNDQEF4!N@fAEf8^xEFdF`t;s)ыF,-9'v 9^`FhF8D8ZZZf9FlFtX^tx18[^_]FhGFlFtX^tVtE t_~l^`FpE^xFdF`F\Vl)…F8D$ T$D$4$]WVFlF\;.~l^xt+Fp=F`~FtDE]f+FdPy YfZ]Ӌ}ff=vff}f E苆E~x}Ft)ÉFtWVxFlE܉U]؉Fl;Ew2^8\ NX~H1#NTNH^D K~4!Nj^@f{fm}~xu]FhF`E}܍D8FlU9UV\)ЅxeV8D$ D$T$4$]TFlF\|@^t[F`^x~l11뚋NhteV8FlDZZZfFhFlƒwg} tlV\)ЅV8D$ D$T$4$]SFlF\v@8[^_]ú} uV\)ЅxRV8D$ D$T$4$]8SFlF\x8[^_]ø8[^_]1W1UWVSPE P E}`&&u`'&Ewt,GlW8TOXwH1#WTWHOD Qw4!Ƌ_@fsft)Ӌw,9W`YPf+Gpqfq ҋ]ff=vffuf EԋEЋG`E܋wt)Ɖwt_l]؋_8]_X]_T];w QUU؉WlG`]GHTM1#UWH]9]G\Wl)…G8D$ T$D$<$]3QGlG\HD1P[^_]ËW8ZZfGtpwtGl9EWt] `Glv‰G`GlX_`GDE̋G@EȋG4EċGHM؍Q]uWlMuL1#EGHu̍Fu!֋Mȉ]fq]fmuw`uuUU؉Wl\1tƒwg} tlW\)ЅW8D$ D$T$<$]vOGlG\Z@P[^_]ú} uW\)ЅxKW8D$ D$T$<$]OGlG\xP[^_]øP[^_]11SUWVS$) 4EEP @,ru9vEECEЉE9vME9E} 1;UEED$ D$D$E$],KEP@]و\EP@|EP@шLEP@ӈ|EEEsEEEP*K97)ыE@l}+G\Ǎ0E ;UE} u9v}J _\_8‰ωރtftuC )CCF\)EE.S uEs )sssEEu)ƉuteuV,~8;Udž3)փd9*EP,PlEP\Eu)ƉuuEPlE9sEaEHE E;P\Ep,E;vEH*E@ E)=}O\)ʉ99G9} D$ t$EH8L$$]HEp\~E$[^_]Ëuvtftt&1[^_]ÍHw5@u[^_]1[^_]u/u=yf XUWVS ö}EGGGG,wFFFFy؉Ft@F*D$D$$-+G0F(4$>E[^_]F9D$D$$j$EUWVS ~ u4$ Džt [^_]ËvF,F}U )u׉[^_]ÿ[^_]ÿUS]tDS t=C$t6…u)CM MMMH|[]ú[]UWVS }U \É ÍBEtƉ ƉU u\OAtWЃy0IPt9s؃ [^_]Ãu ]Ѓ [^_]9rgC [^_]ËAEtjxtm@E}t )ǃ|u}$t )ǃ|u},_WC땃yl ?5UWVS4z E܋EE؅} E@EEP 'PE@=u~QuN(} ~(v=* EPB@qEX EM  @M L$M $MP<t%} }  EZE@u E@(E؃4[^_]ËE@4+@MAEЋ] ۃ} u ~ 9=EHEXEHtU mx} VEPEH0uFXF^EH0VFX^,EH2VFX^ EH3VFX^ EHVFX^ EHVFX^,EH VFX^ EH VFX^ EMA~؉AEX1EeuF0E 7E@lt B))ЃuNVZ^$NVZ^FlD$D$$]w#MA0uFqFE@9D$D$$]MA0uVFHNVFHNVFHNF0‹x,tXtHtx$tuNFX^FHVFX^ FHVFX^,FHVFX^ FHVFX^    }OGX_GH WGX_ Wrt*JWGX_ GHWGX_,WZ,{ E@ @E}  E9EXۋE@-} #E@4+@MAEVFHNVFHNVFHNVFHNVFHN ) 9 }OGX_WGHOGqEVGGEdEPr]{}K B)ȉ‰E[ ]9iUmtftB BJI,t ;E EB UEUBmM+MM]z }JqJ 9EE])ZE߉΃v|\UEa E@0NVZ^NVZ^EP0NFX^4NFX^M)ȉD$BȉUԉD$E@0$]MA0UE]ڋE}x΃htft}MOOWB,0E@ E@IBuN&ZV z~ ^x~t4FV9F uՋz,t9EFV1묋EPZ,t @9OE@ E@[B$uN*Z$V z~ ^x~FV9F uыz,t9rrE\FV1묋MAE D$E$K)ȉD$NL$E@0$]MA0)ȉD$NL$E@0$]MA0e]C@,S9dMAgtp]CP;S vEC.MI0uVX^ EH0VFX^,D$D$$]MA0}GqEw8B,XfEnIu EP[;gE@@,1ϋGtG`W8GlZZZfGtGtOlQWl9pGt^E Eǀ} ETMA\Yl])…sA8D$ T$D$}<$]2GlG\PG\)…x9G8t$ T$D$<$]^2GlG\B@1;M썶E)L$GD$E@0$]MA0WE`&&M`'&UB`Jlr8utut]:^E XXX fjtBl9ZBt=QЉU(UBt=6M CB`Jlr8u4@ED$ D$D$E$]-} EEp()ȉD$}OL$E@0$]3MA0W)ʉT$KL$E@0$]MA0G@,k:^e:^\u썴uUԉEU؋]L:P':P :P:Pf:P::P:9E:PtUԉƋEЉ]+]Z`9B`ÉكXXX Mff B`)BtBlB`9B\Jl)B8D$ L$D$$U].UBlB\U@U)&u^VFX^ EP0NFX^4NFX^NO tE}GD$GD$E@0$]MA0WU1Eǀ} .MEPE*E$],ɀ@\ϋYl])D$ T$A8D$ $]-GlG\HE@AE@4+@FE|}GDWLfDPTT$D$$]4Gt*GlG\LJ @\Yl])…xoA8D$ T$D$}.1E@D$}fEP1됋UԉƋEЉ]UUԉƋEЉ]BUԉƋEЉ]/UԉƋEЉ]UԉƋEЉ] UԉƋEЉ]UԉƋEЉ]UWVSg } EEMEp 5}+M9~(u\9tDJBBF|EE[^_]D$E$E@FtFl9F\`^tiFDVLfDPTT$D$$dž% @9E5E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS se ~EuE EM}EEEEE U$n81e8\GFF ^$}uEEG} }UD$D$F($V ÅF0@*UP@x0ljC,@C4UJKPCLCT SXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃUJD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]O?|A11u3 cEނF$EF F( [^_]øCE@4+@F4$~̸U ED$ED$D$D$D$ D$E D$E$]UWVS] .EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8C,{@uv@CL{DMqD%C {uvugu`CMQ+QS $ | 0 E[^_]ävflfftt&mft&_0f&t&fu5Ifa{@f3f+0f(-f%*$ E/E#E^ UWVS<] EU O]Ӄ}E U2X3 ˃uE UEEEċE EEEEEEuދE30u؋M3HM܋}3x}ԋ]3X ]ЋM3HM̃Eȉ4E܋EEËEE]] E34}Nj<1}}Nj<1}}Nj<1}}ȋ1EE]umuEU E U 1غ3 ȃuM U3Q1к3 ȃuM U3Q1к3 ȃuM U3Q 1к3 ȃuM U3Q1‰Ӻ3ÃuE }.U EMщ232B32Z32B32Z32B32Z32B3)ЃwMEu DE t&M EE 2X39uЃ<[^_]ÉE Ủe)EUEEEE&1<[^_]ËMoyUWVSsZ ~uUtbE`E}EtBtEu41ۺt 1ÍJtt5 tߋu1ɸt 1Pt t t1PuE 1ȃ[^_]UWVSY uUtbE`E}EtBtEu41ۺt 1ÍJtt5 tߋu1ɸt 1Pt t t1PuE 1ȃ[^_]UWVSX }t\E`EEtBtE]1t 1ƍJtt5 t߉[^_]UWVSdX o}t\E`EEtBtE]1t 1ƍJtt5 t߉[^_]UVSE]1t 1ƍJtt5 t1ƍJuE 1[^]UWVS<}M E}]}pE}EPEEm}EF]؉F}F‰MFUЉF]؉F}F‰MFUЉF lj]F }~ E^ N VFЉEEEEEEEEEEEEUUE9)}q ))Ǹq] ))É]E}EE <[^_]ËUtUʋEY9uEvqE )ЋU)‰ <[^_]ǁvE=t-j}]EEȉE8A]؉AƉ}A‰uAUЉA]qEYQA <}A }A }A }A }A}yENjEEEEEEEEEEEEE;M/E]Dt]T؋MX9uMq ))NjE ))E <[^_]ËE-uXUWVSMuq ))ƉE E)ыE  ))֍11}t9Ov=v=w  ȃ[^_]-=vѸ[^_]UWVSMuq ))ƉE E)ыE  ))֍11}t9Ov=v=w  ȃ[^_]-=vѸ[^_]oR zøUUeR `+E@]US6R =EE $[]USR E $$[]fffffffUWVSljU䍱\ ]ɋPE9fEE苄\ ]fU9M~Q` }Xwĉ]f9]sċEƋE܉D [^_]Ë}X8>Xv֋MD ;M~E܉D [^_]f}E^UWVSLÉЉUċU@0uЋx ǃPǃT=1ɾ1!P\ ƄXƃ9tf<ufD9uu|Ẻȉ}ȋ}M6u11҉` fƄXuЅt T)uŃ uΉ빉}}ȋM1t1U̍DPEċUP}Љuu}ЋPuu=B;Xfyf~GƉ` ỦhP` ֍PP\ ` Ủ*` EЋTX JTT uȋE̍֋UЍ ffUXEX872TFT` EX EċUPŰ@UPUPU@Eȍ< E 1UЃ1 9rE6E$EUfD<\ PEE]<)ߋ]<6Ƌ]EtD9U: ]4 D D]9}EfF9}|‹]fC< ]9{11uK: fNuEtBu|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]Ћ}tEȍpuč4C: fEĉC< ftfC< fK< f< Uȅ#=uS< }ȅt>\ 9M|<}L9t)ϋM }fWmu‹}ĉ}랋MȋE]A=)"ȪfEE1ȪEqfmdUWVS ÉJEfDrDE1E?;Ut f| f t_9u:ME19ut:9}9t;E}f| t!UE19uuƃ [^_]ÉUE1룃  f xf kUWVSljRUۃҁpuD E1uEE}?}EE9}9}9ǜ}KNY^^ FHNN)fD8mt>E|T f )f9mu‹EMEEE9E [^_]Ë}fE9t{~ | )9E fVJNNFPVV T)}؋EE  E ȹ)9fVJNNFPVV T)]ۉ߉ f~VJN~FPV )fUWU9U&MEEE9ET[^_]Ã}  ] +M9щ fVJN^FPVV U؍T) } fNVZ^VFX^ )f ډi]ۉ f ] ø+E9OfVFHNVFX^ ]؍T) }  fVFHNVFX^ )f MEf MډEEEE U؉ ;]ۉ fME  f(U؉UWVS(D ]ƉUMԋfE싆E`EЍ`ẺE|Ef ]f])9~fNVZ^]VJNN)ы]f]fL:E9iExDE:É]F‰E܋}UU؉f ])9fVJNNVJNN|:)ы]M̋ MtqUM+‰ ù+E9YfFx~~Fx~~}|8)ËEE=M`MDEE؉ f]+Ef9vFx~~Fx~~)]f]f}L8}䋄EE+` f]+Uf9#VFHNVFHN)f]f}L8E9ϋEE ù)f9Fx~~Fx~~)}fD([^_]ωMEM`/fM艎}쉾]([^_]UVS~CHPrpHPrpfǀǀ[^]Å~UVSH@ G] $ |, | 0 h8 fǃǃ f9uЍ f9u f9ufǃǃǃǃǃ[^]UWVSE]uf f HyxxPzxx )f KHPrpHPrp<xPrpш pHQPftxxu s/u!uX[^_]Ã낤X[^_]ftuutSfUVSEt.~%HPrpf[^]HPrpHPrpfǀǀ[^]UWVSEf f pHyxpPzx )fJ󉈼 ~xHPrpHPrpfǀOt=~%HPrpf[^_]ÃuHPrpHPrpfǀǀ[^_]Ã#UWVS,E< PE]} uEE싓Ex,E- +$  U= E䋋( ‰%0  E`f~ u޹ DH  9F9 >}w} fsKy{sCx{ p󉳼)}( E E܃ -E؉ fsKy{sCx{ p)EE E؉ fsKy{sCx{ p)EǍB  E؉ fsKy{sCx{ )EN􉋼}`4:u]KqssCpss )f 9}t<W~ f 9}uċM܋uaM}Rt f849ufu-fu#fu 9f8tMA,iFM荋 MV9ED$ t$|$$E荓 f9uE䍓 f9u| f9ufǃǃǃǃǃEu,[^_]É؃,[^_]LR 9E fE`\E fsCHKSCps )щf } Ǎq N ǃEf- ǃ+1 55UWVSr6 yEyU yU 4qUU u#]f9[^_]Ã} Wu3`fv`f `UWVS5 ÜƉ׉M$U=yaratA=tcidu-4$ƅt874$GE01[^_]øV[^_]É4$茧ĸ UVS5 MU Eaƅu [^]0[^]UVS4 ٯMU Eƅu [^]l0e0[^]UVS4 ÒMU Eƅu [^]"0[^]UVSE4 LMU Eƅu [^]00[^]UWVS3 M}EDƅt0[^_]É|$ED$E $tE$1[^_]]0E$txUWVS u3 |}Gt<D$UyƋGD$U$jtE 0 [^_]1 [^_]UWVS 3 }Gt9D$U ƋGD$U$WjtE 01 [^_]zo [^_]UWVS 2 Ü}Gt<D$UƋGD$U$itE 0 [^_]1 [^_]UWVS &2 -}Gt9D$U諁ƋGD$U$witE 01 [^_] [^_]UWVS1 üED$E D$E$tSEt4}D<$蠤ƋED$<$htE01[^_][^_][^_]UWVS!1 (ED$E D$E$tSEt4}D<$荀ƋED$<$\htE01[^_][^_]g[^_]UWVS0 ÔM}Eƅug|$ED$E $rtwE$EtKUD$UNjED$U$gt E8[^_]0[^_][^_]8E$Tz[^_]UVS/ óE D$E$uƉ$O=tciduE0[^]1[^]UVS\/ cE D$E$wuƉ$IO=loobt 1[^]É4$юU[^]UVS/ E$t.ƉD$E D$E$uE4$+KE[^]1[^]US. òE D$E$tUT$$X[]USr. yE D$E$tUT$$Y[]US9. @E D$E$TtUT$$bY[]US. E D$E$tUT$$Y[]US- ΨE D$E$sUT$$Y[]US- ÕE D$E$sUT$$Y[]USU- \E D$E$psUT$$Z[]US- #E D$E$7sUT$$uZ[]US, E D$E$rUT$$Z[]US, ñE D$E$rUT$$ [[]USq, xE D$E$rUT$$[[]US8, ?E D$E$SrUT$$"[[]US+ E D$E$rUT$$/[[]US+ ͦE D$E$qUT$$/[[]US+ ÔE D$E$qUT$$/[[]UST+ [E D$E$oqUT$$M[[]US+ "E D$E$6qUT$$M[[]US* E D$E$pUT$$Y[[]US* ðE D$E$pUT$$f[[]USp* wE D$E$pUT$$f[[]UVS6* =E$D$Qt.ƉD$E D$E$pE4$VFE[^]1[^]UVS) ܤE$D$uQt.ƉD$E D$E$pE4$EE[^]1[^]UVSt) {E$D$Qt.ƉD$E D$E$"pE4$EE[^]1[^]UVS) E$D$Pt.ƉD$E D$E$oE4$5EE[^]1[^]UVS( ûEU$T$UPt.ƉD$E D$E$boE4$DE[^]1[^]UVST( [E$D$Ot.ƉD$E D$E$oE4$uDE[^]1[^]UVS' E$D$Ot.ƉD$E D$E$nE4$DE[^]1[^]UVS' ÚE$D$3Ot.ƉD$E D$E$@nE4$CE[^]1[^]UVS2' 9E$D$Nt.ƉD$E D$E$mE4$SCE[^]1[^]UVS& ١EU$T$sNt.ƉD$E D$E$mE4$BE[^]1[^]UVSr& yE$D$[Nt.ƉD$E D$E$mE4$BE[^]1[^]UVS& E$D$Mt.ƉD$E D$E$lE4$/BE[^]1[^]UVS% õE$D$Mt.ƉD$E D$E$[lE4$AE[^]1[^]UVSM% TE$D$7Mt.ƉD$E D$E$kE4$mAE[^]1[^]UVS$ EU$T$Lt.ƉD$E D$E$kE4$ AE[^]1[^]UVS$ ÓE$D$vLt.ƉD$E D$E$9kE4$@E[^]1[^]UVS+$ 2E$D$Lt.ƉD$E D$E$jE4$J@E[^]1[^]UVS# ОE$D$Kt.ƉD$E D$E$ujE4$?E[^]1[^]UVSg# nE$D$QKt.ƉD$E D$E$jE4$?E[^]1[^]UVS# EU$T$Jt.ƉD$E D$E$iE4$'?E[^]1[^]UVS" íE D$E$hƉ$B=gntst 1[^]É4$c&tU[^]UVSJ" QE$$t.ƉD$E D$E$hE4$r>E[^]1[^]UVS! E$b$t.ƉD$E D$E$hE4$>E[^]1[^]UVS! ßE D$E$gƉ$A=atadt 1[^]É4$ztUEt4$zM[^]ø[^]UVS! #ED$E$xt.ƉD$E D$E$gE4$==E[^]1[^]UVS ÛED$E$Jyt.ƉD$E D$E$jgE4$<E[^]1[^]UWVS[ bE D$E$vfƉ$H@=gntst 1[^_]É4$#P$UrDžtڋUT$D$4$0$t U:[^_]ÈE<$dE[^_]UVS ˚E D$E$eƉ$?=gntst 1[^]É4$#tU[^]UVSh oE$!t.ƉD$E D$E$fE4$;E[^]1[^]UVS E$!t.ƉD$E D$E$eE4$7;E[^]1[^]UVS ýut,t$E D$E$ueE4$:E[^]1[^]UVSg nE D$E$ZƉ$T>=loobt 1[^]É4$}U[^]UVS E$|t.ƉD$E D$E$}E4$6:E[^]1[^]UVS  üE $|t'ƉD$E$3E4$9E [^]1 [^]USc jE D$E$VUT$$`G[]US* 1E D$E$UT$$G[]US E D$E$UT$$H[]US ÿE D$E$請UT$$TH[]US ÆE D$E$rUT$$H[]USF ME D$E$9UT$$H[]US  E D$E$UT$$H[]US ۖE D$E$NJUT$$-I[]US âE D$E$莊UT$$I[]USb iE D$E$UUT$$I[]US) 0E D$E$UT$$I[]US E D$E$UT$$I[]US þE D$E$誉UT$$I[]US~ ÅE D$E$qUT$$I[]USE LE D$E$8UT$$I[]US  E D$E$UT$$J[]US ڔE D$E$ƈUT$$J[]US áE D$E$荈UT$$J[]USa hE D$E$TUT$$J[]US( /E D$E$UT$$J[]UVS E$D$@t.ƉD$E D$E$UE4$5E[^]1[^]UVS  ÔE $D$-@t'ƉD$E$E4$4E [^]1 [^]UVS3 :E$D$?t.ƉD$E D$E$蚇E4$S4E[^]1[^]UVS  ْE $D$r?t'ƉD$E$IE4$3E [^]1 [^]UVSx E$D$?t.ƉD$E D$E$E4$3E[^]1[^]UVS  E $D$>t'ƉD$E$萇E4$@3E [^]1 [^]UVS ƑE$D$`>t.ƉD$E D$E$'E4$2E[^]1[^]UVS _ fE $D$>t'ƉD$E$׆E4$2E [^]1 [^]UVS EU$T$=t.ƉD$E D$E$nE4$'2E[^]1[^]UVS  íE U$T$G=t'ƉD$E$E4$1E [^]1 [^]UVSM TE$D$<t.ƉD$E D$E$资E4$n1E[^]1[^]UVS  E $D$<t'ƉD$E$eE4$1E [^]1 [^]UVS ÛE$D$4<t.ƉD$E D$E$E4$0E[^]1[^]UVS 3 :E $D$;t'ƉD$E$誄E4$Z0E [^]1 [^]UVS E$D$y;t.ƉD$E D$E$@E4$/E[^]1[^]UVS x E $D$;t'ƉD$E$E4$/E [^]1 [^]UVS %E$D$:t.ƉD$E D$E$膂E4$?/E[^]1[^]UVS  ōE $D$_:t'ƉD$E$6E4$.E [^]1 [^]UVSe lEU$T$:t.ƉD$E D$E$́E4$.E[^]1[^]UVS  E U$T$9t'ƉD$E$}E4$-.E [^]1 [^]UVS óE$D$9t.ƉD$E D$E$E4$-E[^]1[^]UVS J QE $D$39t'ƉD$E$E4$p-E [^]1 [^]UVS E$D$8t.ƉD$E D$E$UE4$-E[^]1[^]UVS  ÔE $D$v8t'ƉD$E$E4$,E [^]1 [^]UVS2 9E$D$8t.ƉD$E D$E$E4$R,E[^]1[^]UVS  ؊E $D$7t'ƉD$E$HE4$+E [^]1 [^]UVSw ~E$D$a7t.ƉD$E D$E$~E4$+E[^]1[^]UVS  E $D$7t'ƉD$E$E4$=+E [^]1 [^]UVS ÉEU$T$6t.ƉD$E D$E$$~E4$*E[^]1[^]UVS \ cE U$T$G6t'ƉD$E$~E4$*E [^]1 [^]UVS E$D$5t.ƉD$E D$E$j}E4$#*E[^]1[^]UVS éE $D$5t'ƉD$E$~E4$)E [^]1 [^]UVSH OE$D$15t.ƉD$E D$E$|E4$g)E[^]1[^]UVS E $D$4t'ƉD$E$\}E4$ )E [^]1 [^]UVS ÒE$D$t4t.ƉD$E D$E${E4$(E[^]1[^]UVS ) 0E $D$4t'ƉD$E$|E4$O(E [^]1 [^]UVS ՆE$D$3t.ƉD$E D$E$5{E4$'E[^]1[^]UVS m tE $D$W3t'ƉD$E${E4$'E [^]1 [^]UVS EU$T$2t.ƉD$E D$E${zE4$4'E[^]1[^]UVS úE U$T$2t'ƉD$E$+{E4$&E [^]1 [^]UVSZ aE D$E$MyƉ$G*=gntst 1[^]É4$tU[^]UVS E$F t.ƉD$E D$E$myE4$&&E[^]1[^]UVS ìE $ t'ƉD$E$$zE4$%E [^]1 [^]UVSS ZE$ t.ƉD$E D$E$xE4${%E[^]1[^]UVS  E $k t'ƉD$E$yyE4$)%E [^]1 [^]UVS ïE D$E$wƉ$(=atadt 1[^]É4$ btUEt4$aM[^]ø[^]UVS, 3ED$E$`t.ƉD$E D$E$wE4$M$E[^]1[^]UVS ӂED$E$Z`t.ƉD$E D$E$4wE4$#E[^]1[^]UVS l sED$E $@_t'ƉD$E$wE4$#E [^]1 [^]UVS  ED$E $_t'ƉD$E$wE4$;#E [^]1 [^]UWVS E D$E$uƉ$&=gntst 1[^_]É4$M P$UDžtڋUT$D$4$ t U:[^_]ÈE<$E[^_]UVS" )E D$E$uƉ$&=gntst 1[^]É4$ tU[^]UVS ̀E$t.ƉD$E D$E$5uE4$!E[^]1[^]UVS m tE $t'ƉD$E$uE4$!E [^]1 [^]UVS "E$t.ƉD$E D$E$tE4$C!E[^]1[^]UVS  E $3t'ƉD$E$AuE4$ E [^]1 [^]UVS p wu t%t$E$tE4$ E [^]1 [^]UVS( /ut,t$E D$E$sE4$Z E[^]1[^]ffffffUWVS ~E 0Ft%uFt$-4$%1[^_]Í <$葎Ft<$肎1[^_]Ét$ $<$^FUSB I~D$ $D$ $1[]US ~EU 9t8J 9H u(Rt<@t-T$$~[]1[]ø[]ÍˍUWVS Ð}u F tPa|$E$u 1[^_]ËFD$E$ t|$E$[^_]ÍaD$E${[^_]US }E @tUT$$}[]ÍD$ D$D$o8$US ì|E @tURtUWVSU\yEtw} |$ ED$D$$ƅxEH $Mr…t1|$ ED$ML$$UmU1[^_]1[^_]ÍD$ (D$D$E8$UxUT$ِ$]UVSqxxut4$ӽ[^]_UWVS 5u֋E& tЉD$$>u1 [^_]ËU tD$$uϋE&qD$$u럸 [^_]UWVSu} F t*19^ vD$ 4$u1[^_]D$<4$|u1[^_]ÉD$4$btȃuE >u[^_]>UVSu] D$<4$ u 1[^]D$/4$ttD$4$t̃uD$>4$tE u[^]UWVSu} F t*19^ vD$ 4$u1[^_]D$<4$etu tD$4$BuD$/4$,tD$>4$tE u[^_]UWVSl]`< tD$$u1[^_]ÍD$$tD$ $[^_]US\gl]D$$$tD$$N[]UVS&l$mƅt'$[tFFF [^]É4$V1USkE$5[]UWVSák]u}E E $EF t|Jvt/ut!1[^_]ÍBFrEPF(F ǀ u( t&/t&t>tt tJwՉ)‰VM t%]9u\$D$E $]e?/F$<>"G9tHv~ u#) t$=t&t tJw׉)Vx"xPVHЀ"u"uxzF(F(`F$>RFFFF ~%]D$ D$D$$1[)щN x>FUWVS}E@tJ1u t 9v8u t(<&upatluAxt1[^_]pmpuxou߀xsuـx;uӃ'놀guxtux;u>hquxuuxouxtux;u"t7։>t/uE$辻EE[^_]ÍPEP0V(EPUSdE$q[]UWVScUEy:$UUD9uH9/t9wY/u9t 9t8/t)Ѓ=;փ.ƄfDž.U$oH UU/.pl@istX@XXXXf@ X<$ƃED$E D$4$j9EL84$l$Y/81[^_]?1[^_]1[^_]äƄfH1[^_]É4$kF$`lj$Vׁ|$4$n4$kUT$$EDPt:9 u0H 9JƄt1@ƅtptC[^_]ÉUx<$%P1ɋUƅtpt<$P[^_]ÍD$ DD$D$X$UWVS=u ~tPa|$E$u 1[^_]Ãt$E$ t|$E$n[^_]ÍD$ tD$D$X$LUSRY=UB4tB4R,…t8$[]ÍD$ D$D$X$D$ D$D$X$辭UWVS<}Gp4$NGt'9uG@D$ D$D$X$$UVS)0:E 0t$, $pF,v D$ D$D$HX$詞+D$ D$D$GX$US蔲-EM t 9t[]Åt`9uM []_USDK-Et 9t1[]ËM tM 9uL$$?U -Et`9u]1]U,Et`9u]1]US譱ô,Et `9t1[]ËM tM 9uL$$UWVS dk,}*t^Ɖ$ft4|$4$P t$4$tE4$PE [^_]Ë$荃4$31 [^_]1 [^_]UWVS ܰ+}U uFt  [^_]ÉU1wtF$Ut [^_]ÉUM$zMUt E [^_] $USMT+D$E$^[]UWVS%+E$t[Ɖ$vpD$t$E $DŽt4$e[^_]pU4$IpU[^_]1[^_]UWVS蔯Û*E$!t*ƍD$$lj4$[^_]1[^_]UVS<C*E 0FuFt$裁4$蛁1[^]US*EU 9tH ;J u@uu;Bu^[]1[]ÉL$RT$$F[]Í@D$ hD$D$h$eD$ hD$D$h$;UWVS?F)} W ED$E$cwG EEpE8D$M $U}D$E$ͷED$E$讷trmEV0MM<NʈUV?UMD$E$@.1[^_]ÉD$E$j[^_]ËE>}FMu0u&Ɖ[^_]Åu2[^_]1[^_]äftt鍃D$ XD$D$h$ŐD$ XD$D$h$蛐U豤¬Et9u@]1]USyÀEt 9t1[]ËM tM 9uL$$tUS 29Et 9t1 []ËM9H uU tL$M L$@$腈 []UWVSգu~$u7Ft=D$ T$VT$$-t V [^_]ËFD$U$11YtՋEH $MmDžtFVT$U$M$E9ED$D$4$]uE$CmT$$EͬE@xp U icD$ED$F$舖Et|UF F9:"D$ @D$D$h$)<$t[^_]É<$t$rlT1(b8"ft_E<$jtE%1UܡEt 9t1]ËM tM 9u9]UVS萡×t$H $yƃP t$< $`ƃD 1[^]US=DE xuriD$E$耮[]Í,UVSu\D$$.u< 4$ռ[^]ÍH UVS諠òut9u4$蘼[^]1[^]U~yEt 9t1]@]UUPEt 9t1]@]US#Et 9t1[]ËM tM 9uL$$UVSԟuFt [^]À~$tD$ ,D$FD$F $u_D$ riD$FD$F $tW\D$$g-< 4$HE 0[^]Í\D$$0-H ǍD$ XD$D$0$ϊffffUWVS˞ƅur$@iDžED$E<$蔨ED$G$+EG,w0G4G8G<[^_]ÍD$$qlEEt#$@hDžMq $p1USE$*E $*[]USŝPt:9 u0H 9JЃ[^_]úrD$ D$D$$݇D$ D$D$$資UWVS跛þE 0F4N09V,tdtd|ED$D$ D$t$E$tDn4E 8[^_]Åt\(D$ D$D$e$[^_]É$wmF$'4$dm1[^_]Åt?E 8[^_]ÍD$ D$D$d$|D$ D$D$u$RUWVSV]ljEp,uUD$$fhtYUtt 9t%$$ [^_]ÉUMGE$F!UNjE$/!Ut$裰ME [^_]D$ D$D$$$1%UE]UWVS}9GE$ G4tMG4t=1M<B,U8$E茯MQ,E:UB49rɉ׉A4G8A8ME$) Mȃ[^_]1ɉȃ[^_]UE$2t`8]UWVS ut 9t 1[^_]Í~<$v0<$[^_]UWVS蹒 ut 9t 1[^_]Í~<$fv4<$[[^_]UWVSho ut 9t 1[^_]Í~<$E 9F0r<$[^_]ɉUWVS u~<$t_9UuRD$$`t:HHE4$賭EpU9u%@V

17UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1M9|$vFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$u{9r92)|$ȉ뗅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ щL$D$\$T$ L$t$Ӊd$D$$9rAt;+t$$L$ D$L$L$ L$ډD$9sy+D$T$$D$1fffUWVSM]u D$ \$y كۉ\$ˋ}D$u9v2։1 M9t$v:ȉL$ t؃ڃ[^_]Åu 1t$É1뷋T$ƒD$u,9r9w)t$]U ] u D$ O T$)ЉD$ыT$L$ щL$D$$T$ L$t$$$9r't!)L$L$ 9s+$T$։UWVSM]u D$ څy T$ كۉډˋED$u9vJ19v11L$ t؃ڃ[^_]uR9r ;L$ȅu 11҉NjD$]U ] u D$ U )T$ډL$ щL$$T$ ֋ $t$щ9rt13T$9s11UWVS8迀Eu Mt Mtxt|xHUPT$0PT$,P T$(P T$$P T$ P T$P T$@D$|$L$ ED$D$4$bt8[^_]E11{EtۋE8[^_]USM] CfACfACAC A 1T T u[]US]M CfACfACAC A 1T T u[]USM] ȉCffACffACAC A 1T T u[]US]M ȉCffACffACAC A 1T T u[]UWVS4~}u ?Mt E<$ ?$t4[^_]À-uFD$0FD$,F D$(F D$$F D$ F D$F D$FD$FD$FD$ t$D$<$uN uFx,EtEtED$4$24[^_]Ƀtʃt$T$4[^_]ÍD$0E'|$,EW9t$D$sE"t$T$4[^_]UWVS3\6EU uM] $\$M] Ǡ ,}}$}M] $\$M] [^_]EUWVS EU ]\$u}M] $\$](]M$M $\$M]u} L$ [^_]UWVSPw[~D$u[^_]Írt :u>ut2E8:t*0|$ D$D$,$X?[^_]ÀxF_>t%l [^_]Àx:tV9M:E8:tCbh|$ D$3E l ǃl v:US HØD$ D$E$ []US[HbD$E$](]]fUS-H4E$1[]UWVSH D$}Et|tAt wG W9w2G 1҃[^_]É]E G wW9vߋwMx_);M E|jE G W9v멋E E t\$,D$ dD$D$8$.3E Uy\$H\$T/\$#D$ dD$D$8$2UWVSFEH 1ҋu1׉u}9}EE}E@U29w|)ȉ‹E9wI<u sKu.u&]K K [UR9w [^_]ÉftЉ<u ru^uf뜍GD$4$4ƅtYE@)ǍD|$D$$E0]ECK 7Pf뉃JUWVS yEÀuE D$$‰$Dž0E GGG D$D$<$t7D$$E4UЃ [^_]n1҉Ѓ [^_]ÉETM<$ $2MU#8$ 81US 8D?E D$ED$,X$n []USDED$ E D$ED$,X$n[]USCʾU ML$ D$T$E$S[]USCÍD$ D$D$E$[]USKCRU D$ D$T$E$[]UVS CuD$D$ D$D$4$2Ht [^]1[^]USBþED$ D$ E D$E$][]UWVS|BÃuE D$4$~7cF0u D$4$d[^_]t*F0uҿF0fffUUM EyEM EB]UWVS u] }u6)t2yD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVS[AbE0x$tu[^_]1[^_]UWVSA%} tE}st+fp f@UPx$MH,UP(UPDUP [^_]þEu}1UWVS @ê}u$ ‹EE Bzr EBtCtpE tZCE &CEUUtnMfH f@PM H$x,p(@DCP [^_]Í&CE뭋M tCE E딉UU$A1 [^_]1UWVS?åUB0~4r,txM q J$tE D$ E 0xt$|$$o[^_]US ?ED$E D$E$vu []US>ED$ ED$E D$E$t[]ÐUWVS$>òuED$E $GEP5F fJfF D$ED$E$DžEEF FFFFFF0tN@9t $iF0ǀǀ @$7F0ǀǀEt9tD$<$WEfF f~vF$F,F(F E$[^_]èHV Ff"UED$ED$E$\DžUUEU9}F$V F F$ qHD$ D$D$4$$[^_]EEt8t,8t"vEc<$i}F$V D$ED$E$^됅yF$l4$4$P1<$g1pfF OM1YUVSt;{uf~ tzD$4$[F0tN@9t $ F0ǀǀ FFF t1FD$4$(1[^]ËF UWVS:ѵUB0~4r,t} p J$t} Lj $ M Q!Ѓ[^_]UWVSO:VuD$4$=nx$P8D$4$F[^_]É4$US 9ED$E D$E$  []US9ʴED$ ED$E D$E$[]UWVS,9ÐEt8uj}ԉT;$FtFF )t$|$$,[^_]ÉEԉ$yE؍rEEu}˄ws끋uU8ųEx9]Ë]Ís]UWVST8É}E uu5uM tV9utRD$2@D$}<$<$PEt;UED$|$E$Uuqx<$IPEuŋEu+0ЃT[^_]Ë@E >tSFML$$Cu|$ W L$ (D$D$2}<$<$PlU9\ʜffffffUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UE@)@3U u@ @]1]USEU ]xuQwLHtCu?HH LZYZYR Q X SP ҍ1[]øUExuxw1U ]ø]UExu@ u<.w]ø]UUM zuB u<.w~ 9| D ]1]UExu@ u <.w ;E ]ø]UEu E D]1]UWVS 4uU }Euu0[^_]ø]ɘUUzuBu :Br]ø]UUM zu#Bu:Brx9s D ]1]fffffffUS 2ôtu []JHT$D$$ []UE ]UEUJσw@)P U 1]ø]UWVS]M4{ }}9+E1|!})1׉;>EE 8th@‹Mϋu sftftu+EP)‰׉;>+US 1[^_]ø[^_]ø‹Mϋu ruu&넍s*yPfUWVS]M}w~4{ 9t~)1UD!ЋU+U1UU֋E M )Q)ʉUEUE)C [^_]1[^_]ÍsuUVSU] z)uGB1w<v5J q 9r#L t18tP9r P9s[^]ú9rB9v$8tP9rP9[^]UVSM] y)uGAPσw<v5Q r 9r#T t18tH9r H9s[^]ù9rA9s+0;ut)tH9rH9rع묉1UUE ttuB]ø]ø]UWVS.EEEuM<ٸ9E|0)ߋU t;} whEtfEEtlt5PKHKL$MD$$U]UM MPU [^_]ÿ[^_]1vUWSE]~OSt<);U www؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSU E]tvuqUt6E9vt0u0H9r HD9s[^_]ËEŃp9rxD89rЋU U:3+E[^_]øUWVSU EutoujUt=E9s t7H9rxM9s1E[^_]ËE뾹M9rω8t E렸˃U:uE+EUWVS] UЋ}uރstft[^_]uuBfUS*ۥD$D$ED$ ED$E D$E$蕮[]fffffffUWVSTx*Ɖ5M1ƅD$D$D$D$ D$T$4$$t,DžM+T[^_]Í11  rFDžDžD$ T$U9D$<$"stjƅD$D$D$D$ t$GD$G$Fut$$tu<$%"$"Dž舎UWVST(ڣƉ5M1ƃ ƅD$D$D$D$  D$T$4$xD$D$D$D$ D$|$4$4;DžDžDžDžDžVDžDžDžT$ D$U9D$$ tjƅD$D$D$D$ t$GD$G$Qut$$thuGtLD$ D$(D$$$1U+u)T[^_]Ë묋$LUWVS&ÞEE EE5M1ɅD$D$ D$D$$eWD$ D$D$$`t6D$ D$D$$u(dƅ3$ªD$$D$$pl$zD$4$62$@$2豁t&tw$R$t$D$D$4$hU+BĈ[^_]Í @$6- u,D$$JD$/$pt(D$D$$[PD$D$T$D$ fD$t$$D$ D$P$耆$衺@D$ D$@$O$p$ D$'$$8@$8u 1D$/$D$|$ \T$D$$ɿD$D$T$D$fD$ ?D$t$$~D$D$T$D$fD$ ^볋D$ D$$ D$$ D$$螄Ɇ D$0$w$蘸UWVS Eh5E1p ׉lfDžpD$D$$QxKfDžrlT$$7x1rfhE+u=Ę[^_]ÿl<$膥l躅UWVS  EhU5E1pl } t.} tn/E+Ę[^_]ƅpt BtE qD$D$E $Džy2ƅptËBxB |BEBEfDžrlD$<$xrfh=l<$6liU D$E D$E$]UWVS×ƉtE|E xE5E1DžDžDžDžL$D$$FǃSDžDžDž,D$FD$$vDžD$D$<$_FD$FD$<$艢^<$虢808=~4$6tDž.8#tf\$)v D$D$$U+pĜ[^_]ÃP$똋F?ƅD$D$D$D$ |$FD$F$|$i$8vƅD$D$D$D$ |$FD$F$u!|$D$$LD$D$<$D$D$<$A$KD$ @D$dD$,$8D$FD$$DžD$$ D$ WD$D$$"$D$D$<$6$9fDžfDžD$D$$,D$L$4$4$ҋk<<4$D$t$<$-|4$D$t$<$ x4$~D$t$<$D$D$<$D$D$$D$D$D$D$ D$D$ $qu(4$Y=4$Y=$t$h<$`PD$D$<$Džx${4$뗋%D$t$$ PD$t$<$螛t2p$z4$螜1tD$ِ$z$y^|$gzDžUWVSl}EEEEEEEE5E1E fD$ YD$D$ UЉ$U?EEEEEEM MEEML$ D$UT$$ukEPt%D$T$ $UUEML$ML$M $M;NjE$E+u1l[^_]É$D$D$~$6{UD$ED$ED$ED$ ED$E D$E$h]UWVSlDKuEEEEEEEE5E1E fD$ YD$D$ UЉ$UEEEEEEM MEEML$ D$UT$$ E@t"D$D$ $UUYD$$ tM 9Ht?ED$ED$E$MEwƋE$% E+uhl[^_]Íݎ$D$ ED$ED$E$ME 뭉$ D$D$~$ ;yUD$ED$ED$ED$ ED$E D$E$ ]UWVSJMEdE TEPEX5@]1D$pH$肢DžLDžDph ,` ,\dD$ D$D$h$ D$ h4$Sp< `\ l4< t4nЍLDSt l< F< uȍV< t< tщ< u Xvt < u;h>uPp<+<-pq<@[LDH\$ D$D$r$؉DžL<+tr<-:lt$X$Ќl@81FF<@lFD$zqS<@0LDH\$ D$D$r$DžLhUTd J4$ u6F<@f lFD$X$}؋llHD$ XD$D$F$%lltbqUTqUT؉E@M+ [^_]DžL1lHD$ XD$D$F$J؋lUTDUTDƅpsUWVS4;E,E(E<5E1ǃ U@D$D$ D$DD$<$ǰ@D$@ D$4$&D$D$4$豊84@@ $`@P T$$Gc@@$RD$4$V0t$D$4$D0|%= $C8$蕼4$觼E+{[^_]þōRD$$…tG(D$yZ]}3}3}3}lj]1Ӊ!1׉u]yZE|3tu13uƉ]3]!3u|yZ։U3p3U3U‰ӋU1!3UxEyZډډUt3Xh13]É؉11t‹En؋Up3P]13|‰13]p nˉӋUX3M3M3xM11MM9nMP3}3}3tlj}11߉}}7n}u3u3u3pƉu11Ήuunu։U3U3U3U‰U11UUnU‰E3h3|3EE11EEnE؉]3]3x3]É]11Ӊ]] n]ˉh3M3t3MM11hM9nh}3}3p3}lj}11߉h}7nhu3u3u3uƉu11Ήhunh։U3U3U3U‰U11hUnh‰E3|3E3EE11hEnh؉]3x3]3]É]11Ӊh] nhˉ|3t3M3M|11h|9nhx3p3}3}ljx11߉hx7nht3u3u3uƉt11Ήhtnhp3U3U3|‰p11hpnh‰E3E3E3xE11hEnh؉]3]3]3tÉP11։h nM3M3M3pM ӋP!ى! ˋM9ܼˉ}3}3}3}lj} ȉ!׉X!ȉ }Pܼ}3}3|3hlj} #X! }ܼ։׋]3]3x3]É] ӉP!É! ڋ]XܼډډM3M3t3ME ؉!! ȉEEPܼEȉM3M3p3MM !މX! u>ܼ׋U3U3U3U‰U #X! uܼE3E3h3EE !! ؉EEXܼE؉؉M3|3M3MM !X! ً];ܼى׋U3x3U3U‰U X!Ӊ! ڋ]3ܼډ|3t3E3EE !! ؉|EXܼ|؉ˋx3p3M3M| !X! ً|;ܼى׋t3U3U3U‰x X!Ӊ! ڋx3ܼډp3h3E3Et !! ؉ptXܼp؉ˋM3M3M3|M !X! ً];ܼى׋h3]3]3x‰p X!Ӊ! ڋp3ܼډE3E3E3tƉuΉ މ!Ήh!Ɖ ؋uXܼ؉΋M3M3M3MM ֋h!! ً];ܼى<X}3}3}3plj} щωP!!щ }h7ܼX]3]3|3]M !׉! MP9ܼߋX]3]3x3]É]11h]bhU3U3t3U‰U11hUbhU3U3U3U‰U11ډhU bʋhʉM3M3p3MM11hM1bʋhhE3E3E3EEh1މ1Ћu>bU3|3U3UƋh11ʉubډXU3x3U3U‰։11‰Phb]ډދ|3t3E3EX1E1؉h9bNj]]x3E3E3E]11ЉxˋX bȉȉt3p3U3P‰ӋU11t3b|U3U3U3h‰Ӊ11‰X};bډډUӋp3E3E3xNj|1ډ1pbȋU<}E3E3E3t‰1E1ȉH|:bMȋMM}3}3}3XljM1}1ωUbˋ}}}3}3P3pljU3U1ljM1bNjE3E3h3H‹E11؉UM bЉE3E3x3E11EMȋMbʋEȉE3E3t3Ebʉ11E3E3X3Ebʉ11؉ME3E3p3Edbu11ƉƋE0`X\xMlH LPT5}+8u Ĵ[^_]ËTXKUE#Eg@@ܺ@ vT2@@@]UWVS EPEЋMAs EA?JEЃ?v|@)ЉËu<u uyUEHL$$U);Mu} T$4$qڃ@;Ur)]] Eu<u sCtft [^_]äfzuZuAUuLuT] EDE|fE pCfUWVS$^E}}] 5E܋8}11u1҃‰уTuD$}䍇D$$ C%=t)D$|$$C%=uD$t$$Ut#1у4 uߋE܋}+8u$[^_]Ë]HffffffUWVS(]E؋}u 5Eԋ]1ۅtX|$}܉<$]i1 F TFuF(}ԋu+7u([^_]$)]責ƅt둋]GUWVS18]uE E}5M1ɍ $sD$@4$SfE ES1;1;EEE=TD$|$$eD$|$ $;uE})EUE Eu0$rfء0D$ $U+[^_]øG葡0$f|0t1D$ D$|$$Ô$e1sD$$ހt΋ptEUyEEUD$D$D$D$ E D$E$]UWVStZUUEE5E1u4$DM L$UT$4$ED$4$M+ut[^_](EfffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8XpuH MPUHMpuPUH Mp$uP(Up,uH0MP4Up8u@<|E\EHp@ URl1p1‰x\ l‰T ωh11׉tp߉` 11Eh d11Eh  11؋UPd 11U 11} 11u  11]  11E  11M 11U 11} 11u 11]  11| d1lj!3d}9yZЉX 1!1}:yZd X1!1ڋ}8yZX 1ljd!1NjtyZ  d1ʉ!1΋UyZ Ƌd 1!1Ӊd]yZd  1!؉X1|9yZ d1!1}:yZX 1!1ڋ}>yZd ljȉ1!׉X1xdyZ d 1!1΋EyZX d1!1ӋEyZ ˋd 1!؉d1}9yZ  1!1}:yZd 1ىʉX!1ڋMdyZ  X1!1NjMyZ ߋX 1Ήdu3nd  1Ӊd]nd ˉd Ӌd 1]n dӉ 1]nd 1ډdUnd dЉ 3d|n  X1΋M n dΉ L1ËtnX d d1UnL d 1Und 1ډdxnd  1ljd}>nd 1Ήdu3nd 1Ӊd]nd  1dEnd 1dM nd 1!1‰dtܼd  1׉d!1ω}>ܼ<0  1!1֋Eܼd 1!1d]ܼd 1؉X!1x9ܼ d1!1ً}:ܼX 1!1‹}>ܼ d Ɖ1ЉljX!1ϋEdܼ 1!1֋Eܼ X 1!1d]ܼd 1!1dEܼd 1!1ىd| ܼd 1!1‰dUܼd 1!1ȉdEܼd ։d1!1֋Eܼ d1!1ËEܼ ˋd X 1ߋENS  d 1xNSX 1ʋENSd X׉ 1‹}d>NS <d 1};NSXӉ ׋d 1؋}:NSȋd d 1‹}9NS  1ʋ}>NS d X։ 1Ћu7NS ։ 1t3NS X d 1ËuX2NS ˉ Ӊ 1֋]NSd щX 1]dNS X L 1ʋ]NS߉ H ʉd1|NSL@ DpҋT ы`1ً\}>拢Plыh 1ϋu2拢P p׋PЉ 1E拢P h 1ډh‹x拢Ph  X׉ 1֋}8拢P  1}9拢PX h 1}X:拢Pى щ 1׋M 拢Ph щˉX 1Mh 拢PX 1ډhU拢Ph މh1֋|拢P XЋh 1]拢P  P 1t拢PXh Ӊ 1ϋUX拢PP h1U拢P h Xщ 1ڋM拢P 1щ!1ދM$M\ X h1!1ЋMX $M\  1!щ1M$M\h 1ΉX!1Njuh3$M\ h1!1ˋx2$M\ X 1މ!1u0$M\h 1׉X!1ދ}h8$M\  1!1Ћ}9$M\ X 1h!1}X:$M\ 1!1Nj|$M\h 1!1ˉh]$M\h  1!1hU$M\h 1!1މhu0$M\h 1!1ЉhE$M\h 1h!1t$M\  1!1NjU$M\ h h1Ë|>pm  Љ 1ʋE>pmh ׉ ։X1Ƌth8>pm 1؋}9>pm X 8 h 1Ћ}X:>pm؉ Љ 1E>pmh X 1ˉ؋]h>pmX hЉ 3hЋU>pm0 Љ 1E>pm h 1ىhM>pmh h ыh 1ЋM>pm hщ 1M >pm׋h X1ˋM >pm  hщ 1‹x>pm X 1M>pmh ؉Ӊ X1]h>pm 1!1ЉËEvmz;X 1h!1Evmz h1!1ˋEvmzh 1!ډX1‹tvmz  h1!1EvmzX 1!1ًEvmzh ׉1!ȉX1|hvmz؉h 1!1xvmzX h1!1ˋUvmzh 1!1‰hUvmzh  1!1hu1vmzh  1!h1ً]vmz  1Ӊ!1Ћ]vmz h 1!1h};vmzh 1!1ˉh]vmzh 1!1‰hUvmzh 11MΉ4 11| 11}  11]  11t  11E 11M 11} 11u 11]  11E 11M 11x 11} 7 11u މu d T}wpDw13E] lHىO D d@1ًLu0NS\HuO `ډĴ[^_]UWVS]CSƒ?@)ЋM41s{s{9w[uf}?v/1@} D$$#v@9us1;Es/)EE E|u sltft[^_]1;Erу[^_]ÉE|u sfEuTEuKEUCD$$U)9uEr} `uTu;xfEtfuKu1MEtffmM qHMUWVS87A]} 5EM1ɋGWEU?@)ƒw)ƒT$ D$<$ D$ED$<$t(OSSs9uݺ\1u.u4tftEM+u[^_]ê[tfʼn*UE]UU f%f=t1]ÁE ]ffL$$Yai qyD$A(tQS[?RjjH [1Í&t&L$y(tQS[Ý?jRjG [T$D$ Zbj rzu@ $fffD$$X`h px1Ít&T$D$ Zbj rzu@ $fffffffL$$Yai qyQS[>Rjj.G [1Í&L$QS[>jRjG [T$D$ Zbj rzu@ $US yÀ>ED$E D$E$/ []USHO>D$ D$ED$$6F[]US >D$ E D$ED$$MMMEM <wE)Ѓ9uEEED$D$|$ ED$D$4$6؃,[^_]q8 uEƀUGUWVShÊ;8 ut$$8 @B1NjEEE1EUME1ȋ}Gt$$xx8 @B1Ƌ}E1UBME1ȋuF D$E$8u(8 ]ٸ@B1E1؃h[^_]øh[^_]$'*8 UWVSZa:D$CsD$E$fguEǰ+@t&tD$E$6u܉[^_]D$`D$E$gt 1[^_]ËEpD$MD$4$fE@<-u?EP ,DPtEPD$ ED$$U$MU9p9g^My+th)ƍF߃1BD$D$4$(fE@t<+ !M?!U»8E?w°+t u]Ë u@u1]U聽x8EP>w °+]1]UWVS(AH8u}܉|$D$4$UxFNE uD>wg5EظыE! MD$|$4$T([^_]Ã>w05EظE ed}W}UWVS~Å7u$D$ to,D$D$` <$y)@ ,t@@ [^_]ÍU T$ t$)‰T$$y뵍ِD$D$` <$蕅fffffffUS=vNotvcuu<ɐtg Ƀ шH@}+tr}-tr}=tr[]Ã+t-ut(#MH[]ÃXtguԈu@] X밋M #MH-u P+뮉H딀H뎀HUWVSEu I@Mgt&=-XuUt pguډ%+t[^_]ÀouuPӃt>Mt }#x!t }#x!t }#x!rt #X t #X ރI#H ΃?lP!փ&EjUWVS`ƹ4u>(EEEE}|$EԉD$$<$ h$EgD$|$$4u [^_]D$$a$4 [^_]Ë$4FuEx+uD$$`D$$`F$3Ex+uUWVSRY)lj֋E8rMD$t@G$^EGF$r3MUVN ` ` [^_]Ë$^EFG$33UMUVS(ϭ(uU EZEt\d.5uZ]xWJ`ƃtQ]WEU $U d.5E@EE([^]Ë]썃$@8듍EU D$ED$]썃D$ \D$&D$1$F$uD]m05Wd.5t]썃$7E$]+E$1E$1Km0EE([^]Ë]썃$p7UVS[Z'uUEEtPd.5]^tnt7EU$UEd.5E@EE[^]ÍEUED$E D$E$]0$BC]el0d.5t]썃$6E$]}E$0E$0l0EE[^]Ë]썃$B6 ]썃$,6+UWVS&Ud.51` 19VuM$\^MEEak8D$ED$F $ǃtщ4$|}[^_]ÉM썃$Z5` UMTt$25j뫍$5V` ?4$t|UWVS\ݩ$E}|$ ut$E D$E$Ht$t$E$sYƒЃ\[^_]ÉEEED$$wUt։|$ D$EE D$E$THMtZEEL$ME$YƒMtU ${UЃ\[^_]ÉMi8Mt9uWEE뤉M$M~9E~ωL$$X‹MffffUWVSP裨Ƣ#EE E EEEE}~ E0EE tE}HGz;EGEkMddeEUMEEE m|EE$1h8UԍD;E  }0C]XEUM]L$\$ $T$_%9}uӉEUM܋]ىeщٸ9и| E ED$ExD$ED$Љʃ2D$dD$ $T$$}؉׉ʉD$ T$D$E D$E$ip;} P[^_]ÍE/EE#*E EE +EԋUUȃn}u*D$dD$ EU$T$#EUED$ED$ED$]؉ؙMʋEe}SEQ%M]EU)+EUEUEEEEdEtExd1҉s΃ẺUЋE̋U9E]"1}EUM]L$\$ $T$"EM̋]9ȉ}uȋ}EUEȅD]U]EdEUMMw$dUԍD;E UUEEBf~uU)E4$jUtsuփWQuRN>w2MϋMM}R tUUw~1҅ډЃ[^_]É)Uu$OrЃ[^_]ËE$jEUMt>MUt$D$E$TMU+`v J}B FۋrUWVS(/DdhpE\} uElEX5<M1f_9r9f>*uf~*u1f~*@DFP;\XD$lD$ PD$|$\$phdrhfDžHdf8D$D@D$T${Tl@ @T $P ``l@ @DaTt4p8`$TЅ$lS t%XYLYL x .& h;pHfKfu9pH@u5l4d#6|%= P\hS;8sfC/fXD$lD$4$pddhfDžPDž@DžHdf8tldIu|%=@tn1ɋ<}+8ȁ[^_];PXf?D$lD$QG$phddf5TэUF9t3狅T$D,``?lpt=1dATD{[D$T$օul@ @T@`x .Vxfx.Apf8` p`$@lPpl@ 4Y\f9.k@k\hCSXD$lD$<$pdlP @pD"ZpND p+lP 1G=6vDYh/lP DsUWVS辘`։ϋUE dE\5pM1fhl1 fy9v7fFftYf/uڅtQfF/f/u%9wp}+9İ[^_]ftLhl맅t:\D$dD$ lD$T$$h`|ftld‹`u{dP t"\HhHht$f~/t|%=@=t)d@\‹`%11ɍX`JfhhuNX@tSlL$$dP(u|%=@q9v/^uNlL$$ $W/.UWVSD=D׉5]1pf~ fb"f*ff ftFf?f[uZىX!Gf>Vf[ fuffW uAO f?TW рO N;t fx*4f*΃!B f7f/-B9uݸ2\$|$$]+.D[^_]Írfzuf[VpV f f]uf[!u Xf@!Zf]tIډˍKf%f2f-uBf]ifC-Kf%fCrZf]u։ځO Af]mD$D$ D$D$$76P f9sQfPfu98t6P9fx*P9fx*W ; >T$ D$)L$GO$$4…?D$D$ D$D$$15nGu^ f[!)Z-efP94UWVS9։)ӉσXPft:1ff}tMCftf[tHf{uCfuM u1[^_]Å~릍sCf]fu돍ZJf]$`EE Eƅk}D$tD$G$k[DE$uCD0f|$UDž|I$M|UE$$CDž|E`Džd[E@D$P;U v"4$E [^_]Åt1 } 9r1D$ <$.x ǃ| >84$US}E$T-ǃ| []UWVS8}ãD$$D$D$D$$D$ |$(|$D$@$/t:M w:E t(D$411\$t$ l$Uƒ9w؋E e[^_]ùUWVS |H$tǀ8u^UD$L$ D$D$ <$VFUE tE 0 [^_]D$ ED$<$UE@9MU։ED$ $tuME e|$o$LuD$$6u|$R$$ut zuG<&w⍃뒍@E0E;M[_$EfffffUWVS8z5M111 r D$ D$D$$s T$$`D$\|$4$D08t߉ 8#mD$\|$4$Dt8t㉃ D$\|$4$Dt8t㉃ D$\|$4$lD8t߉ ǃ ǃ D$\|$4$1Dt>8t$Ϻ D$\|$4$Dt8t$褺 D$ D$4$/T D$\D$$Cƅ8tщ$@9uċPtP >t|$$Vuቻ ?xuxu U+8[^_]ÍdD$\|$4$B.8t߉ 8#kD$\|$4$Bt8t㉃ D$\|$4$B8t߉ 8xuxxu x 8sxwx} D$\|$4$"BtM8t$ D$\|$4$At"8t$蕸 ue D$D$H$bpQǃ BT1mǃ ǃ _T$$puUVS vÚ tut [^]ǃ RD$4$D uEt$2$EUWVS v uǃ t1$nst$ $tMu [^_]ÍRD$<$C u͉E|$2$E뼍 [^_]UWVS suzuǃ t1$rt$ $tM(u [^_]ÍRD$<$TC u͉E|$2$XE뼍 [^_]UVStǃ t$&rЃ[^]ÍRD$4$B uЉt$2$1USUt\ t$'ǃ []ffUWVSD#t"uĉUMЋ}0 ,E ,Eԉ΃UƍFE܅ÍTMDAtEEE? *iVЍL]DS<*u,U܋utȍ\ DNtE<*t݉U].X$U>}+8 4[^_]É4$6t$ D$ED$E$3$5E[1Dž;~2D$$T:T$D$ |$ML$M $D$D$ |$ED$E $9t0;1D$ D$D1D$<$sƄD$D$ |$ED$E$0ƒDž*8-؉DžDžDžDžQDžDžUWVS<iÊEu 5>}1D$ D$}|$$uRDžDž$;$w;u+0<[^_]É<$&3|$ D$ED$$2$2NX1Dž;~2D$$s7T$D$ |$ML$ $D$D$ |$ED$$9t0;1D$ D$D1D$<$pƄD$D$ |$ED$$&ƒDž '8-؉DžDžDžDžgDžDžUWVS<fàEu 5>}1D$ D$}|$$uRDžDž$8$8u+0<[^_]É<$<0|$ D$ED$$($/NX1Dž;~2D$$4T$D$ |$ML$ $D$D$ |$ED$$9t0;1D$ D$D1D$<$3mƄD$D$ |$ED$$ƒDž $8-؉DžDžDžDž}DžDžUWVS cù}h"D$E D$<$$ututЍv [^_]UWVS QcX}h"D$E D$<$utu&tf [^_]UWVS b}h"D$E D$<$ututf [^_]US bÚ5D$E D$E$ []UWVS[bbEEM 5E1EUt^Ǻu )ԍT$ MJtJx9uT$E$o}+>ue[^_]úoUWVSaEEM 5E8}1UEtoӸ{u )čD$MHtMXʋy;uT$D$E$xj}]+ue[^_]ø롉US aED$ ED$E D$E$辣US `ED$E D$E$:US `õED$E D$E$>;fffUWVS {`ÂƉUt- t D$4$$u+E [^_] ,DPu 1 [^_]É4$y [^_]U`Et8t l1]ø]UWVSX_5EM1ɋED$lD$Ẻ$_ }e1󫍃 EЋM̍ |t:tEЃ9s EЄu t$tD$Ẻ$dFD$8PD$Ẻ$cEЉED$D$Ẻ$cx/Eй 2€X $I1D$:ߤD$Ẻ$PStX EԉEȉD$D$Ẻ$ gvEԉ( EȉD$Z]D$Ẻ$ft Eԉ0 EȉD$fD$Ẻ$ft Eԉ, EȉD$yVD$Ẻ$ft Eԉ4 ED$kt$Ẻ$bE0f EЉ$.0EȉD$^D$Ẻ$fXEԉ8 EȉD$4D$Ẻ$eFEԉ< EȉD$9 D$Ẻ$eEfH EȉD$_D$Ẻ$e*EfJ EȉD$D$Ẻ$_eEfL EȉD$b_D$Ẻ$/eEfN EȉD$o,D$Ẻ$dEԉP EȉD$wD$Ẻ$dPEԉT EȉD$rD$Ẻ$dEԉ EȉD$D$Ẻ$udEԉ fEpxEfEbxEfEfxEfEoxEfEtxEE`a E؉EEEčEEEts4$8D9u n9tg8/t9spz/t9u)ЍpvD$ t$T$ <$^Ƅ [^_]þ@À8/u W뱉¾US<"U)EEEEEEEED$ẺD$$tEMt<[]ø<[]UWVS Tïxƃt,t $UtwE t [^_]D$D$ \$ǃtD$$bD$<$RD$<$B~<$U1됍W$CvsUSSEtU T$؉$i[]i萋T$D$Ít&T$D$Í&&T$D$!Ít&T$#L$ u&fT$ Í&T$HÐT$Í&T$@ÐT$D$ Ít&T$ L$ u&fT$D$Ít&T$D$L$  Í&&T$D$L$  Í&&Í&&D$ffff̀rS[P@[Ḯ̀rS[0@[ḭ̀rS[@[̀ffff̀ffff/̀ffff^̀rS[@[̀rS[à@[Ḥ̀rS[À@[<̀rS[`@[̀rS[@@[ḇ̀rS[ @[̀rS[@[ḓ̀rS[@[̀rS[@[`̀rS[à@[R̀rS[À@[2̀rS[`@[ḩ̀rS[@@[P̀rS[ @[ḷ̀rS[@[Ḷ̀rS[@[ḉ̀rS[@[̀rS[à@[Ḛ̀rS[À@[̀rS[`@[Ḩ̀rS[@@[1̀rS[ @[Ḍ̀rS[@[òrS[@[ìrS[@[l̀rS[à@[t̀rS[À@[s̀rS[`@[r̀rS[@@[p̀rS[ @[j̀rS[@[m̀rS[@[Z̀rS[@[ ̀rS[à@[S[Ê@[፴&v*̀r׋L$Q1fffffỲrJ!Q{ UWVS&M-  D$$4 + s$uu[^_]ä[^_]ft뻋 P D$D$D$D$ D$ D$$B 3ǃ D$$D$$$Ef=USK E)9 t$+[]à T$$[]US}KÄD$"$ u $^[]ffffffUSúQ)‰э)y )ȍBхyJut,$I )Ѝ)‰)[]i)\P ףwUWVS ÉUMPЀ wYU1ɉU v1pЉ w' LHЋuU<;}v;Mr9MrE؃ [^_]1 [^_]UWVS JEUM1E $Ma ƉD$ED$M $t9} uˋEEtE붋E8E[^_]1[^_]UWVS$IǍ5 M1ɋ0¬ ,ʍ}9tBt DK@tt0DCu1}+;uv$[^_]Ë$Džt̋0F D$<$zF$F(<$됍XUWVSxRHUuuEEEE ,E ,EԍEE ,E5EtEEč[$EEEE HtBEUDZ@/<%^]8 މM E HuE܃ M܃EpQ)Ѝ)ƍ,B i)\P(\#1= ף‹E@4R`ʃ;}EPMu܃EHQ)Ѝ),u,i)\P(\ = ףƍvEP@+`}G Mu܃E@EPx*9|x7 G9}ۉ΋EpgEUYCM ^]>%BU؅7%M EM$UED$t$U$M$UED$t$U$h1uE t Ex E@MA]؅xM 0< jFE؉E0E]F0<  XȉE+EU9ȉM]M]EE0< EE؉E@0E9ȉ}1M E]؅MԉL$ ML$D$4$ƉEoM EU$ =ƉEEMAEJM+M U$5ƉEM U$c1ɉƉEM EP$ EE؃My uAM U$c1ɉ~ƉEM̅?EHQ)ȍEEMAMEBM M؅JEM $=1ɋUƉEEM E؅ EYE؅EM EP$;1뤉M EMM ElU$'1ɉwƉEE-lMAEMcM E9M E؅TM EE؅=EM E؅#M EnM EU$c1ɉƉEE ME̅t+EXQ)Ѝ)ىMEHE8M EP$1ɉZƉEEsMTM U$)ƉEM躓$I)))EHEtE܃  }EE@EE@El‹E)ЍH$I )))ыuȍDU)D+EЋMAME܃U@ZDSM؄tE0DV@)ˋE@ @$MH(+uEPuuE؅EuLuEPuuU؅{EHQ)),Li)\P(\ = ף@MAQ `DAME܃t1EDdEsu{M]S3eʋEDH@R EDH@DP@SDP@St DP@uD$$MM)iuV$V(EËM OMEЉAME[u؍NM>TVEDP@NM~CV1ɀ}zEU}z]M ENN fJEEڋEP$@(E؉EX1nED$E$Å6Mu EPtJЃEM؉M}]EMDA }Q)ʍ)M;))ȍLE]DA@CÉEDQ@u1F1ڀvVM)ٍ)ҍJEMMzʋEDH@GK뮋]D$$ME t,MA M)iuV$D$$MEhMuN u6u؉ڋuV$UU6 ,D$ ED$E D$E$]ffffUVS<\6cU E5M1tHMȋHM̋HMЋH MԋHM؋HM܋HMHMH MH$M@(EMEȃt'tTt7U+uR<[^]ÉD$D$t,E$ىD$D$t,E$D$D$t,E$UVSu] 1t  9t)ʉ[^]UWVSA5HE0uto4$xuEpEt';Uu"|$t$F$轙V9UtމuE tH9utFE]E[^_]EUWVS 4ǥuU Mt;A t+ ÃutF\$D$$ [^_]ffffffUWVS+42D$E$EU ND$}|$E$ƃlE $6ELǜ50t6Eu1[^_]ÉL$M$UUM $ tE $'EMʉNjusStftM|=Eu stf`Zu@u'ӨuEuP똋E|fE밸xUf0UVS B2IE UtuD$E$a [^]ÉT$D$E$ƅt$Tt01 [^] 1뼋E [^]UWVS1ìE 0E,}54M1Ɂ}D$D$E$]H@hDžDžD$$D$h8$趼hǀPǀTǀX84$8Dž@fDžDUfFHDžLTDž\dDž`DžX|$ ,D$0D$4$M[Džx 4$u4M+u8[^_]ÿ艕U/UT$ U T$ ,D$E$]US /éED$E D$E$E []USq/xED$ ED$E D$E$-D[]UWVS7/>u}}t}D$4$ 4$F0tN@9t $jF0ǀǀ FFV Ш\}UED$ED$4$8U …tIME 19tуM}tIfV M N~MtP~IU}<$E U 1ʀ뢃fV M N~UFEH5 D$4$E[^_]ÉUF$3U\}1EfV FVCVFD$4$E[^_]F߉~eMU<$E UMt19tU $MwE MUui4σUWVS,MD$ $MQ( $MMA uoD$ D$D$A$MQ(Ɖ!ЃMt!A t?A)׋A0tA<)D$ $m[^_]ËqPyTut֋t+AD$ $3UVS+uD$4$V(4$F D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$oEUw0E[^]ËVPNTUMutt+FEUTD$4$ D$4$UWVS*êE8ep >EFt$V tQFtB1ɉωMT:0$V T:($V D: $M9NV w$F,t$|F4t -$hF8t$Y4$Q[^_]UVS)üx4$謴 D$E$T4$菴[^]UVSp)wx4$g $T4$Q[^]UWVS1)8x<$( D$$YƉ<$ [^_]fffffUWVS (uED$@$bED$E $vcEt9t$}$]t$u ǃtt$$9uEPut$EE [^_]UVS5(<4$, D$E$b4$[^]UVS'4$ $+b4$Ѳ[^]UWVS'ø<$訲 D$$PbƉ<$色[^_]fffffUWVS$g'bE¬ ,:}؍]]Љ]0E E1Hڋut^}u 8}|;ЉEuEԍ]9tiwa.EԉxA0kPу߀Xt_EEU}ufuE܅u$[^_] f҃a)߉OPEt ‹uDF@tEԉ8HU)уwt%1 ؃9u뉍u9ux11rUWVS %àBD$,D$ƀ,<$mE tED$E D$<$PD$$ ]"E$USE%LUT$ U T$D$E$gfUWVS %EEt-\u [^_]à tF [^_]U U^E} ?U  ЋuE [^_]E T ,Eg} ;U ,DPEDBE u'} B} 8U ,DPyE 0uE EE 0<MEu DЋuEE} #E11ۀ} ;c}}} dڅt<|7;}3;]uЀ}N} -.} ^tEEE T ,NE 0u ЈE } z=3 huE EQEEu } \Et } %Et } &Et } =uE E T ,ZE 0uE U ,DPuE $0E 0<Eu DЋuE7u VnwK EuڍEuE ¬ ,u DrSuM uE 0uEEuunuuZuuFu\u2EEEu uu uu uu uu uu uEc"dhEe[d8؃7t&E 07Fn ,WIuu ,W7E E1"EEnE [UWVS,65} EEEX]]UU؍MM܉ىEˋE)؉EED$ E؉D$|$E܉$Pwqً]EE@tn륉ً]CUÃЉE3UЃ,[^_];]tdECbЃ,[^_]É߉EC~EtEt +]덉v tUED$ E D$D$E$t]UD$ E D$D$E$H]UD$ ED$E D$E$]UWVSGNM@ />3)Ѝ)Ѝ4>~ 9O$#H  $MMt0O$wD$ D$4$X[^_]Åt1O$wL$ -D$D$ 4$@M t1[^_]ËĮM$ЃH MWH u$ĮM$ЃH MM$(eljM $M>0[^_]Ë] t OwǃH 0 *MD$$=Ɖ@ MGǃ0 ǃH EUWVSKRM< ))Љ)4>~ 9O$#D  $MȮMt0O$wD$ D$4$[[^_]Åt1O$wL$ -D$D$ 4$CM t1[^_]ËԮM$ЃD MWD u$ԮM$ЃD MM$(hljM $ȮM>0[^_]Ë] t OwǃD , *MD$$Ɖ< MFǃ, ǃD EUWVSNUuE$ƅ8 ^uE1ɃP9u/>3)Ѝ)<7>V~2T$UE$舓Uu;V$] [^_]ËH uĮǃH D$ ED$$E$@F$] 1[^_]ËH uĮ$ЃH $(eƉE$ts@] 1[^_]ÉU$ЃH U=( uV~2T$UE$耑Uu;V$] [^_]ËD uԮǃD D$ ED$$E$̮@F$] 1[^_]ËD uԮ$ЃD $(]ƉE$̮ts@] 1[^_]ÉU$ЃD U=$ uf.a11~fUWVS { Â}<$` $E쉃\ ǃX Et{ ,wE}UWU}:uKxpu<\u$JDK@tÃtDK@tB<:uEЀ}:t}uPE1 [^_]Ë\ t$ǃ\ ǃ` 1 [^_]. px8UVSE] :tu1҉[^] 8u4u u݃}:t@1;UuЍPx@tΉ[^]Ã8t̄u@t}:ǘt:fu‰[^]U ΅Uخ]UWVS}u 8u u|t3:t.t*9vv :t|tu[^_]1UWVShL KU 58}1}!0Mu$\ tT$4$,f$#Dž9DžUD$ }D$D$4$D$D$ D$D$@4$AD$D$@$mEjDžDžƉ19vhpȀ W:Dž\1҃ t t DžO;>9wD$D$E$]'؉؍pȀ Q X@<#D$<$خbDžD$=D$<$Åu<:BuED$D$E$ C:{DžYI@E<$Džj:ߍO;))|$$//ljeDž<:tu)>|>:t:)ȉ)‰+99)؉D$\$$i|$t$ $i$zzO11cC_)Љ)Ћ))ÉT$$‰‰ÉtE$[)P9rX8U+h[^_]D$ D$D$E$ɷD$<$<늋` $Džst$$DخuƋ90<$E{0DžNju*$E$踇ËE$襇hƋ<$$D$ \$|$4$V tWu$Dž4$VDžPu#Dž묉$H $DžtxL$T$$e4$Vx-18 0<$o0Dž4$V Dž<$uzE $u)$ <$E$xċeE$ZpUUD$ED$$M E]USzT t$CǃT ǃL ǃX ǃP 1[]UWVS,krzEE 5M1DžL T Ǭ ,R\ tX D$T $8D0Dq@:#P ux|\u ǃP ύ:\tWut$T $7lDҀ|\tǃP ǃP T $ƋT $GǃT L PL @L$$T dǃL ǃX ǃP f:wʄt <:tBt<|uD$L$$~ƍ@M+,,[^_]ËT $ubT $ǃT +L T 6RD$L $}T SYT t$蠯ǃT ǃL ǃX ǃP ǃX ]S$NǃT <ǃL ǃX ǃP $aUWVSryvu} T t$ǃT ǃL ǃX ǃP } u[^_]UWVS v]D$=E D$E$$d3ƅ:Ed\t0:tY^tU^uW:tGtCuЋM)ˉލCdD$ $]cƉEd:u^u)ڍ{EM[^_]WU:t̄tȍOMJЀvMB2wTɋ}싔W0UWUU W0ҍ ʈM} } } } }}:}}1T$4$]fE4$]}QE$]e]莹 UWVSõs]D$=E D$E$6$dƅ<:d <:tCZt{u)Cd]D$4$]lU‰ƹd<:uЉƍX)Ӎ{t<։\$4$]*…u%4$]ZЉ)Ӎ{uċE[^_]1뫿4$]ы]? UVS D$#E D$E$0<0tP 1F<w1F9~ƒ1F< w9E1 [^]ÍF<wFqs;u/uƄƄft|뤍l />:@ 1ƒ ue[^_]øWfffffffUSlD$ $, D$ i$&I []UWVSLÒluu؋} }ԋEE5EЋM1ɍD$$h u}MfMUT$U܉T$ D$ ut$$".u} v M܋9c} u tM؉%9 t1EЋu+0ЃL[^_]Á} u uD$D$ $Vƅt Eĉ4$ZBfxHuPP}3z$M3J u֋M3JʀuɋPD$EĉD$$U胤DžuED$UȃT$Ẻ$膦9Ev % ЉD$ D$ D$ED$Ẻ$a;E҃"A9FAf9F1҉UȍQ Mčwt$D$U$膇OMU|:9I9ur?M̉ωփs6tf[UU؉4$WU="3MuuA q EfPTUSiD$ \$ ED$EU $T$u؃[]1[]UVS^[]1UWVS f}E 4M0M(52u1,hEED$E$zuD$h8$FvhdžPdžTdžXfDžD8H<$êD$$D$(*AD$4GGPt$89t$4PD$( L$L|$Lvt$H$D$,D$lt$\|$L|$d QՀMwEҋP |$D ~0d$\?PT$lGGD$ll$Lut$\ƀ$Pу߀XuD$lD$dD$$8D$lueD$hD$ D$DD$D$D$,$o Ζы|$<|$<{@{D$TD$l+D$,D$`D$@OT$0t$DrT$DT$\&ҋt$,T9 d$\D$DT$\@փ濁t$\T$0t$DrT$Dt$DuL$\D$DT$\b?T$\[<$膏ht$\D$ljqXGGkP;t$8 @‰T$$L$4ƋD$hD$4$L$4T$$D$LD$ D$$mq-q-GGQP;t$8 PL$Lt$L|$$mL$ T$4L$hL$4$芘T$4L$ DqWBG P;t$8^ PL$LD$$D$(q+Gqx1t$Lt$\|$dD$L)Љ<$ x G9w݉t$L)ȋ|$dGʉt$`D$h$4D$$D$8$D$,<$覍';t$8D$Lt$LIqGG@ P;t$8 @‰L$LD$(D$LD$ L$\<$* L$\;L$8 L$4)D$<L$HD$<1 D$4D$tD$,D$hD$D$d$*…(D$LT$8D$h$9T$8T$(T$dNL$84j|$t t$4D$hD$D$,D$ L$8L$$t$D$H$ȪT$("N D$HD$hD$$身u>L$8L$`l$LL$\ D$HD$8D$dPt$8t$,D$8t!ƋD$dD$F$ 9t$,uD$\D$HD$TL$\<$b) L$\;L$8 L$4ЃL$Lt$L$D$LD$ D$(ʀ|$$ @D$TL$L<$L$LT$89T$4D$(rL$4<$L$4;L$8D$ D$LTGIP;t$8 P^D$  t1 E] U}#]#} t]!É]܋E!ЉEE܋U t1҉EЉUԉNjU̅tEvw EE@iEЃUBftEЃ0<Eąu tEtJM\EЉ0҉Q0A0y AE؃E؃<[^_]E@Uǀt MǃU؉<$]豍U؍JM؅^@zE@uJ4$]融uM tHFv@E %Fv. #M؍Q\aE ,DptGE؉7E؃<[^_]ËE\@tEE\@bEE\@nEE\@vEU\B0E0<UE\@aEgE\@sELE\@fE1E\@rE-z<$]E@0@ 0EB?E\xEUWVSkr3}U EEuEE tu$UUtT t! tT$U$q+Ut==GG W[^_]ÍB߃]wʃ=uËEEuEEU }[^_]|UWVS觷î2}u EEEEEE4$nuF_tAN߃ w ?u.%DGG W[^_]ËEEEEEEu }[^_]UWVS 2ʋEE50u1}}fEuD$$΄D$<$訄|DžE %@ 1)tnu䋅D$ v D$T$<$蓉x9G hu1DžO+;uvu$uD$$S.p 1󫋅t$< 9uE t?*hHE t`'HE t E t E t E t "E @u \E LE  L$L$ U T$OL$$ЅuSt$$$$Յ}+8~Ĉ[^_]Ë$計\ 1󫋍Dž ,򋽬);\$D$$胆…lj99ߋtft@Dž1Dž tr1 t1 !! tߋ;!ȉ!؉ t1ҋ;Dž9D$ \D$D$$^$…j9(떸~D$ D$D$$ <$v2t0,1,DыWыWD$<$}{ .Dž^tt$%$$ /qP+f#1{ o D$ \D$D$$D$ \D$D$$љDžDžAq^UVS赭ƴ(EE5EE EEEMED$ UT$UT$$1MxEM+ u [^]1UWVS:9(EE5EEEEEMU ED$ }|$}|$$xEU+u [^_]1gUVS趬ý'u t44$mD$ UT$UT$$1ҍEi[^]1UVSdk'ut54$lU D$ ML$ML$$E[^]1UD$ ED$ED$E$M 1ҍE]UU D$ ED$ED$E$ME]UU E D$ ED$ED$E$MEu]UVSw~&EE5EE EEEMED$ T$UT$$1xEM+u [^]1UWVS&EE5EEEEEMU ED$ |$}|$$xEU+u [^_]1/UVS~Å%u t74$jD$ T$UT$$1ҍE.[^]1UVS)0%ut84$jU D$ L$ML$$E[^]1UWVSҩ$}u t74$+jD$ T$UT$$1҉z[^_]1Ur}$D$ D$ED$E$M 1ҍE2]U2=$U D$ D$ED$E$ME]U#U ML$ D$ED$E$ME]US 质û#EEEEED$E$-E []UWVS$nu#DžE = tiЁ$[^_]ÍƍE}D$D$ t$|$$` 1ɉ 9FD$E$T#u؉G} t9;4$yЁ$[^_]Ég8 uf;t<$y$VqDžgWPUE D$E$]ffffffUWVS{Â!ƃ ‰ ‰ ‰ ‰ z|$F$utF~1[^_]øUWVS!9H rt~t PRuF$D$ D$L$M<$#^M΃t ljډE:BGuETB[^_]ÉUy(MFfED$|$F$>aM"fUu ~ MFЃ[^_]UWVS18 ljօxlxD$$EtU3W4E3G0 u|3WQF)uhGHf fuT~t$bu} EHDu@8/tF(tTF[^_]1[^_]ÉUD$D$@@$TǃUtE F<$<$u: FE@[^_]ÁN(\F11UWVSfm }d.5u4E<$u(<$aE$|[^_]ËG$$뿋G$$G$$G$$vaUS   ,D$ ED$E D$E$m []US 裎ê ED$ ED$E D$E$em []UWVS8fm Ɖt,MQ=M= =HL$U؉T$U܉T$ D$|$4$3=ƒ0u܍M؁ ʨtUEԃ8[^_]1EEkEhEEEdҺ뱺몋U른 N"ك8[^_]1U:E ,U E]UMU E]ffffff̀rS[@[̀rS[@[ ̀rS[@[UEM 9u 9tu1]US{ÂE D$E$*[]USQXE D$E$[]fffffUWVS@"|$(D$T$L$,tȃ"|$FD$8UT$$\$(Ju܉L$8ƀ-5+uD$D$,{L$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$}D$L$811҉D$8T$txG MQ T$$(tˉ}ӋMEAA$KMA E@@eEtG>uuE$wSE@ EjE $,D$@E$9E EMH jA^^AQUWVS膀Í}G $Rwt6$RuG[^_]US@GE D$E $[]UVS8 ut&== =xUT$U܉T$U؉T$ D$E D$E$=t3w \Ef>@fFE܋UVtfNȃ8[^]FfFt׸E@EÿE?EEEJ1ոfFFfFt{FfFeZffffff̀rS[ð@[UWVSljEЉΉMމuEtME9UEs7lj։u\$4$U~  HS9u+}9ur͋Umu[^_]UWVST ~Eu }Z E EE̋}}G$]0HEąMEЃ~)֋]ދ}߉}E$MučDMEED$E$U1ɅM9}EEu؋EEE؉E܋]]]9]?]ԋ} ]9]vE؉D$$ׅ;Etډߋ]ԃE؉E9q}ԋ}؋u}؋uUUE;E]+EE\$$UU9tʉ+EEĉE؍G~}u؉M HZ;EuuE9oEɋE$MEEЋMEĉEEEċE9EE$]tN1T[^_]Ëu؉} 9]vIEËE]V+uuĉ2}uڋ}lj]XJ9u]9]wu؃uM9MDEЋU;EEEUBEMċ}9EMȉUM܋Eȃ+UUU;EzEȋE+EEE؋UԋM99U]\$u4$UuE؉EE}Ѕ}\$E$U;E~~9]wދU9UM̅U܋E 9wMA9EE܋U܋EM9uU܉EM9MU9UE̅}܋uEԤ9wUBM9)E܋UE؉EM9M>E؉Es}؉u}tFEM9rD$+E$UE؃M+UUĉU؉M}uً}}EuƉM HZ;EuM}M9{Uʋuދ}9u\މۍ9EvljD$E$U;E܉߉19}E9}s0u9us<3|$E$U;E}9uruU9Uu̅U܋E 9wUB9EE܋U܋EM9uU܉EM9MM9M3U̅gU܋E]؋ 9wE؃+EU܍DEEE]EԉEE}܋u9wMA9r@)]]܋uEߤ9uu]]X]+]9w ]E뻸\$E$U;E΋EE9wÉEE;]v)1uE<|$E$U;E͉Ӌ}܋u9wMA9r%)]]܋uEߤ9uu]]ָc-EE}܋uEؤ9uE+EEEEEM9^EċMMĉEU܋E]ԋ 9wMAU9r Ѓ)C9/EԉEE؃Un1T[^_]ËED$}ĉ|$E$]}EĉEEE\6UWVS wuEuFEt,~^tH1ًP1 uV9P u [^_]$]?t"N^HXVP }8F [^_]ÃUWVStud.5u [^_]HF$$4$5NjF$$[^_]UWVStà}E wut6tn9ƍvuVFO9N uO1MO1 MtGD$ T$D$$t(GWG1D$<$#tG9F [^_]fffffffUWVSsuF9FF FD$ D$D$$'FVFD$F D$$F~]FV uPzN)9@FJ u M kz u F [Ѓ[^_]ÅuF u\1UWVSs}d.5t2G$$D$<$ƋG$$[^_]D$<$Ɖ[^_]UWVS råU3EK3d.50E@$$pD$E$YƅP } iIE@$$2tlEM 1 [^_]D$E$ƅt[P } uduMM2uB2}8눋E@$$v(2uO2}8E1 [^_]ä1Bftfv 1fOE x-fE xfff̀rS[à@[ḃ̀rS[À@[UWVS$[pbEEE E08D$D$ED$ ED$D$E$t 1$[^_]É08 u081$[^_]UWVS@o}ljӉMЋMM̋u MUUȋE5EԋU1ҸQ)‰U܍)lj}ظQlj)<)]؋U܍<Q))Ӊ]}u}u|EԋM+@[^_]Åu E܅1M؉D$]D$ EȉD$D$ }<$8M9r 똃9tPu}t]܅M܉\$]D$ EȉD$D$ }<$T8M9@ 91Pu}܅tcd}܃}~Wd]܃}9sQ-E9t@u<}u}t&}uM؋]ۉ\$]D$ EȉD$D$ E$V7M؉C]UWVS9m@EMME EEEEE5u>}1Etuu ,u;}tX֍VFtC<%uEDž|1ɉx}rBu h[^_]>+̀ffffj̀rS[À@[ÒrS[`@[UWVS;FB}u t$<$赅u 1[^_]D$FD$<$0tۍFD$<$rtȍF D$<$_tD$D$D$ FD$t$<$zfffffffUWVS{EÂ]}E 0|$E$Jt?;}vE8th1[^_]ÉepuWUD$$]EƋE 0u(]썃D$$N1뚅titn1ۉ}߉ut\$E$]9}wUZEE $]E E6tu#EUWVS] uEt'1 ]9}t\$E$օu[^_]ø[^_]UWVSD u 5E1Vt(.E+pЁĸ[^_]DždDžhF\DžTDžX)V\f8DžllD$`D$ TD$XL$U$$…QD$dD$ TD$XL$E$…hL$t$E$‹\f8\dP\p9\hD$t$E$f\P\wDždDžhF\DžTDžXDžhhD$pt$E$eƒq\D$ hD$D$4$&\D$`D$ TD$XD$E$A\*ffh̀rS[0@[UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS ?ÿu}F9r+)F|$E D$F $Q~  [^_]1 [^_]UWVS b?iu}F9r+)F|$F D$E $~  [^_]1 [^_]US!?EU ]uHPP UP[]Í@fUWVS>ҹ}u t$<$^t t&t 1[^_]Ãt$<$6[^_]ÍFD$<$~t̃t$<$~[^_]UWVSK>R}u t$<$ށu 1[^_]D$ FD$FD$<$7tԍF D$<$蟁tF t6u$FD$<$ ~tt$<$}듸[^_]ËFE }F[^_]UWVS=×}u t$<$#u[^_]D$ FD$t$<$~[^_]US :=AD$E D$E$- []UWVS= }u t$<$#}u 1[^_]ÍFD$<$|t~uD$D$ F D$t$<$gUWVS<Ö}u FFt 1[^_]Ét$<$|tFD$<$tӍFD$<$h|tF D$<$U|tt$<$B|US< UE JttH[]ËJuL[]ËJ t't@H[]RP[]JHRP[]ÃwJ JHR P[] | q f[@HFfffffffìrS[@[v̀rS[@[VWST$L$1t8uЄt`B͉ t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^UWVSMu tSY99t=PutC{tP9utCE[^_]É1Eu1E1[^_]ffffffUWVS$9ÿlj50u1D$ t$T$$f 4$@;EwDUT$t$$Gu%1M+$[^_]øE @O)D$ YD$D$4$v<L;Mwσtft%D81= 3D$ YD$D$4$wO 7t$$* tG$b,u?u&9O 뗋Gf%UWVSp7wƉЉU 5M1ɅtA~t7/u+0Ĉ[^_]ÿۿDž9EFfEfD$ YD$D$<$+<$;E@ED$|$$Nu5F~uN uF=tu ~tME}}0D$ t$T$$ cP4$;EwdED$t$$811Fȉ<32$`<]<fDžEYT$ L$D$$/8<$;E=ED$|$$$_D$D$D$D$ D$؍ DD$$WTtQ0IE ED$E$F <etNtu:Euۃt?ED$ D$T$$` ED$E$Bv蘘UWVS82uU EEEE܋}EE؋E E5ME1w^~wXN`vDt E؅tFu f~(VN'}U+8[^_]ËEM+EԉEE؉E} E܉EM8[^_]yvt E؅*Mt U܅ 1댅t E؅FfVT$D$ 4D$E܉D$E$JDžxi9}vdFutF ftV ff҉T$D$ MD$E)D$E8$UUx_9EvX1EtE܅uMD$ 4D$E)D$U$UUx 9}SEtUEE܃iviD$t$E$-1FT DD$ YD$E܉D$E$x9Ev1t&FD$ >ƀD}pEԍFM؍9MЉu EЉT$D$ E؉D$t$ $MM9)9}u1fэ~ȋE<ΉuԋuFM؍9MЉu"9M)ƃ;}tGUЉD$T$ E؉D$t$ $MyVFD$ YD$D$EEԉ$Eԉ$^9EE؉D$EԉD$<$aD$T$ 4D$E܉D$E$X?6UWVS<.ÈljE5M1ɋG ֨uI<$Ytpt$<$Zt㋅9Fu؋tD$F $̩u6ffd$L@=v1M+ P<[^_]ÍAƅffD$ L$D$$6D$D$ D$T$G$0jA;)ff9t<B9L$D$B$=D$ T$t$<$FtVuMEM]\$ ]\$D$$7t@M땸-V룸 1뵍YUWVSòƉ׉MJD$A M$…tKX MH FBF B FBFBZJBB!G_ ߋus%uu Ѓ[^_]äЃ[^_]ftuu fUWVS &֙8<ʋEE$5 0u111  r} !} t } 0<xf@fPffЋ<ȉHQ PD$ T$ LPT$D$ $fL8@ u+D$L0ЅLDPDP} t!} t} t@Dž6$L=L(Љ@ύALQP9H?DžDDžE, ;P1LLdP9HRJ,@)lj|$D$ PD$HD$<$Meƅ8@ u@$0ЅP4$gf(F$gf4F$gN Pf4(4} } } 9U "Bvq'tlH $xNjE $x$y|$t$D$D$ 4D$D$$%G4P1Zg1 }+8 &[^_]Ã7D$t$ PD$HD$<$c…xH8@ u44$0Ѕ4t!P4$P9| } 19Dt0d@pT4 HPL@@@11LrDXDž\Dž`LTtDžxDž|$8$4u+D$PtpDP;GDfǃ HfPt(ЉfHtuϋHfPu؉x~Pd Z04(ff!cfT(@D$$z(=H 󥋅@D$D$ D$D$$%@D$$y4N PWP @<$$VV VVVVD@` 9uP‹A@u4P'1Dx?$LbH+$$i|F}(@D$$=(4P14P <@ffa01$FF FFFFf(@4$D$NN NNNN(@@k$FF FFFFP4|$t$@4$4Љ@1\鲦P$_f4F $_f(F$_fFPD$t$ D$HD$<$\Dž(8@ P4$=$Dž44((D$t$G$4 (Dt9 u7t t*DD14$z\5HDu (0…t+49 ut t؉:11 xUWVSlV]Ɖ5M1ɋ$%$e11 rFFtH@FENRl]X1ɀ.уu;P1.d9.6<$1ҋND$F D$F$Ƌ@ut0HT$‹@ D$B$tF$$}+8Vl[^_]ËqD$ D$D$<$"(dPGGDWDDžDžDžDž<$O<8=t_W[G t Z$$vDžG GDWDDžDžI<1$@<E6d9ZDž<$1ҋ3YG GDWDE%1oY<$1ҋbW<$1ҋCUYGtGDWDE+Y8Y $XDžX{rUWVS ͇Ehp@`t%=mDžthE11҉ rMd11҉`d r`VtA<$ XXt[^_]ËhMEEdUMEE$Ju\11 rU؅t d<$E؅PU[^_]ËhMEE끋hMEEe`F:Xl}\1Md1҉ rGTdHpPL9F\D$ PD$D$`$'"hL$P T$ D$LD$l$l1xSE11҉ rlUEE!$Xl$g;T-XduDX$#E4 \i |‹dC뭋HA‹@uH_UWVS@? FƉU܉M؋EEЋM MȋMM5Uԋ:}1 $U؉$uxNtq`} tB9u}܋UML$Mċ}܉|$$2MċUt#1EЉ81}ԋu+7q@[^_]1F;tBDž;Ẻ$1ɋU؉r@u둉UML$MċE܉$)MċUhMUčD$}܉<$.,<CFU;MtDžẺ$1ɋU؉uu`@uWEVwt$<$uEEȉ$m‰GE뻋Eȉ$km‰GulU Ew ]Í]UWVS߁uvGt$B<$:u[^_]UWVSÝEhE tExEl5pM1ɍ1󫍵1҉ r`11 rhxPu x3Dž| $U1t vGt$9<$1ulpM+/|[^_]ËtbDž|DžDžDžttu7Dž$t`|Tljd\ t1҃tTtP9t GtFuBG9tGt/tu'W9Gt bh* Dž|T`\Xdt# t1҃i9]F9V@N9tu tDž$t`e|9tL$`D$hD$\D$XD$ XcD$D$$]wfzDž|tEdTΉvWt$<$udT GtDžuxtxFF1҉@уu􉍜xKD$$-DžD$D$|$ D$D$4$Lvx$Ft$$+lDž|muu tu th$t`` 9udr@D$%h$蛌Xlh $be‰HXh)D$L$4$t`|dpXLD v~u~XxMG<a$_+DžDžtPG t7Gt1H11 ⋍ ։?u$)1H$Dž|BDž|hdTƋt0fǃ $1ɉvxFtuËF@fu뾋FbDž|$ D$D$|$ D$D$4$nȉQH9wO$PrxrHH9s$NpDžP|0@BƜ9]GGPHH HH H@FF|t <DžDžDž 1D$ D$D$<$*$1ɋ|~D$ D$$\…D$D$$5{~D$|$$)F|HF<<tFDžt19vDh9K2Bt⋵ht9s 9r.$czyZD$ D$xD$<$r)0J9uB$t/0PtV2$0Pu$FDžDžFdT|l1hVDžtuH1׉tD$ D$D$$btT$D$Ii $袧i\NxS$XVP2$^0Pu݉UWVShnE֍U11  r1UEEED$ E$'HMED$E$n3Pt+< < ED$$nuȋFE؋FE܋F EFEFEFEFEEED$ EԉD$D$E$tt8EEEESkE Utȉ։vt t$UWFUvu׋EtMA‹@uUEz}Љh[^_]ÅuUWVSp^eluE$#'E~u11 rGtfEEEEE$ML$ML$D$ ED$D$E$$'t}EЅUp[^_]ËE$%MML$UUT$D$ ED$D$E$&t>E$Sp[^_]ÉE-tFE$bEԋGE؋GE܋G EGEGEGEGEEUԋEyEЉƋ@uh;UWVS\ ÿj5U1ҋ]D$ D$ D$ $Xƅ8#3D$4$XkD$4$;kxDž< < D$4$jxt$$贲t띋BBB BBBBDžD$ D$D$4$X~#|$$u@RD$Sc$1M+uy\ [^_]Ët܋vtHt$ySFu܋vGt$西<$蝿uzRUWVS4gEȋEE0xU11  rŰ]ȍRD$Sc$EЋỦӍEЉẺEtCË@uEuEЅt $]EU4[^_]UVS4;guD$F $StP PH p[^]UWVSDfU5U1ҋ@ ut$Yt$$dtӋD$$%gtD$F $gu[$蚫=w;$t@=wЉ=H1M+ yD[^_]Ë~D$<$Zftu狵11҉D$ |$D$$Ѝ|>rtftD$D$ GD$D$@$&9pt89T$T$$i<T09TN 9- |9;u׋D$D$$\uL$ D$D$$S)uurvBfMUVS :Acut$F $uE $MUF t [^]ÉE4$LE [^]ÐUVSÉ1   lLLLL9w[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1ӉU1ًU䍔2L*!3u ދUȍB91UԋM q11 ‹M"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1E u_MOUW T[^_]UE@@#Eg@@ܺ@ vT2]UWVSEP?ΉM} 1ÉPHʉP@)N9rcڍ<u usukPE+U9UEƋ} ؃@;Er)]] U<u sHtft[^_]äftt&u^uE_uOuW] }u|7}wfu SfUWVS OVZEE} 5E0u1Wu5G?7w}8)‰T$@D$<$D$t$<$EX1u7u=tftEu+0u& [^_]úx)끪WtfDUWVS(fiY}Ћ]E E5E؋0u1¬ ,:}DWuủu<051 I1҉}KMHɋ} Otp}UTyċ}toE+E̍H_(EԅtFʋEԉ=}uOtJ fɃa) yHȀ_1E؋}+8([^_]<.cEu9tԁw̃u܈VEXPЋ}DWt<0Cƒ߀Xt>1҃o}DG@YC1s:E  EE M EM ]AU ED$E$u ]ËE]fff ̀rS[V@[UWVS4VEċuűU 5E1Ju5  t8t+E̋u+74[^_]ÍuЉu11ۈEËEȉ4 rEËučJۃDЃuEu 'tɃL " u+Ep1i]]@UWVSïUE4M 0u,}5U1ҍhEED$E$eD$h8$ehǀPǀTǀXDžDB$T8HDž@DžL|$ ,|$0L$8$Kǃt>8GD$H$Ǩt4E+u=[^_]ËHt$֫4 >U(TUT$ U T$ ,D$E$@]UED$ ED$E D$E$]USUT$ U T$ ,D$E$]UWVS$ÍSu4$uE荓tUEEEEED$,xX<$:wE؉D$<$DgD$<$Bw $[^_]UWVSREX5TM1D$D$$g>ƍ`$1D$XD$$PPT$D$i4$q4$t'\pTU+İ[^_]}\\$xh\Pt_6tU~ tu틅XD$F$RuGXP$xXg1^P$ST1>$<UVSszQƋ@0$F0F($ըF(F,F$輨FFN D$$Ft N 1[^]ÍRD$$(t N 1[^]øUUB t B 1]É](UVSâPuF uu,F [^]ËF$FF F tԋ$F F [^]UVS+2PuF ujtfF0$蓧F0F u>D$D$ D$D$$ F0؃[^]Ë$1f 벸US] C t1ҋM ЉC []ÉC UVSnuOu4$F$٦FFF0$F0F($讦F(F,[^]UWVS OE@0VU UT$$P4p< t< t򍃕bD$4$OPU4$fU BЋUP ExE xED$$Ot_p1tG< t_< t[E@P9t[E xAE4ED$4$OOt1pMuE @<} [^_]Ã둋EV$ED$ ED$T$F$i t+1[^]ÉatF F$F 1봃F$ED$ ED$ED$4$c[^]ffUWVShÒID$D$}Љ|$ D$D$4$'DEЉ$蝘EąD$D$|$ ljD$D$4$C}Љ}9EfEE1Exu7P u%Mftf9HX`p u~9EwEEEuE$ʗEE 0Mω}t$D$lj$r}UfEzu4B<<u$Eftf9B_B %Ef9UwEĉ$gMAu9wAE01h[^_]@tfH fMEuh uȍLM9EBu=fE9U#bfE9EbB fEu11  r}}؋BEE΃FEtfEtuDE}ȉ}E<vtft}a}ȍDEr!E9U.mEE$˝1h[^_]ËEEĉ$譝1h[^_]ÍP UE1ɉ֋UtE6փ u11ɋUEuutƒ u؋E9EE؋}GE܉GGBGB E1ɋ}tƃ uE1U/tkHE EtEut_t/ƒu}ȉ~utftExu}ȉ~ utftEȋ}O yBMO7U}G E9U}MuEȉFNjMr1Et1fEt1}}ȸu}ȉ~Eru'u MfmHM뿋Eĉ$՚US8?CE$讚[]ffffUS CED$E $|[]UWVS$BljUM$<'ƋMEFWUVGEF G EF$G$F(FF,EE=OF-~MN O(N1utE)NEEȉF99E9}9UEE uuu=ED$D$ 11 +D$$D$?F4F:ON;$[^_]#4$ژ1$[^_]Á}w.F,EE=E=wF-F,E~F-EEt uuu=ED$D$ 11 +D$$D$>F0F8ON9Sy`F0F81F4F:1UWVS@D$E$qIƍxD$4$de}и9ED$D$t$D$ D$|$$t4$Itt*'v8NBCDt*|$t$1Ĝ[^_]ÁxB u$,u뾉4$dIt&Ƅ1Ĝ[^_]É4$@I1UVS>EU Mu'v8NBCDty1[^]ÁxB uu[^]UE@ ]UWVSz>EEU 9P vnH,X<3t;t*9r/9Pr*XˋE)ʋE1[^_]ԋ͋]̃ԋ]跃UWVS$=uF$ED$ F(D$ED$E $M~;N:]f4)ЉMЉ}F$)É]}f4)MMF$)lj}Ef4E)MMF$U)‰UN-FÃthtLÉf0ED$ ED$)N8N9F )É\$4$C$[^_]벋mUVS Ƙ<]tS T$ST$S$Љ$ [^]fUWVSGR<E]Uu y7y7} vyCS< ) 1))ȉ1))‰ 1))щ 1))ȉ1))‰1))щ1))ȉ 1))‰׉1 wU g}#sC )ى 1))ȉ1))‰ 1))щ 1))ȉ1))‰1))щ1))ȉÉ 1))‹uF1ЉF[^_]Ã} vyCS< ) 1))ȉ1))‰ 1))щ 1))ȉ1))‰1))щ1))ȉ 1)ʉ)lj1 wU v/ t us s sC vTtzftjtws w}#3}#s zrt>t0t<Xsss{sssUS 蔾Û9D$ D$E$!% []ffUWVS[b9E ,0DFt"ҍDB9D~u.tH 1 ֍V9rl u ʚ;}1 ~  [^_]yDVt6<}yDVuE{뚃jD8EVUWVS`_8uEU ,]|Yo1tX|Yu]@t|Y@u]|Yy1EutX|YuEu؋u@t|Y@u]DY*1E|XDYuE}}.b\AE}@u DA@tDY@u]}EX2wۋE1EE<2wuEBRDQ@u DQ@tDQ@uu؃[^_]EEv+E܉)u؍4)u4)Z)E؍4)EE܍(E=E/EEEB\AuE1BE\AEtGBE|AE󍄀]܍CEB\Au*&EEE}܍DЉEUWVS 55r̉EU)‰U)ƋUQ)Ɖt$T$(D$ D$ D$<$5v[^_]UWVScj4M 5t M1ɋ`M!t$dD$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,b|DžcxW&X ,`plh\Hh|@{  s D$ D$D$$ cu_tUatF[o‹|p p ;ut$xD$$Äu f})D$|$D$ D$D$$ `?|$$$|$$ Xw8jt&v$VD$PD$$$臈tM+m[^_]}n p9u}m P9u쀽it$T$ D$D$$#u8<$豇=!$jzD$ D$D$2$C|$D$ D$D$  $Zq|$D$ D$D$4$.q|$D$ D$D$ $p|$D$ D$D$<$p D$D$ D$D$4$pu艵EЉT$UT$ D$XD$<$dwC%D$D$<$DDž+ufNffftD$`D$<$ـdFD$D$<$袀9uۋd|$ D$D$p$@F DAu.|$$n9uщ|$ D$D$l$@|$ D$D$h$U@f|$ D$D$\$$@DžwaD$$ n{||$ D$D$h$?dFD$D$<$~;uۋd|$ D$D$p$(?F DAu.|$$í;uPoq$χD$D$$e~t!UWVSls+EĉED$ED$E $[/D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$, ZED$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,YẺEEfEEEfEEEfEEEfEEE`t5 u)K}f 8g1ҍ p9uED$t$ ,MD$@&D$E$|E`t fED$$;dE`BED$ D$D$$<D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,X,D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,WD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,FWD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,VvD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,vVD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,VRD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,UD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,>U.E`}c‹w puED$ t$&D$E$xb‹w p8uED$ t$/t$E$@xbW] PK8uED$ T$t$E$wObWu W}?uED$ T$t$E$wE`t tED$$ ED$$1ɋ}E+ED$$ EED$$@EED$$EEf Ef EMf Ĉ[^_]Í |$WD$ D$D$4$e D$WD$ D$D$$UweU D$WD$ D$D$4$?e D$WD$ D$D$$UeUM D$WD$ D$D$4$dHh$0D$D$E$uĈ[^_]ËED$ D$D$"$5ED$ D$D$$5ED$ D$D$$5ED$ D$D$$5ED$ D$D$$U5`ED$ D$D$$+5ED$ D$D$ $5uMt Ev[^_]Í|$WD$ D$D$4$_EtËE[^_]UWVSŢuZǹ| Pt9uЃ[^_]Ét$WD$ D$D$ $_v8Ѓ[^_]Ét${D$ D$D$  4$^Ѓ[^_]UWVSU} tdUZ~U ~t;u[^_]Í T$WD$ D$D$<$L^[^_]ÍUWVSu|uYǹHh Pt9uЃ[^_]Ét$WD$ D$D$ $]v@Ѓ[^_]Ét$sD$ D$D$ 4$]Ѓ[^_]UWVS讠õuXw# wVfK Bx v|@vF[^_]Ávf[^_]Á  [^_]Á v,낃@t9u~jtucOD{9.t#i xn1t$D$ D$(D$<$[^InXgUWVS跞þ}VYD$t$<$xWx [^_]É|$YD$ D$(D$4$[[^_]UWVSCJ}jV1ҍ pt9u[^_]Í |$WD$ D$D$4$Z[^_]UWVSLŝ5E1E <tmD$D$ D$.D$M‰ $M/ZMt#PT$UL$<$0+U0E+u4L[^_]D$ .M‰L$ME D$$MUWVS(EEEE$M]E܍U}`EUSEEU t 1([^_]ÃuuE-xE+u PUXƬ ,uЋDJ_p1ɉ}؍uNLY>vDzu}؍ 4u؀.M\BuuEEE܃@tMDB@9wMDB@9=E؋EЋEDJ@tEDJ@9wEDJ@9ËEЋEDJ@tEDJ@9wEDJ@9&MDB@89wE} U؈W_GEȉGEȉGEȉG E]]EEDJ@9w덃EDJ@B9wkHMX\Z1HMX4X\Zu,uPUXEwEHMX\]@\BUWVS谙÷EM HMHMHMp΁HɁ@ =*-E썃E,ENMb׍)ƉuԾE+E)lj}))lj}Љu̅EEMb֍)Mȹ))lj))MUĺQEM)U܍)ME$jEE $VE$CEU܋M\EE_uEeED$DED$@ED$*u|.t B[^]ÉЃ[^]1[^]UWVS(}ÄMEEEE$NPlPHH8|$x|$x|$@ D$L$ T$D$4$|([^_]UWVSuHh Gt-D$4$Xu?E tE [^_]Ë?D$CD$4$<…ukN ,DHtU)UD$ ED$4$HUҋUyE8m1ҁ]1VUWVS u| Gt-D$4$ Xu?E tE [^_]Ë?D$'D$4$;…ukN ,DHtU9TD$ ED$4$XTҋUyE8m1ҁ]1VUWVSu D$4$2FFy ;F|/} t)P}D$4$1[^_]Ét$E$cUS蛒â EM QQy ;Q|< tZ[]ÉL$$b[]UWVSIP Eu E$REEEEED$4$1F0u ǀED$4$ !D$4$1[^_]ffUWVS軑 IP5uWV@tWufFuFuFf~@tJD$4$lj4$]I[^_]ÉV@ut"Fu띉F룉4$fF@먋FtUVS 5Fu "t$,XD$ D$ED$4$E[^]UVS讐õ 5Fu tE D$ D$ED$4$[^]UVS`g 5Fu tED$ E D$ED$4$[^]UVS, 5Fu 3tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$7,[^]ÉED$4$EUVS脏Ë 5Fu t2ED$ED$ED$ E D$ED$4$[^]ÉED$4$ EU 5U]U 5U]US֎ ED$5$4k[]UVS討ï 5Fu t$ED$ED$ E D$ED$4$Jo[^]USU\ 5$[]UVS.5 5Fu Nt2ED$ED$ED$ E D$ED$4$[^]ÉED$4$EUVS 軍5Fu t9ED$ED$ED$ED$ E D$ED$4$ [^]ÉED$4$PEUSBIED$ED$ E D$ED$5$豝[]UVS5Fu t4$[^]TD$$US謌óD$   D$ED$5$诙[]UWVS krE8th׉ƅt|$4$JHt>u(<.tqAtN<\u~u~t&뺉+E [^_]ËU9Ѓ [^_]1+EUWVS$܋]Uϋu U MUL$T$ L$U‰T$$EU;tqu?E8@@P]})ˉ$[^_]ËUt U t.t7Myt.:u)|.tPM;wH.ȋ똍둋]KEEu0UWVSÊƋE9vtˉЋ9s/u#uE щ )Ћ]1[^_]äftuuBf։JUWVS !E։ϋUUU܋U$q1 M9ЍTU9q'E썃E9utoD$E$tE$ExE$yJE܉E] [^_]ËuE$q1Kx+E [^_]UWVS}ˋMu uJZ9vC>}])BvJ {9Cs1[^_]É4$E|[^_]ÉM]*IEEMUWVS+=DE}U(E,E M0|5M1E$t|$$CLƀ?QE4$6(DžE4D$D$E$E@ƅ)E4E$kE$T$D$ID$ D$dD$$C‹ $=t$ $ }wvE}M(t#t<. y<7|7.f}B}$+)ʍ'1| &ȉ9%9I $fyƸM+.Ę+[^_]ÍE4$@kxD$$1ɺ pE4$(H;+'M$D$L$T$(D$ D$dD$<$%A‹$; ,f @)lj~ Dž10D$D$<$ 9҉+򋅐${<$M(~F|$ $1ɺ0 f; @@1xJɋDOu.9̋+$;)+|}$$ENj$,$D$t$ljD$Z(D$ D$2D$@4$g>‹$D$D$$U u+|}$$MD$(D$ D$dD$4$=‹<$L|$D$G|$D$$U <$||$L$$D$(t$ D$dD$<$<‹$,dP@D$t$ D$dD$<$r<‹$B$D$t$ D$dD$<$<‹$rB:}\xD$D$ D$dD$4$|;$y}$t& $fPPHp $$aL$t$T$D$(D$ D$dD$$:‹$ B<$9 $$D$t$ D$dD$<$*:‹$$u$D$t$ D$dD$<$9‹<$2j$D$(D$ D$dD$4$m9‰<$|$D$$U D$ *@t$)‰T$$,$|1P)/~0> $J09:!$.<‹$y}$t&r$ЋHpH@D$t$T$q(D$ D$dD$4$7‹$<tD$ *@t$)‰T$$)+!@!|1P)/~0> $09 $:‹$dy$򋅰q+'/}+}$(D$t$ D$dD$<$N6‹$P@D$t$ D$dD$<$5‹$b;\;D$t$ D$dD$<$z5$yt$|$$U 4$|$SD$8$!D$WD$$S4$C8sP8Pp$B= $(~t$|$$U x4$|O$$1D$t$ D$dD$<$G3‹$$$D$t$ D$dD$<$2‹$K$ B$B$D$t$|$Z(D$ D$dD$4$D2‹$) VUUU)ʃ$(Gz}$ $ D$(D$ D$dD$4$m1‹<$ @t$D$E$$+4$4‹$$+'M$LG}$D$(D$ D$dD$4$`0‹$0Q 09(@Dž@DžDDžHDžL@)t 1҉  ;rE4D$ D$t$$;4$)3)E4ȉ39[4$|t$|$}$Pd e }$t&D$(t$ D$dD$<$.‹$*P@D$t$ D$dD$<$8.‹$P@D$t$ D$dD$<$-‹$LH@<G E4D$ D$L$$?4$-1Ɖ)E4H97)ȉǍ4VUUU)ƒ$({D$D$$U u9xsPP@ 19 :t1 tb$D$D$ D$dD$<$+‹$P{HED$vD$ D$dD$4$}+4D$D$$U )1xs9t։4$ZD$D$ D$dD$$*‹ $yR|$D$$U <$||$L$$U o<$ (n)ƒ '[}$U4T$ T$D$$X4$F-Ɖ)E4P@D$d(D$ D$dD$4$<)‹$;Dž1(P0k(ƀu1$SDž |$D$ D$dD$$^(‹ $Q;'$M(p}$n)'W}$uU4T$ T$D$$X4$F+v@t$$4$+‹$0}$t&b$膶$lD$t$](D$ D$2D$@4$&‹<$/g<$A4$|4$dm4$|4$&4$|Rt$|$$U X$$۴JRT$D$t$(D$ D$(D$4$'%‹$) VUUU)ʃ~$(/bf; @9)(n }$$e}3$|B2,t&jуP P@Dž====$;xsPP@k 19H :t1 tb$D$D$ D$dD$<$V"‹${HуP PPуP P҉уP P@ƅ= Љ;2H PPH P҃H PPH @$)`Dž====fDž==уP PPуP @fDž==ƅ=0t$(D$ D$dD$4$Q‹$1\9D$D$ D$dD$4$$yV$|)}u 9D4$YbT$ @t$D$<$5% |1Q)/~0 $N09>$2!‹$񋅤yT$ @t$D$<$[|1Q)/~0 $<t09d$X ‹$񋅤y6$)ʍ'$譫ƃ<$(t$-D$ D$dD$$Ɖ<$‹?w|$$1ɺT<$ $(3$ߪƃ<$(E4D$D$4$U)E4|$4$1ɺ><$ .(U$9ƃ<$(UE4D$D$4$4)E4|$4$1ɺ <$9($蓩ƃ<$(wE4D$D$4$ )E4|$4$1ɺd<$ B( A$ƃ<$( E4D$D$4$cƅ)E4<$L(|$$1ɺ'<$ O(@s<fWD$D$$U 0U4T$ T$D$$$(D$ @t$D$$ … $Q(OUD$D$$U  ;$r'$L(}$t&@!)' $>D$(t$ D$dD$<$‹$=Љ;TF~'$L(D$~(D$ D$dD$4$$ X$,d'<$@"E4D$ D$L$$4$Ɖ)E4HT$ @t$|$ $DžZ|Dž[+/~0 $L097$*‹$y$'$h' $+c'$&'9m*UWVS8rVuE  U8u@E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$8[^_]UUM8E#]UWVSUêu}(Q|EtO9M r&Wfҍ<t+E D$<$ߞy([^_]9} r+E[^_]UWVSU'EE}M OX9ff_X9@ffG 19wzsfftG u1Dw fu3Du9uEG$G(G,1[^_]ÉD$ t$L$M$x&\ËM믋]([^_]øUWVS$T/Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$uF,F,^(D$ML$ D$FD$$]f=F,F,H^]9f]fPV,PffN,unǃfǃ ǃF(F(V 9F$F(DF,1[^_]É~$F(DF,1P 9UruHɋ]HN,@ff V,9ErEMF,F(F(T~ 9~~$kF(F,1[^_]Ë](K4]UWVS QEu} ]9~$t~$F(DF,u^(D~ 9V(9 F,9~,)щL$ |$VT$$F,F,^(MT$D$L$ D$FD$$]AF,F,H^]9fҋ]PV,Pf҉N,uoǃ ǃǃF(F(V 9F$F(DF,1 [^_]É~$F(DF,1P 9UrtHɋ] HN,@fV,9ErE]F,F(F(T~ 9~~$lF(F,1 [^_]Ë](L5]~fUWVS OEU} BrJm U0<Ѓ?}E]썛@-]]M}KFm M0ˈ]<NN?M9UM ]L]M\ˈDMD} tE u;UEЃ [^_]} u~Nσ%?};}>qEDP@=T$E$RtXU t}9}vI+EM 9ENtSEDP@M=tT$E$MT[^_]É΍NuߋE[^_]Éu} u9uv} l롄t&뒿v1vlο`qXEDP@u=CT$E$*,EEEύNt[t] At DB@uE E9E] <NF]BDC@u=uJsύIGeUWVS IE80P߀XHp@EU1¬ ,U¤ ,U<+u6\]tE]\Ftu0 7)YAtZM DADNtF0 Ƀ7) ‹E E ٍq„t;}sXҀO1 [^_]UWVSHu} UEXf0xu~E~j1E ɃT 7  ҃sT 7SEu9E~sC.9EE[^_]à EuE[^_]H @# UWVGu@# o^_]ø1G% UWVS\GóϋMM5uM1t$D$uD$ D$2D$M $MƃM;w,ML$$ 7M)11}U+u\[^_]ø軬UWVSGEuE E컉))lj))MӺэR)É]%I$)‰)؉)U: 1UEu ]E u"M EÉ$Sr~=Ut3}Ƭ ,Ǩ ,w\DAtu܋E +E[^_]ÍM E$WE?M E$DxhU#M E$HEx@EM EÉ$MMExM BfUWVS Eu4$qH;MX} slu^uVM T:.utez\t*:.tU ƒ.} 1[^_]Ãt8z\tפftu:u!xU 믋E Pf} 봋U r(iUWVSCE 5E1D$|$E$xFD$T$$rxT$<$M+u [^_]fffUVSþD$0DŽ$DŽ$DŽ$E$d$$$$DŽ$tKi= t= 5=t#=t%DŽ$DŽ$ DŽ$D$PD$PD$tD$tD$xD$xD$|ݜ$ED$,D$,-w?,.D$|D$,D$,D$,D$,D$,벐D$,<0ZD$,Xt xDŽ$5DŽ$DŽ$DŽ$DŽ$$$ED$D$|D$D$0D$ $D$$D$D$,$D$`D$`AuED$,D$|(D$0t-T$0.T$D$$$D$0$$T$`T$ D$$D$$$v+D$xD$,D$,D$,<0tD$,D$,$DŽ$$$D$pD$pD$hd|$h$$‹D$LЃ0$)|$h"$‹D$LЃ0$D$hD$,D$,D$,D$L|$L/~|$L9~D$hD$l$9D$LD$`*T$,D$`L$`$8D$`T$`$u‹T$,D$`ЉD$,D$,D$LD$P|$hQD$tD$,D$,D$,D$L|$L0tۃ|$L07|$L9,D$,$D$tD$pD$tD$tl$L0|$LD$tD$pD$`LD$hPT$h$$|$h$$D$`D$`;D$t|D$hPT$h!$‹D$LЉ$&|$h$‹D$LЉ$D$tD$,D$,D$,D$L|$L/~ |$L9D$T|$Let |$LEt|$hu|$tu |$xD$,ED$\D$,D$,D$,D$L|$L+t|$L-u!D$\D$,D$,D$,D$L|$L/|$L9D$,D$,D$,D$L|$L0t|$L0|$L9D$L0$D$,$"$‹D$LЃ0$D$,D$,D$,D$L|$L/~|$L9~D$,+$ $N~ D$TN $D$T|$\t\$T D$T ED$,|$ho|$t?|$x4|$P6|$Ln|$Ln$|$Lit|$Li|$LIt |$LNtn .D$D$,$D$,D$,#.D$D$,$^u D$,D$,DŽ$DŽ$).D$D$,$txD$,<(uL$D$.D$D$,$u&$ $$$DŽ$DŽ$ED$,D$|D$p)D$TD$TD$X|$luD$hD$lD$h~$$D$T$l$ݜ$$ ~=$P&݄$ɋ$D$T$l$ݜ$DŽ$|$h.|$T#|$T|$TA|$|t݄$ݜ$D$|݄$&T$Tݜ$+D$hD$`D$`9D$T|$|t݄$ݜ$D$|D$`)D$T݄$&T$`ݜ$݄$&T$Tݜ$P|$T|E|$|t݄$ݜ$D$|݄$D$T؉&ݜ$D$h+$D$XD$4$~;|$|t$u$$t DŽ$|$XD$XD$`|$`t݄$&T$`ݜ$d$X|$Xg|$X41.+(%" $t $uDŽ$DŽ$DŽ$DŽ$$tHD$0$$$|$$m$$^$$O"uD$XD$XD$d7D$Xt݄$&T$dݜ$D$dD$XD$X|$X‹$-P$݄$&T$dݜ$$%$$|$|vDŽ$DŽ$$P$|$X\$XD$XD$`|$`t݄$&T$`ݜ$|$X|$XI|$X D$XtD$4jD$d5D$Xt݄$D$d݄ /ݜ$D$dD$XD$X|$Xă|$4$%¸k)ЉD$d|$d~i|$d~CDŽ$|$d4~ DŽ$pC$D$d !Љ$$D$d!Љ$݄$z|$`$s$d$%P$%=9$@u$@D$$$$$o$D$$$|$`&$$%=E$|$4tA$$$w $k)ʾ9$=u$$%$DŽ$DŽ$$%$uy|$4t6$%$$$p$%-$$ $DŽ$P$t$#$u/$#$$t"T$4$݄$ݜ$AT$4$݄$ݜ$݄$z2ظ+$$$D$$$ݜ$݃X/ܜ$$tݜ$݄$ݜ$&$u$%t4$u$ݜ$ݜ$ܜ$v݃`/ݜ$݄$݃`/ݜ$݄$ݜ$݄$݃`/ݜ$$u ݄$݄$ݜ$$t6$B$t"$u.݄$݃`/ݜ$݄$݃`/ݜ$$%$$݄$ݜ$$-P$݄$\$$$EL$ݜ$݄$݄$ݜ$$%=|v9$=u$DŽ$DŽ$$P$|$4$݃h/ܜ$݄$|$"D$" fD$ l$ |$l$"D$$$u DŽ$$D$T$l$ݜ$$u ݄$݄$ݜ$$+$$݄$\$$$L$ݜ$݄$݄$ݜ$$%$|$4$;$݄$|$"D$" fD$ l$ ۜ$l$"ۄ$݄$ݜ$$u$u$%t&݃p/ܜ$ww݄$ܛx/we݃/ܜ$wPD$0$$$$$$$ D$0$d$$U$$F$$7$$(|$4tVDŽ$P9DŽ$݄$݄$ݜ$$%uI" } t T$,E |$|t ݄$݄$e[^]UWVS 2 9Ɖ׉$t/Vk)Ѕ~?D$D$L$e[^_]U ޚ ,D$E D$E$]ff̀ffff̀rS[Ð@[̀rS[p@[̀rS[P@[̀rS[0@[UWVS }u ҈Ut!FE$^EwUu81[^_]ÈUED$ED$4$(UtՃFtȍ~8uffffffUWVS{Âu} 4$duM<$Wuj;r-w tt 1[^_]ËG9Fr[^_]ø[^_]Í/D$ 0D$D$e/$ /D$ 0D$D$f/$ UWVSúu} 4$E<$9E4$r<$bGE9FuCtL1.\9\u,\9\u"T9Tu9Mt9tʸ[^_]1[^_]Í/D$ 1D$D$C/$<0D$ 1D$D$E/$0D$ 1D$D$D/$vUS|ÃEpfT$ D$PT$$&[]US=DE$uE []1[]UWVS$EpEEEEEE1ҹEEu@u;8 w68`0$E;Uũ}u }$[^_]ÃHut9Ms߃EM붃̃E릃H}t9MsEM넃uEqE c}t}j1hUSUM} ~Zu@AЃໃrЃඃwAu A-1[]Ax1[]  UU1Ʉt"t'4$D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]USâUt/9E t* 1D$ X1D$D$p,1$GE []US>EE%t/;U t* 1D$ X1D$D$p,1$M []UEtt]ËE ]1} ]USáE ~>u>EtQ 1D$ X1D$D$p,1$<[]ËEwǀ[]ËEǀ[]US EU tt 1[]UWVS ё$ ƅt@@@[D$D$4$S:u [^_]%84$81 [^_]UWVS8?uF~O9tHNM 1[^_]ÉUED$|$E$UuFUF맸UWVSù}t;t-M tWt1$ 9ww$<$[^_]UWVST[EPUt8E19ut%E'q1f1T$ t$D$E D$D$|$ 1D$D$$z`u(u~EM+8[^_]yL$D$ dD$D$4$LzD$t$$`t1H󥋅D$ ِD$D$$`:ǃ`s1$衴…`1ƉtcA<+w2׃ʃ뽃밃룃떉 `vUED$ D$E D$E$]US͋UM˃w3BtJ[]ËE E @%]3 ؉BtBt븋E E @BtBtUVS<Et{E5EEEEEUT$u܉t$U؉T$ D$E D$E$}=t D$ EԋU؉T$t$U$Eԃ<[^]Í3UE@%-@~D$$$]؉=?w $D$~$$]øUWVS}7t%KE tP9uu 1ۉ[^_]CffUWVS$‰EU܉Mtȃ"}}GE]\$$huMÀ-M+EUU1uUE1-09M~Ax;EEȻOQЀ vˍQW9Mu؅؋M܅twuu܋}>$[^_]EExUI0EE왙E E ;;MQ"@QW7 U܅o_TExEE܅u01) [](lUS×E D$E$[]ffffUWVS[bD$E$IE@0u ǀE EEEEPEE9UED$D$ $M MUp))‹}W7‹}΃K$}D$E$諤E[^_]ÉT$UD$ $M荝MUuE@uЋ}΃stftU)UEu=u$ȉ$sEPfB볋E)‹}WȉЋ}΃u1u$}}Ef}}ftEfH @D$$?1[^_]uruYPE;ED$E$1KfkPLfExUWVS gn~jD$,D$ƀ,<$EtE D$ED$<$-D$$  [^_]UWVS}u D$4$ߡFFy ;F|/} t)P}D$4$ӡ[^_]Ét$E$UVS yÀ}uD$4$gD$D$4$ff D$4$c [^]US '}ED$ E D$D$E$2[]fffffBfBfB B UWVSh|PQ@ $(DžDž XhD$$E}tmpЉD$D$$*Bu t< u򃽴#wH@+9N4)ЍW9w։)ЉG 1ҍ9tftH<@ lj)9tA;wh΃r2놋D04$ݿ@;y$@ Džh[^_]Ã< t< t򋅘D$4$){1Ҁ8 Hit$$rzt97 tb t] 9vx0D$4$Szwpd u뉋@ k‹tft4)‰NDžLtftQ :)9<44$q@;‹hD (T$$…9+Qf 0Dž1aP$%f  (D$$B+lj$Dž>f`BUWVS`-4vEEE5U1ҋ@E4i D$ .u‰t$L$E$X(}3EE4$*ML$ML$D$ t$ED$4i $0t\E$E@ U+u_`[^_]ÉM4i $!0MB΍3EfMUEPƋE$u_UWVS(tE8P4i tkEUE<$*ML$ML$D$ |$ED$4$/Ut/E$E@ ([^_]ÍE듋MEƋE$t([^_]ÉU荃4i $.t4i U9UWVSMxubx u\@@ HtEӋ‰t"ƃ))u)9|[^_]UWVSXxsE}E 5M1Ƀt/۸/1M+X[^_]Dž;E~F D$.$  ,8tGt2fDwu<.tfD$:$芄htOfu:t .Duـx.0}GPuNWP v@9T$D$$ '@8@lj)Ɖ$觶@92‹Љ@ э:E4$|$D$t$`D$3D$ XcD$D$$jDž;E袵1D$ D$D$$y.+1hsfcuCu*>X1!fYUWVSdo׉E EuM52u1} }t*}t$1}+> d[^_]$(蹽u3Dž$1돋ωAfAffQ 9fED$D$ T$D$$;@ u1$ЅyD 9c}}FPVDžPw9uDž Dž@44}}} 9}#GV'M<$^NNjE$QN$O|$t$D$ D$D$$%1Ƀ9)‰T$D$ D$D$$p9DžA@ u$Ѕ48D8 9rQ4$;fF$;ǍF$;Ћщ;wfp1$R1+ BGD$t$ D$D$$Z8Džx#@ k4$ЅXCf ft ftāD$$R9P u,04$ t~9)9nv8Ћtft1%dUL}BDžDž O819tl!9hu牕f zOut|J9~ 9~ oti9~aGH0f9~fpfJ2r 9uك9u@ +x+)9~փ $u+Q)9nFNjtft4$=2,D$t$ D$D$$3Dž@ 94$Nx)9}T$t$$>1D$ D$D$$%-1l$轪p)9HEEUSS$D$D$@ ) D$ i D$ ED$E D$E$[]USßSt$D$D$ @ ) D$ i D$E$[]UWVSRUS($gtDÉt$ D$@ ) D$ i $ًU EƉ$p[^_]1[^_]UVSR) tpǃ i ǃ$i ǃ(i ǃ,i ǃ0i s#D$D$ @ ) D$ i D$) $"Ɖ[^]Í) $] ) t#ΐUWVS"RƉU ,8DGtlUU؉U0tr\G0 1 4H\Gu2.utE]9t]srBDGu1[^_]Ã0 vNȃEt0虏D$E$mİ[^_]ËMx1DžlDžpEP:E@ fu%!tMfA E$_cDžiED$ E UD$T$E@$t!Ѓ8E@0tuN@9t$rE@0E@MAfa D$ $lİ[^_]_~MQf7xD$$nE@ UUuVLfF EE UdhE{@ fbEPPHTE@\lp+lp։ωlpMI0T XZMI<\)ωlplpƉ׋EH8+H1)׉lp\bf uBldh9p|$1lp9dh=ExL߉#dh!D$ |$D$E@$t!ЃyE@@MA0tI@9t$%E@0Ef` ߋd)lt.$E@l9})ЉGD$E$ij1İ[^_]ËE$:`E@ D$ D$D$E@$tЉlp!ЃE@ E@)lplpE@0tE@<)׉lplpE UuEEP$dE@fuxT$$jE UEUԉdhu~TvPlpNEAu+Flp)@0TXEt"@ fbE@u~<\@\E@ fbE+H1ҋlp)׉lp\DžXD$ D$D$E@$tЉщ!ȃE@ fbdtl)UB+tЉJXt+@9t4$Ex @0TTߋ}fG D$<$g1 nfffUWVS4+2CEMHM@ED$E$f1EEEUtED$ ED$E$…uuGE$DžID$E$f<$14[^_]À}F|2 EtNML284֋EUDMD$<$Y…Mzȋ}׃;tftE׉ED$E$eEED$<$Suu؉}}}UzMqBtz}u:Euߋ}OMMU8|U88uu}GEE@EUzMqEBu}<$REE ^E ]4[^_]E89 JEܸ)ЉEЉủ}ԉ ;MȃEU8Puut9wE9Eu}ԉ)։u Et)E9rU9|UEEEU؋Eu 0M܍D0D$<$U M}}ωփ}EEuq}8}xEEE9Eủ}E#E\E\flM}8}fEqM=uU8Uuu8EuMU8mU8aU8OPu8EuÃEU܃9Ufl1맋EXM}܉DfmNm.ffffUVS=uF0t$ UT$T$$g+tM F0[^]ËE F @u1N8TuD1fffffffUWVS cb=Éσt )Njt;u&CL$T$$P tZu` [^_]à [^_]ËCL$T$$Pt#tɋC|$8i T$$P [^_]1 [^_]ËC|$4T$$P [^_]U EE D$E$U]øU Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]U Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]UUM ttt1]ø]ËBM U]B@]UUM ttt1]ø]ËBM U]B@]U Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]U Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]U Utt t41]ø]ËBML$$tEM f]ËE EBML$$P]U Utt t41]ø]ËBML$$tEM f]ËE EBML$$P]U Utt t41]ø]ËBML$$tEM f]ËE EBML$$P]U Utt t41]ø]ËBML$$tEM f]ËE EBML$$P]UVSM] 3t@t+t 1[^]ÈUuAut$ $PUtۈ[^]ËAUT$ $tUUVSM] 3t@t+t 1[^]ÈUuAut$ $PUtۈ[^]ËAUT$ $tUU Utt t:1]ø]ËBML$$t1UM ]ËE 1EBML$$P]U Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]UEU Mt]n]UWVSƻ6uE tbt;t 1[^_]ËEEFUT$4$PtڋU ;MvIuɅ$E 멋FUT$4$tME;MwuQtbtkEډ>aY}ME$kE E1]u[^_]ÉL$M$׈ËE ۋMu4D$$ENUE D$ D$D$E$l]UWVSu} EE]EE|$4$t2Cu Ct9 uUU u[^_]Eu1[^_]UWVS4uEE 8t utQ<$ zEED$4$qtM;Mwtmtt(1[^_]É<$ۋE [^_]Et>uu}uE<$藋E E랉ȃttEM밉MD$$NjE 8Mu4D$$CEU D$(#E D$E$]UVS]tZtIt 1[^]ËE M QUECUT$$PtҋCUT$$P[^]ø[^]ËCUT$$tCUT$$tEMu F[^]UVS]tZtIt 1[^]ËE M QUECUT$$PtҋCUT$$P[^]ø[^]ËCUT$$tCUT$$tEMu F[^]J@UVS 2uED$t$ ED$E D$E$~>.t[^][^]US谶÷1ED$ED$ ED$E D$E$$[]UVSpw1uE D$E$tE)[^]UVSEHt9.Q.tFÃ.t,.tDuQCvCv0 w[^]Ã߃AvXЃ wUtމƉ뤍sw3Ƹ.듉ރ߃Av܃0 vԃ-u ӉQ|svŃ0 v1҉[^]UE8*u P.tt E]]ÃE]USUtGÅt91.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]US訴ï/E D$E$[]US~Å/E D$E$[]USSZ/E$r[]US07/E$@[]/5U/E Mx.5]UEf]UE]UEfU f]UEȋU ]ffffUWVS$菳ǒ.E EEEHEËU 6Ej9U 9UXr.Eƒ>@tK9U-@>}A4EHMtTAcI} BEE E1ɍ6E ,EЉM[6U|$M $r<Ut|UM)ȍ<FD$ $B<UUM)ȍ(E,\.u+E܃E%E}9}EM؈v/M؅<.U܃uyUD$]E$8;UEE+EP~xF~EЋDx0~ru9}19u(EEEE15EU}f떋EEtEEvUD$ED$ED$ ED$E D$E$]UWVS0貦!EEEx}܋EZE@}8uEU1i@(HˁLʄűE EEEE̋} EEEȋEE:uE;EEԉ}؋EԋEEtzEutE+uuЁ?aP0t;ME?@ ƋEP0uEE}EuEE9Ed}؋]fEFFEE 9]+E fFEpB'}1f6EpBUWVS$E5 M1D$D$|$ ED$E D$E$t8ED$D$<$tE+uЁ$[^_]úUWVS$VUE UM5;}1D$ D$|$E$lt-L$T$ ED$D$<$U+u $[^_]ÉTUS]E M9r 9s9vu[][]UWVSvyEE;E szX0t0ʃ@t:ttS`([^_]ÍX;] wދE1[^_]9] v)Au@u#!E!39E w뾋EEUVSğE UHu'u#9w5)ItAZ…uމ+E[^]É7`[^]É!`([^]É+E[^]UWVS5@EEUu Ɖu]Ӊ]8]}N 09Mvy 9Mvq9uczPt$|$$U]FuCU270:ۅtNt% t][_[^_]1[^_]Ë]6_([^_]1[^_]UWVS DKu}E9E |2&6D$D$$EFumtF;Gt1 [^_]ø [^_]UWVSݝU2E uuZ1[^_]ÉuZ9wBZML$ ML$)D$D2$xC9E~E}ljr[^_]É ^( ^иɉ]?UWVSME tjX1u%9w8L)ÍF[tA…uۍF[^_]É][^_]Éw]([^_]ÍF[^_]øUS芜ÑE D$E$j[]UVS_fuD$D$$YtD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]fffffffUWVS 进EU܉Mtȃ"uuFE]\$$hZuMÀ-u+EEE}EډU1709M~Kt#E;]])ˋENQЀ vQW9MU܅ttFEE܋}8؃ [^_]EEpEF0E E?}UE<;]PtI]˸YQp7;M3Z" ;M~Z"EpEZE܅to}81u [^_]UUT$ U T$ ,D$E$]UED$ ED$E D$E$~]UUT$ U T$ ,D$E$G]UWVS IPE} E0E@0zE@1/tftE@EM)ȋ}GU\}EU2D$ED$4$.Et)EEEEEUM 9s[=sFt%  Ɖ Ɖ  pt$$ve…t_EE 0E0Mȉ׃u_uFE$jKEu[@ VTEfH @ [^_]fEǀw@ @u}]t6EtE [^_]ËE - VruUWVS%,}D$<$4|$ ED$E D$E$D$<$ 4[^_]USǔD$Xi $![]UVS薔Ýd.5uHi [^]Í&D$$z"Xi $,"ƅu$^ƅtD$Xi $!FFF US TU T$UT$$ []UWVSœKD$,D$ƀ,<$vaE t8ED$E D$<$$|$ D$D$r$!E$zjD$D$$a[^_]ÐUS$E D$E$5W[]US E D$E$W[]UVS Ƌ$5eFt)VtF D$F$ҋF9t$Z[^]UWVSip E։ϋMt%L$UT$ $[^_]ÃD$$baƅtM1UWVS u} GD$F$ uD$$U[^_]UWVS,貑ù 5M1DžDžDžDžDž$t3D$D$ 6D$D$<$Z=~j$ti pi 'pi T$ D$ti T$$1M+,[^_]D$<$Yx6T$$Y…D$D$$҉t6t, L$ D$T$$ ;t${XDž$^XDžYUWVS褏ë @l$xD$Tw4$E9`i di Ed$RD$4$r]l5`Nxi h|i txhDžptLGtWt1 t $QaW9tu$;aGt$&app ;|i rhth$`ǃ|i ǃxi pi tti t!t1te;ti r狅ttt$`ǃti ǃpi `$zA|i u;EU`i di d$l$1Ĥ[^_]ÍT$ D$ D$xi $Q UWVS(jq}u OW$tRGED$D$ ti D$pi D$E$R1t([^_]Ë3UWVS ߌ}GF8iL$ D$D$ 7$WGExsE썃hE荃fE3E$`WEE9GE4G0D$E$1WGD0t‹E$WGD0u7$VGD0t07$VGD0_@7$VGD0JQ7$V7$ U [^_]ÍUWVSkr|i 1u9|i vxi <D$E$ZOuΉ‹OtAGEt"1Ut $]O9uuUU $i]GUUD$ ED$<$UЃ[^_]$ |i xi Etxi 1҉Ѓ[^_]úUWVSlkrE~EsEhd.5Ehi Phi E$EEčD$D$ |i D$xi D$Eĉ$|O*PU@E1GE0EEEM E t~} tpD$4$MuOGUT$L$U$ЋUBuMu#TEM9MEU4ЋM yuED$D$ ti D$pi D$E$}NtMPtFMMЋMMԋUT$D$ P T$@D$EЉ$>NtH @,1EM9MXE$=Ehi ul[^_]E\<$0li U 9PuMEAli li E<$l[^_]Í\<$EtUPU<$RE0E1U<…uEEEHhi  MEAli li E<$<w <$'EtUPU<$ EEf̀rS[@[UWVS軆ƉUM}PЀ wK1HЀ w%0P9~:GT1[^_];U|E[^_]G1[^_]UVSӍu$1ɉYts‹M)::t Ѓ[^]ÍB$;1ɉ…t4M)::uʍB$<1ɉ…tE1UWVS蝅ǠhFٻ]t1lFdVىudFډi >-00u[^_]Ë]!؃[^_]UWVS&]ƉӉMudi)\P(\vB;SBLLL);Q= ףvEK My *)R)ǃQ))|gfff)DbQ)))׺$I)))ljC)S}u v u싌 84)֍t09@9| )~`E@E썀 8Ƌ}|)9uKEȃ[^_]ËC )KEȃ[^_]ËSBLLL)KEȃ[^_]ÃC)*E B9At DËA+BuA +B uA+Bu A+Bu+UWVSMP|$ D$T$0L$,} \$THx|$\p t$FD$hF;D$@l$<D$|<u(3lFdV-00tD<<<sĉ|$,,$<\$ <D$ \$T$0D$D$9D$ W D$\$,hF9u͋\$  L$0hF9dFL$,+dF1G D$D$$D$E$T$(щ€|$;;D$D$$D$E$T$(rщ€|$; D$0dFT$,+dF)1W G 9\$ W +\$A7T\$#7\$UWVST5v<U0xu}ʋ IXXU p x9uU|u}ċUIlX}t`XE.‹EEƉ)Ǎ)})lj})։u;MEU+EUĉEUEEE<ED$QD$ u}4$|$'EUD$QD$ 4$|$E.‹E}:))})+}Ѝ}lj׍))MD$:D$ EU$T$}|Eиk9)Ѝr)‰)))D$:D$ EU$T$!i"EU}MЍ_uk9)Љ))щMD$dD$ $T$E nD$D$ EU$T$ Ѓn9EpSc} :)șEUEȉỦƉ׃MЉE؉UD$D$ 4$|$EU܉E؉UD$D$ 4$|$EU܉E؉U܋MЋE؉EЋEUƉ׃MEUD$D$ 4$|$zEUEUD$D$ 4$|$REUEUMɍU)‹E+E)‰UEȋỦEUEUƃBm9Eu؋u}ƔE9EpUbE}x$I)))MEUƉ׃EЉUD$D$ 4$|$UEUԉEЉUD$D$ 4$|$-uƋEM荄5ƺ$I)))ƉyEPųE }O)M)ѺW)Ѝ)ЉUM9ЋME؅J 8E@]9|u)ӉFT9~]UEP @ ]X$T[^_]؃ډƉD$D$ EU$T$D$D$ EU$T$׉ЉEЉEMmM؃ډƉD$D$ EЉUԉ$T$yD$D$ EЋUԉ$T$S׉ЉE؉ЉE܋MqnD$dD$ u}4$|$ u$D$D$ 4$|$ lP8g؃ډƉD$D$ EЉUԉ$T$D$D$ EЋUԉ$T$ЉOE<E0/T1&EmUVSHnOuE$j E tuj t dVP([^]Í8P([^]Í8USJMt50 wsS$m1tX8/t}C []S $ t%8.u S$t8.tH1[]S$mlzSH-t++t>[]S$15CC[;[]UWVS.ED$ ED$ED$E$ƅHE@9EE}G}mș+EU؉9‰F1EԃEt}<$}Ћj 1(ƅEЋj t"dVF(M]؉ș9둋EЍ8UWVSdi|$\T$PL$,fB<: u3|$X5|$Pa )GD$XT$X|$PwGW9|`Y`D$\T$`>|$T9t3T$`3TD$\3D u>L$Tt΋D$P@|$PD T=Y`Ӂ|cD$\T$`7>^t$T OT$`3TD$\3D u>t΋t$TD$P@1T$P9~[>u|$PlFdV-00t:L$P> hF1\$XhFt 91|$PZ1z\$\ $8e[^_]ËD$\lD$D$(9D$@tSD$ 9D$@tAD$P|$$xt$@pt$4p >t$Tu4t$X8>D$8D$D|$LT$HD$<ƉB ʉ։߃9D$Xu|$<yD$T@L$DAQL$P\\$D$$L$H1:t|$P7>9y;|$@|ӿe[^_]ÿ?e[^_]1D$Dgt$H؃  ȃuyƉ;t$<|\$T\$\!8JY&L$HD$PpD$PdF1L$HD$X4 u|$XyA<CA;D$4C;|$@|L$H1L$H\$4t$PdV9|D$4D$HL$4dV|$Pf@?|$$dXD$@D$HD$XD$4D$TD$8>tE1t$PFD$\=E0, [XX\$T ;A Yzl$Ty\$\\$\K\9D}%\$\DTUD$X:>NE9]D$X1ҋ}  T$\L$P]D$XA|$\;|1TF;1XF;1\F;1`FD$\|$\9 |$TT$T4$\$\T$TЉD$T17D$XЉD$u)T$lt$pAT$tD$\멍AT$tD$\t\$t|$hGGD$t؉dFƇhFLJlFfLJpFLJtFƇxFLJ|FfLJFLJZt$Xw dV\$lډNjt$psgtftt$l0e[^_]D$PD$Lxw1 y$/\$`1 Å$1ɋT$h|$`y7Ɖ$*(D$htoD$PD$L1 @D$\Ru>uT$\)щL$TT$tT$xgD$PD$LD$hxD$tD$Lt$h>>> 9f |uA؉D$`1҉|$Pt$h>hF>qFuL$L+L$`L\dFt؉D$`;T$PuD$L؋t$hdFƆhFdžlFfdžpFD$x؉tFƆxFD$X|FfdžFFdžZD$h\$HX dV\$lډNjt$psgtftt$l 0T0\$T؉׋t$\stftD$T0Ũy{dXt$hdXeXeXfD$`Gf\$hdVeV\$lSf=AyD$Tf.\$hdVeV\$lST$x\$x|$XD$`T$dD$DD$@^i)\P(\wU= ף%Q3D$`T$dp;\$Dp0\$P9؉\$L}"D$`t$d|$Dt3뿸븉|$ |$@t$<D$<\$ D$@|$t$~i)\P(\= ף%Q3D$89t$Dz|$DL$@ D$XD$`T$dD$0T$4D$T$0T$T$4T$D$hT$0TT$TD$u0T$P9T$T$T$L|9t$DD$hL$@>AD$@D$XD$`T$dD$D$T$ T$0D$hT$TT$0Tp+L$T$P9ыT$0T$L|9t$Dt$@0>FD$@;|$D$}QD$:t1ɋU 8vUWVSLNji t@U$n =EU~)|$i $u[^_]ÅxEi }i 8dži GXx2>ui Ei [^_]Ë_yUtPىfu$ZVÉi ;8dži 1냍D$|$i $UWVSzJEu] N~61hF9u lFdV9ut [^_]Ë] 1[^_]UWVSJE] H~.hF9udF9ut[^_]É [^_]UVSIî4$n1h4$_[^]USqIx.v$T[]/UVSFIM4$ .v$4$[^]UWVS I $ZNÅtUDžu ؃[^_]É$M 81USHöE$%[]UED$ D$E D$E$]UWVS_Hf<$&.v$4i D$ D$ED$i $=Ɖ<$[^_]UWVSG<$.v$E D$ D$ED$i $Ɖ<$u[^_]USGËE $j 1ҋE tj tdVP([]Í8US2G9i $j 1ҋEtj tdVP([]Í8UVSFu 'i $j Ertuj t dVP([^]Í8P([^]Í8UVSnFuu E$j Etuj t dVP([^]Í8P([^]Í8UWVSF <$.v$i D$ D$ED$i $Ɖ<$t 4$9 Ɖ[^_]UWVSD$ $i tXuE E5EU1҅[F8F 8|Ut$ R$D$D$ }<$7EFEFEv <$5U|9|$$}|$ }|$}|$t$L$T$ D$D$Hu4$&4$ƒv k 9EurBMσsOtftEMU+Ġ[^_]Íj"F j" 9NusuZT1E??? @??? @?? ?@ ?:??@:?? @????f@ Xfyu{ UV<ak D$E$]fSL$D$ &t@AuD&€tAt9AtAt9Au΋D$[UWVS;ȶUE ,9t%\_ptwf9t)[^_]1[^_]USl;sLk u#$Hk tЋE$UWVS%;,e=t:F$V FtD$$B4$e uƃ[^_]UWVS:ŵ}ƃLk $tCƉxtD$<$E FEF e1[^_]ÃUWVS}t3Mˋu Ήt$E$Ut~uu Wׅu1[^_]ÉUWVS 9EU΍`k <$t?$)tYMHMHp k k <$1 [^_]Ík 1 #txu8u막<$oUMU E]HUWVSE9D`k E$/|k k 1k E0E}Uׅt&k ϋCtT9S tuߋu}샮|k E$|k ut?$& u[^_]Åt*k MK uIUCЋUk ;EuO|k u;]rF;]sAktڋk MUCK $ЋUk ;Et׉E](U11ҋE]UWVS7ME0}U5E1E (,hEED$E$GD$h8$hǀPǀTǀXDžDE ,(tY8HE @LT$ |$0D$8$8}+>uE[^_]Í78HDž@DžLVT&Us6~UT$UT$ ,D$E D$E$X]U56@UT$UT$ ,D$E D$E$]UED$ED$ ED$E D$E$]UWVS5ΰD$ƀ,FX$F`F`y ;Fp|4} t.FXPVX}D$FX$[^_]ÍFXD$E$USB5IE,Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$c[]US 4E D$ED$,X$n_ []US4úED$ E D$ED$,X$_[]UWVSs4z} Ee E EED$E$6E@ E@U~1M19ssE}EtfEtME)‰UE$[U/E@뮁}bE KEE[^_]ÉЋ}tftE)PD$$EEE[^_]Ëuulj7wWU<$Uu(w+WuދECMAAA듋E)1u EMuouV0xTEfH @EUD$E$EU)1u EfBfmWMyHM2US 2ED$E D$E$\ []US1ED$ ED$E D$E$\[]UWVS1òED$E $JƅD$ED$E$׵xy=_fFf~ vF$F,F(F EtED$ D$D$4$[^_]É$EfF 1[^_]UWVS0ʫ}D$<$w fD$<$[^_]ffffffUWVSk0ru 4$;EU9v 9ru׃s$u8u:Ѓ[^_]Í 9rU9sՉ׃ru$u,tftƤЃ[^_] zfRffffff!̀rS[ð@[UWVS/Òu F0u ǀFFF tBNt;})9F~JnJM 9FtHF t t=[^_]É4$u:N})9F4$u뤉4$t ffffffUWVS.ƲӋ} UU tau! uމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]{ xy1tv҉)Ѓ0CUtʋE9ut ~sECExtE1띺4)0Kщa0C[^_]UWVS `-gUM9 ?p9s΃ttUUED$t$E$MU)UD$D$$E}E01 [^_]ÉUE~ED$t$E$vMZu9EU JHJHJ H JHJHJHRPV|U 0U$0VUWVST,T$L$\$4\$11҉  r\$\$,D$0D$ D$$uHtDP%uD$(\$0\$XPZw Bt u\$ 9\$$G|$$ D$D$$6 L$, < C1ҍTPЃCHЃ v$h։YD$(UUU9t$09t$$st$$D$,D$ 3L$(D$(UUUp9t$09t$$st$$D$,D$ L$(D$(bUUU#9t$0 9t$$st$$D$,D$ UUU9t$0*9t$$st$$D$,D$ _L$(1HЃ  1҉t$ \$Ӎ\PЃpЃ vt$ L$\$ \$<$UUUV9t$0wT$,L$9t$$st$$D$,D$ D$(UUU9t$0x9t$$st$$D$,D$ sL$(ED$(@s࿀ D$((D$(UUU9t$09t$$st$$D$,D$ S*j HЉӃ CPЃ vL$(UUU9t$09t$$st$$D$,D$ L$(]D$(-UUU9t$0wL$0T$,cm9t$$st$$D$,D$  D$(; D$(L$( \$ \$34L$,st$ 9D$$;L$U $1e[^_]Ët$t$L$,^\$붋t$t$vtL$,t$^\$돋\$ \$stL$,\$st$eD$(ttUUU9t$09t$$st$$D$,D$ UUUN9t$09t$$st$$D$,D$ D$(D$( UUU9t$09t$$D$, D$ qD$(UUU9t$09t$$st$$D$, D$ )UUUy9t$019t$$st$$D$, D$ L$0T$,e[^_]D$(uD$( UUU9t$099t$$st$$D$,D$ {UUU9t$09t$$st$$D$,D$ AD$(UUU9t$0wL$0T$,(29t$$.D$, D$ L$(@L$(L$0T$,L$0T$,L$0T$,L$0T$,}u+$t]T$x.$$ C$$$$@$T$x_$8\$HtD$H$$$@ @ftD$x$t$9t$$D$0$<++ED$xe[^_]Ë$<$$ȳCG f 4$fx"$$DŽ$DŽ$D$$$$UD$$8$!$ǁPǁTǁXy 1??tft$B f$f$Bf$B$B,$BD$$<$$DŽ$DŽ$DŽ$D$DD$ D$4D$D$`DŽ$$"T$`sl$`뚋$$$$$у~B8@$Q$vDžuP1DŽ$$8p$$$:t$d$D$$$$胄DŽ$DŽ$DŽ$11ۋ$(ukDŽ$D$d$1$D$$$$DŽ$DŽ$H1ۋ$$$D$$$$賃DŽ$DŽ$D$d1ۋ$$DŽ$$t$dn$$$Ƅ$-$$L$\$ׁ|$hу$D$l$$ljօR DŽ$$@D$pD$dD$`8D$ D$ <$t$$bqlj։ O$AL$|$D$ D$ <$t$$o0L$|A$$D$hrD$`<c9[ 9GA$D$\AD$`xtD$`D$ D$ <$t$$pljDŽ$t?$D$$$$|DŽ$DŽ$$|$D$(É$$DŽ$$2$$$fD$pOxDŽ$$$DŽ$)t$h$$$D$$$$蕀DŽ$DŽ$1ۋ$|$d}$$$$|$p$Jƒ$G$B$vÅu1ҹ$뷋D$pD$$$$DŽ$DŽ$11ۋ$fDŽ$$$K$D$l$$@$D$$$$DŽ$DŽ$^1ɋ$D$W$|D$P+$} 6D$Wttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVSéN}ED$E D$EE$TfFE܋HF\$D$D$D$D$%-MM0U$T$ 4ƅGT$ DV 9ЉT$ v")HFL$D$$T$ ЍN99T$9Ӄ9uT$9Ѓ9uU'} ];E tE C9wwN9ue[^_]ËD$%-uMEED$E D$F$3Ɖe[^_]ËED$E D$ F$m3Ɖe[^_]ËED$E D$U9$;3Ɖe[^_]ú+]~ t$^L$E$UE|tET$r@dUWVS K}m|$D$U <$~c0Fm܋HF|$D$%-BuM%U$T$ 1ƅ<T$ DV9ЉT$ v")HFL$D$$FT$ ЍV99L$9˃9uL$9ȃ9uU%}];E$tE$C9wuN9u [^_]D$%-@uMEED$E$D$F$0Ɖ [^_]ËED$E$D$ F$0Ɖ [^_]ËED$E$D$U9$~0Ɖ [^_]ú6]~t(^L$ɋE$UE|tEL$sMeUWVS` IE(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$`¿PFD$DÿED$ED$ED$E D$D$DD$ D$HD$|$dF$U:ue[^_]D$DD$DD$DD$DffffffUWVSĀG}== =DD$pEU D$PT$Tu %=D$PT$hq D$p~D$pD$xD$ D$|D$D$h${D$HD$xD$LCD$hD$`D$l% ?D$dD$(D$`أxF܋F܃F݃FL$`L$`|$vD$v fD$tl$tT$Xl$vt ؋T$L)ʍzt$X&\$hD$,D$DD$8D$D$H$sD$HD$`D$`e[^_]D$pUt$T%=dE'E  D$E D$F$,D$`D$`e[^_]D$,D$DD$XD$XljD$ D$xD$$؃|F\$LD$LT$PD$-@D$D$$أFD$ ؋D$$T$(D$LT$P|$DD$<L$8|$h+|$HGD$xuVt$D)9D }D }: )ЃD$x}~T$\~ ;D$\ D$TT$,L$0ȉD$0T$h$UD$DT$h~t$T~9~D$x)D$0))D$TD$,t D$8eD$,)U$HUD$hYt$X} D$Lt$X+t$Tt$xD$0D$TL$ D$\D$8Fr |$DD$L D$xt$l|$X|$Dt$Lt$d$QL$TJ Mu M9 ~ |$< D$LD$LD$dAD$\9D$x D$D$ 4$Rƅ%;|$XD$D$ <$lRDžD$D$ D$X$FRD$XD$xD$hD$4$TD$H0L$d|$4$XD$TL$XL$D$h$X…@ T$T$84$[XD$DT$8$PD$DM(M L$Dʃ T$<L$dt$d|$D|$Xt$L9 |$Tz L$H1E VD$DD$X|$DED$`T$\D$h$&P|$DT$\_D$Xt9tT$h$OT$hT$hD$D$OT$h*L$TD$ )D$0|$X|$T|$4D$,T$lD$D$d$MD$x} lj|$D)D$HT$l8D$<=D$E݃FD$hD$lL$ll$t\$ll$vD$lD$xED$8D$D$\r|$<t +D$0tD$8}rD$\D$D$D$h$KD$hD$D$d$RRD$lP1D$4D$` T$\D$h$LJt$DT$\=}D$\|$,9~)ljD$\D$xD$TL$0ȉD$0D$x?T$T$hD$D$ND$Dbt$dt$$\LD$dF4$IT$h|$HE@D$L;E D$0D$TD$Lt$\:M؋F\$LD$hD$DEЉD$4T$lD$`؋D$<؃D$`(|$HE@9E Ut$D$D$)OD$Dr?+T$,T$X1҉D$,q|$0+|$\D$xBG$6GWx q dtftD$$NDžD$<wz4u2D$hvt(؋t$lD$4D$l1D$` D$`?0tD$41L$dt$d|$D|$Xt$LT$<*L$`D$D$d$MD$dL$hL$$NL$`9oL$H1D$< L$dt$d|$Xt$LD$X|$DnD$hD$DxT$dz|$<hL$`|$dAD$D$ <$GDžD$hD$<$0D$`L$\t$dL$dt$D$h$ML$dQT$\~L$\D$`AD$D$ 4$GD$d9t$D^D$DUL$dt$d|$D|$Xt$L9VD$DD$X|$DD$` vD$\o|$؋PmT$8XVH؄tJuU tu ؃[^_]11US薝ÝEHP$A[]UWVSD[fEȋE @E]9C] {ETU]sučDEEH1EԉE9EEEE}EgEU܉Ӊ1ۉM؉]܋1ۉEEEUEU)Ӊ؃EEN9}s}]3uAC9Es0uV+E)‰؍M9ttMЋE]ЉXE D$E$]HEԃE̋uEE1ۋG1EU)Ӊ؃EEN9}sЋMċ]Ѝ2u4B9s$C+U)Љ9t\tUЋE}ЉxẼD[^_]1D[^_]UWVS`mt58}1FHDžDžDžDžD$D$$RT$ ِD$D$$r11 rD$T$$2$1$#2U耚GUhs HUfffffUWVS;BuM 1Ҹt B<uDU$pdtNjUruu [^_]äftf9t뫍J‰UWVS踙ÿu4$ZP$UctNjUruu[^_]ä[^_]ftfff̀ffff̀rS[@@[US$D$D$ED$ ED$E D$E$^[]US՘Et?=?Bw@EEED$E$(1[]1[]>Yfq P+US$PWEE E ED$D$ED$ ED$D$E$ ؃$[]USED$ ED$E D$E$b[]fUWVS諗òUBJt@9vtЃ[^_]ËJ;J}ABDЃ[^_]ËBU$h:tËUJ<}x r s$EtfEtE$^;EHuuMx r mfmUWVS0讖õ׉T$$L$T$(T$ T$,T$$EƋ?D$()D$(D$,5}}<T$D$4$/7D$ЃD$ D$(D$4$7T$D$,L$$Q9L$$Q9T$,EV"FD$,D$ {M 014$9e[^_]ËU t:D$,D$D$ L$$Q9p)L$T$,9}iFEPD$ L$t$|$E$5EL$ fBU NVL$$AuL$CT$?E #DD$$D$D$4$y6ED$$RD$,@D$$@ D$ T#9D$ D$(1؉D$4$?ƅ4$mƉu|T$ FD$:T$ 9D$u FD$D$4$5D$,D$,D$ NT$ L$ #TY )ЉvD$tr#DD$$D$D$4$E5ED$$u"D$,D$ PD$,D$ 4$sƋD$,D$ `L$L$$4$4D$L$$&UUBJL@9v t]UWVS u} G9FVt]F9v w $G $D$<$2T$T $D$<$N&ك`I ؋$8 T$HD$8\$0D$$ DŽ$D$\$$Ɖt$Hp\]؉]1EEډ> 'M9Mv9uv 9uHؿXHt4U tE ‰؍XHủu;]s A;]}ދEإ9v}؍GS9)߉} T9E)D$D$ $]"Eԋ@u%E9EE؋U9tt<[^_]ÍF}<[^_]Íx}ԉE19usoF1FEF}}܉1S؀ w P v0P߀Xxx nf_)E )Nj]̉uȋuuZމ MB;Ur]̋u]c 5މӃ)u!Uu,)u}ԋG]ą )ٺ!ЉGlE؋E<[^_]ú} T9)E )Njډ]Zމ MB;Ur]|H pfUWVS0 k ]E$=E5Ex0?EE0V0wF)<ƃP0tEÈE‹M<?t2M1U܉}} 8tU܋}߉]؀PEEE1ɅF}]܅E @ U4;wE E6}1tu$] ƋE0EFt!D$D$F$}9}~ +M}DE @}uE1ۃЋM<u:E)]}!T}Ju:Ћ]΀<GЋ]<u)]OEԉE1EUE 0BE]޿L$ME؉$]ƋME ;Et."L$E؉$]}#"fUWVS{a Ep98)} 19$btWUP@u} K}|> 9u~2U)49t$W0T$D$ $Hu1[^_]Í~ u u ;}t$O0L$D$ $u}1KUWVS0}`Ä }u D$(D$<$\$ D$ T$$D$T$D$,D$4$f\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVSx_ UME DEqAD9sץ9w)ȃTE9v#)D$D$$H[^_]UVSEPXM 9} u#9w1[^]Í~M t09tݸ[^]UVS^´ 0)ˉn u鍊xIa)ˉn u鍊A)ˉn u[^]UWVS} Eu^]9~kVU\ttt )EV9u]M ؉FB9UwU+U}Tt83E@E@[^_]É9vޥ9wE+E}Ћ})MA9tÃ[^_]Ë}GtUUVS+]2 UBJL19r $ 9vt9vUE$Ɖ[^]fffffUWVS\ d.5} vTMU$&ƋUEFVu3FF [^_]Í x M4tt ,$=뽺ME o )ȉ= @N ,$V ,$CUWVS[á ut"F w"d.5u& x 4[^_]É4$-[^_] ,$UMN? x 4tU$+[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɋEDEEdUƉ׉1D9MӉu} t"E9C~$E}|C؃[^_]É؃[^_]ËC$&tMSx s stftE$&Eu2uȉE$Efx s UEuAuuux @t]1ú ]U$7t UP@]UWVSM CFM9w}܋]K9rG)ڃtEEE]XE$E$[^_]å9vܥ9wպUWVS}u F_)u)ODT9s290tۃ[^_]UWVS,]E @s)KD} T9w:98tJC$ljE؅'p CEԍsu̍DE܋E EE @M DEGEЉEu11E]EEK1)@1)Ӊڃ1EEʉHE9EwËE HE+E 9ME9M ]ˉ]MЉM9]v9]A1)EU1US9MwًE܃+EEu}ԉڍ tUԋE؋}ԉxE؃,[^_]É؋] E x1$2E؅tNjE@@E؃,[^_]ù-1UWVSEpt$PtFD$^$+ )NjM 9 ~T |$9|$s%~?\$|$ D$ e[^_]ÅD$ ?\$1ι )D$ ?T$T$9T$r1ҍH Ӊ\$ D$ e[^_]ËV)‰\$ ً\$ D$ ?\$F9D$LF >1-UWVS $ÅE %tT$ED$tpD$$8T$ )L$ KT$SɃKuP-2uD$)E؍e[^_]ÍD$$T$SC tu5)‹E؍e[^_]ËT$ST$lUEM Q tJu]UWVS\Oc } tD$E $ƅD$D$E$Džtt ʃ9t-xD$E$Tt|E%=#t`fp ttu ffp MfH@¢P$P,¨P(P Č[^_]1Č[^_]1Č[^_]O1US N E UD$T$ D$E$[]UWVSM uD$4$nx$P8D$4$[^_]É4$mUSvM} UjxH []É$6[]UVS?MF UF0ǀǀ F 1F t V$ЅxF F0tN@9t $fF0$OF0ǀǀD$4$FFF [^_]ÿF tF$p4$zD  ffffff̀rS[0 @[UVS K uF0u ǀ4$iunP[^]øfffffUSJô MA 1f tЃ[]É $‰Ѓ[]UWVS mJt uP5FF ua'fF FF u}FVT$D$F$V$FV fV 1 [^_]ËF0tN@9t $KF0Fι EM uit^p4u ؃ [^]D$D$4$')Åu(4t udž0؃ [^]û먉 UWVS,>3 Ƌ4D$D$4$(EtE  $XGu͋$74t uW~ 18t $9⋆t$4$uu-E[^_]Ë}uEU#]EUWVS= ]tCƉ$g[^_]þUWVS<ȷ ljUD$@$ >ƋUu 1[^_]ËOD$M$ …1]~ˉ߃Mt~tctQt>t,tt<<<<<<<<<<<<9EC<ƅh}MԉL$U$NfD$ }|$/M؋ML$UBD$E܉$M}ȃNt5ExT6 fuD)ȉF]Ѐc1Jt$}|$E$u$ML$ ỦT$ut$}<$ϭt]Ѐc@[^_]Ëut$ ỦT$ED$M $藭uȋ]ЀcˋuurD$}|$ t$UT$M $薾>댉t$UT$}<$)n(H9 ]U9 ~(}Љ}u胮$dž dž(UWVS7ǿ M ]EUrt!u8tP][^_]Dt4][^_](dž,[^_]Édž,UVS7% M UEpEuU1҉[^]dž,[^]UVS6ձ M Ep}w=tE[^]`Wdž,[^]9dž,UWVSP6[ } D$$YƅǀMtz8xD$ UT$|$M $!S84$>81[^_]É\$E$l T$ ML$|$}<$ É{X TUMQ D$t$$F~^^VN~^F^V f F N F ^ nNNVFnN^NV~^F^NfFFV^fFN F V!n"N#^$N$F%~&^'^(V(N)~*^+F,^,V-f.F/N0F0^1n2N3N4V4F5n6N7^8N8V9~:^;F<^<N=f>F?F@V@^AfBFCFDXhH ݈JHXXhHJ݈ZJHXX h H J݈ZJH X X hHJ݈ZJ;Nx>alF]D$ J$ ;F@7~F(dž‰DžN V DDTNꉖD$ T$D$8$R]tEP {D$4$0MM4dž$$$ODžpGX!NG@W MO 6M_0=G%Fw[^_]ÿO$ȵX ,mr8E8F8FF F FFFF4X , ~D1 󫍾][U]StV4EHt }Gu]Stt V1v4s$^≕@DDDHN F$D$ D$ IL$4$B~BF0F(LN,NV<~$;~v~,)F8FF F FFFF4X , ^D1 󫍾󫍕xT$]$feE=~F $ F1T$4$h1!$F~ '8118xF8FF F FFFF4X ,9 ^DlUWVS$,Õ uF(F(NjN0!MNU9IF9MD$V$tUMF($AV 9} LDLDF F,9r|$}|$4$肤$[^_]ÉF0 F,ۍUE$Et]ED$L$M܋U$WME)EL$D$$U܉$MEFjUS]ED$U $ #C,9C(}#C0[]fUVS + EpFtD$D$$aF u  [^]UWVS*ê E8TumpXtwRuMP PDžPPH4xLxt[tS1ɉȁ[^_]DžXDžPDžT™55DžLDHD$$$ƅ0ǀDHǀ$$Ft dž qAAYA A AAAE UtZt\vFt$Ft$4$+1ɉȁ[^_]ÃBo DxD$ ED$E D$E$.HDE EIXu$EX=X Tu dždž XPLt DžCXL9sЋX1TG1Pf{fPTD$ XD$HD$$a PXD$D$$Xt?fx'8fxD$$nXXl8^D$\|$$5TD$|$$Dž~\q@@f@fGG D$D$T$1D$TT$$\D$|$$FX XD$D$$$XE t @E@t Ed UqDxD$J$~H D™5fdž~XD$`D$H$4` =b1Xd `abcdefghhijkllmnoppqrsttuvw`b19O!ЍDLDžXHDžX9FiXt$ ˜T$¼T$$蝫X5™5 dUhX=8/t_ lpH1YUWVS$V"] EpFtD$D$$諮FUED$E D$4$SDžEtwD$D$ED$D$ D$|$4$!@uFЃ$[^_]ÉED$D$$UЃ$[^_]D$D$$Ѓ$[^_]땺UWVSEU M HpPPHHpPPHH p P P H H pPPΈHPPΈHPPH t t][^_]ftHҍtPވQ‹ˉZˉZBtZ ˉZ Z ˉZ 9uŃ[^_]ftxҍtPu(r utMʉQʉQ;}dΈW‹ ɉ ZˉZZttr Ήr r ur Ήr ʉPʉPPʉPP ʉP PʉPPʉP[^_]UWVSEU U P׃X ރHpPPHHpPPHH p P ˉX ffxPΈHP[^_]fwHҍtP‹ˉZˉZBtZ ˉZ Z ˉZ ވQ9uŋX x#ʉPʉPPʉPP ʉP PʉPPʉP[^_]fxҍLPM3r utMʉQʉQΈW9}p‹ ˉZˉZZttr Ήr r ur Ήr UWVS(kr EpFtD$D$$FE  D$D$$Eb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$$eu ([^_]1([^_]UWVS7> }wFtD$D$$茨FD$<$~tx$臨tiFt$[t$It$7E4$&<$E$؃[^_]øfffffUVSEU Mw:v,290t49t)XJ8t)[^]1ۅuԉ[^]1ۉ[^]US  E;EwD$E D$E$ []WUEtu]11ɍT9w]1]fffffUVS UE XJ1rVȉ ȉȃ rȉVȉrȉVȉ ȃu[^]11ɍv1É11f1놉1_UWVS0ó UEEpt E 9F EEEEEFEFA~ MM܋FfMft LHfME}tC~ JB! 0Eu ~u܉CG GWPWPWxG8GFAW0O ME9Oft DAfEzD$D$ ED$L$4$O1EEtB#E ljEJE 苲E<΃}uH10EFAFF00[^_]E뿉UD$$nƅU=B UD$$KFUQt } ~ F}t\}wF~N1D$}|$D$ } |$D$$0[^_]F~N1D$}|$D$ } |$D$$蓁JU E]#u܋FD$M܉L$ |$D$$UFEM܋U F4$01EEE<$ƃtI<$D$D$4$覗tntD$4$tSD$D$$ȕM+u{D[^_]Í4$@v8D$D$$k4$c8?xwfffffUWVSxҌ E EċEE5E0u1ExGtD$D$$G }t5EQE}+8x[^_]G(<u͋EċPuN9Eu9rYt$ED$<$6seEEEEȉEE@EME؉EEċ@E9v]t$EĉD$<$r EEEEȉEEċ@EME@Eă9ЍEЉEJ}u[D$GD$$KGfEEEċPuN9ED$D$$ߙƅ'GfO @EV)‰UE@UB 9Er[tGFuKfuFGED$EĉD$<$@o)fLJO fMEYF?LJD$t$$聛ẺD$EĉD$<$@ƉE`ENfMu}3EEEċ@EUB ƉEAfEQfU)ЉE9Ef9UUfQEf+EfAufDqȉMMMQPMHp UċBD$D$4$rMAD$D$Ur4$rG( <Myt.D$L$$B}  1]QA;EuLJEfҋu)҉T$DqD$DqM$rMAfEAfEEċ@E  ]EED$ L$MEĉD$<$ƃM5D$L$$TED$ED$ED$ED$ EĉD$L$<$,ƅID$L$$9G|Gf;EnfGbEuFD$D$<$=`A5f}*LJfLJ E9GED$T$<$kO t4fMfO MfTLJ}'fM- pffffffUWVS,; B E@(ƒ 'EEEuTpF~> EHE)ʉT$D$$oEfx]\X}Wft*}M|y f9sf 9u}Dx}WMуft"ҍ PPf9sf9uExEfxE@(E <t 1,[^_]ËEu69puP;UvރufF1ҋu}?9~V;UF(  EEEfEED$D$D$D$ D$ED$E$gIUD D$E$lUXЉUF D$E$lUtF(M 1EUu^@f_E@E@9EEEEfEEH(EEfEut$E D$E$xhE@9EsEEEfEt$E D$E$2hNEH(EuFEfFE@tcVPD$D$$}FtD$D$$t&VPD$D$$@1 [^_]øqUWVS(ç ljU,E싗;UBD$BUD$$zƅUtZBPUTFEDuKFfuz>t$<$ut$<$iȃ([^_]ÉU܉M D$<$DhMUuED$t$$.MfME EF )‰T$L$M $DiEfEfFEDFfENUBft;ЉUTVȉM܉щuuf9sfUf9uM܋u؋ELAFƒEEfEt3Auu}}Af9sf9uu}VBfFD$t$$0E8tQED$<$4t#fFfFF 묋ED$<$7~1ɅfD$D$$1IUWVS4.5~ uExGtD$D$$耏G Et>tЃ4[^_]G(tިЃ4[^_]EEEED$E D$<$O4ƅ4EUuFE@  Vf9"t$E D$<$ bFD$ ED$E D$<$tD$ED$$kЃ4[^_]D$GD$$ƅt@fGD$ t$D$<$GF$UED$t$$ڍU 1҉Ѓ4[^_]fU}6fUfEUBfFft$E D$<$`FD$ ED$E D$<$FHfu9fFMAUEfNpFfEE@fE?1EE@ftD$ED$$蝌Mf9MtED$ED$$rUD$t$$TGEЍMML$D$<$10G9fEA‰EԋuD$L$M$F,EE9Mu2 D$L$M$躋E;}܋MGD$GD$$# GNjEA9Etf}ڋ98}fxVLH|9fAD$D$$D$|$$臈1Ʌqm}ufMډD$L$$貊D$EԉD$$:$F9kD$t$$jD$GD$$ƅD$L$$,D$ED$$:)M D$D$$ωUMIEt&DD$L$$|ED$EЉD$4$.0G,EO9NM܅D$t$$'E;M2D$T$U4$E9uU#EFD$FD$$Z…DF7ftփfEڋfPEHUڅt{MDFDED$t$$LD$ED$$ԅƅ@PMfPMsfUD$t$$D$E܉D$$kƅjP֋MU9fff1̀ffff ̀rS[v @[USu D$D$ D$ED$E$t E[]øUWVSßu ElE `5h M1Ʌt}u]uxVE%GpuFl8Z+Edpl9wD$/$mtDϺºDžphM+pİ[^_]à K\΀>X$>N;\u؋\D$ d)D$t$X$`l9r9?/utD$l$0/|%=@tW蹹Džpl8u+l}?URT`D$E  D$l$|!8fTd9RƋX K\)@u08p9d D$\$?u衸Et8D$l$^/JDžptD$l$d/28pl\fffffffUWVS>Er Eu U;Uwz9v 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xf7\fUSäq `$蔁[]UVS v}q `4$mD$!D$F $. [^]UWVS 29q }$F$F 1$FD$!D$<$7.t$<$V- [^_]USp `$貀[]UWVS|x]y}AEq uy}y}Y]IM]Z]Z]R |MUĉu]]UUẺ}u}}ȋE]]ME te kE2-byEnd 3Eexpa}Ћu]ˋ}11 ˉ]1}E1MM}1]1߉ <}1}]1M؋U1}1 щM1u1Ű}ЋuU1M1 }11u11 Ɖu1uĉU1Eȋ]UӋE11 Ӊ]1EM1ŰU؍ :U1E1 M11}}ЋMϋu1]1 ω}1]1m~u֋UexpaxUnd 3SU؁2-bySte k߉S MKMMȉK]]̉_MMOU‰W ]]_$EEG(EEG,UUW0EG4UUW8|]ĉ_<|[^_]UWVSlüm Ɖ׉M5UE1EEEEUEEEEFEFEF EFEĉFEȉFẺFEuЃs8tftD$@D$E$h*E}+8uBl[^_]uuuуf_WUWVSñl ƉTL5PM1Dž`DždQDž\ EX$)h }D$ |$X$1D$D$\D$ |$D$`$f߃\ ҃D$ |$X$J1TtLL$T$X$$1XD$<$.1D$hD$X$(hlFpFtF xF|FEFEFD$ D$<$o(F PM+u [^_]UUWVSj t,|$}ƅ~ ?[^_]Í`4$zuN2D$PD$v$JcD$F$h|Fƃ4$Gzb$?$? 1$?D$D$D$D$ D$|$$&ƃtoD$|$$u&tJt$|$R|`4$y ~ 11҉[^_]É|$4$%D$|${UVS65i 1ÍUQ9t E[^]ÍC$xE[^]UWVSh x}u 5t]1ۃ w@Éx9$tM+lĤ[^_]xÍEp ‰x9EEEEG`|)l9l)މd?hdt>`]|pډEuE@9|uhlqD$ D$p$x$lD]Epډ\Elڋ\ƃtf"UEplNEfHEV뎉ʋE/P1fQmMtTPtD$D$ $UD$t$$oSuʉu܋60fPEpu>E1ҋEYTPt2fBD$D$ $NUD$t$$R1҅muuÈrS[ÐC @[ÌrS[pC @[Ḉ̀rS[PC @[̀rS[0C @[ḹ̀rS[C @[US B EU D$T$D$ED$ED$ ED$E D$E$+ []B fffffUWS{B Ut}N NJNJNJ NJNJNJNBz(@1uCu4uuB B$[_]êftfŪ?UWVS4A EM(M؋uvuuvuuv ][]܋][]][]ԋ][]M썀OEЃ(8w>8)|>)1ɃtftȪF V$EUD:@t@L>))t 19r\$4$ߺ81tftf뎪gf u`uO7ЃE1 ;Er7MfOfm7Vf먉ȪUWVSӉMp x$?tp@)։u|(;uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$xG W$@9ue?Mt)ʍx(3tftM1H X$[^_]Ã}?"x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8S8 Ppp)|>Q1tftFHVLEUF@VDEU3ߺp1uDuQ1s^tft\$4$Mߺ~1uou` t䪃ުo)f+u?u0rуM1ɉ;Mrqf뙪}fɪUWVS É։T$L$@@SDtv)|P9T$ID$+D$- 1s@{Ds@{DsCHSL|$D8D$T$CPD$$D$|$CPD$D$T$D$؃D$ |$ָL$ B"tftT$D$D$$s@{Ds@{D9T$rCHSL;T$yd$T$t>Ѝ{Pt$4tftL$1C@SDC@SDsCHSLe[^_]ËD$vL$D$1L$L$$C@SDC@SD9ƉыL$rCHSL;L$uBfrT$Ћt$%ubfD$u_uDL$D$tCP{QD$ffl$JL$D$GUMt U E]UWVS贱û, } Et.1T$T$*MTuۺ1u)u/tft[^_]êtfUWS&, UL LJLJ LJ LJLJLJLJ LJ $LJ$(LJ(,LJ,0LJ04LJ48LJ8E3h[]ø1D$D$D$D$ ED$ẺD$oP$["U>ẺD$$=EED$D$D$D$ ED$ẺD$0P$!t5D$D$D$D$ ED$ẺD$P$!zD$D$D$D$ ED$ẺD$P$I!1EED$D$D$D$ ED$ẺD$!P$ BEEGEEFEEEEEDnEECVEEB>EE&x MEE ED$D$ED$ ED$D$Ẻ$D tEx EE<D$D$D$D$ ED$ẺD$P$xEEE D$D$ED$ ED$D$Ẻ$,D$D$ EU$T$#EE*EE)EE(EEEEpiD$ $B EE&3EE%EEREEEE EEEEEEEE}EE eEE MEE 5EE EE EEEEEEEEEEEEuEE]EEEEE-EED$D$D$D$ ED$ẺD$WP$@D$D$D$D$ ED$ẺD$?P$dEEaD$D$D$D$ ED$ẺD$P$2D$D$D$D$ ED$ẺD$P$CUS`g []UWVS4DK EEEEEEЉD$EԉD$$?34$0U+x $2o…nEBE x  U$nDžUHE GEx U$nUMHMtԺ ԺM tк:кUtoȺȺ14$.D$EЉD$$24[^_]Íx 1ҋE 1E+1R1룍x x 2tx 9t$utx 9t<$u Wغt獃x 9t݉$u ,UWVS  <$.Ժt V6uuc$uEt+u̺t V6u<$-E [^_]uĺt V6uD$<$U-E [^_]US$mt x t$[]EEED$D$ED$ x D$D$E$tx $[]UWVS E }0@DFƅtDFU U 9BMD$F D$ $aGEMtwFFU tmHU};O#D$D D$$FMAE1[^_]ËM!@dGF Mu1[^_]ËU!@uMAD 1[^_]ËED$ED$ GD$F D$E$oED$ED$ ED$D D$E$u‹]}[^_]ÉD$ $otEUBL$$vo…vEFH}OUWVS  uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9wt% 9t 8t)؃[^_]ËE)[^_]UWVSUE x}z9v=0t# P9tT8Tt[^_];}[^_]ÉUWVS蛞â }E pE0EEE90EuKEU9vщL$MFD$E$D$t$$*M)Mt/MVD$T$$(ƅu[^_]1[^_]ÉUt$E$mEtЋME0UFUWVS,誝ñ E MMM@E1EEԉ}4UHD$D$E$)U)U}}uEԉD$E$YƅM@@@ @E‹}9vM؉T$U܋ED$F$EU܋MTE)UqD$t$E$%)1,[^_]ø,[^_]UWVS肜É }E pD$D$$z&tU@ u\M D$UT$$I&t$+uPUD$<$9ur1[^_]ø[^_]D$D$$](1[^_]ffffff̀rS[ @[ḿ̀rS[à @[̀rS[À @[S[j @[፴&v̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUE@U +B]UWVS蚚á tMƋuA~8t:F4@9s3`V8F4@9r$lF8[^_]ÉUWVS&- EEu5E8}1s[F8t1EM+YĔ[^_]ËF4A@E$dF8*E} F4F0}}U1EM Q|D$`}|$}x|$ F8D$T$E$ NjUN8UV4V0@D$ D$`T$ $F4E~81u @urP2uB8}8BX;EuF8$jF8U ȉȍB=X8 CUXUF8$jXUF8$PbF8tmD$`}|$x|$ D$|D$E$ DžuUN8cX]SX UWVS@cj EE E5U1҅|%;EK=@9RƅDƅd0D$$%BƅC8DžD BD$4$#)< D$ |$t$$Ƅ=DVD$D$$TQƉ׉qV 8;D$BD$d4$[D$D$4$Ap @utUU}u⍃8n44@ Džh1Dždd 4$]^D$`D$D$ |$D$$  9ȉ։@D$ D$`T$<$G489Ƌ_P((1ɋx9z11tpvu@8R<L9H"99wǍvuB8`9wtswtD$D$ $HtRmuDžP8d@41`;t 9N@FD$$9 udt;G%D$GD$4$iG& tD$dD$$rGtQt9HVtftt81D$ t$$F DtD$t$$FtP?.D$BD$d4$ GDžP8D$D$$1PP8f}tD$D$$EtORtD$D$$dEt sO"M+Ё@[^_]Éd..D$BD$d<$ AdDd$N,N8 6!$BN<$:`O(9H(th89:]``;<$_d$MpuW4P4O0H0O8H8txyPRTP`9uO7t'D$DD$ $?CD$L_R1;s$4`9u닅408$^H돋t3D$D$$fB$L$`U*Nj@8@P1f,$K‹tEt&D$D$ $wAtቅ$K2UWVS耊Ç <$wE D$ ED$ED$E$MU EƉ<$D[^_]fffUWVS EM$u,U5(7u18uu,t.>} u0ptvDž} tоRJ0(U+E[^_]Ë}|$T$,T$ L$U T$$뺅t%=v}`u$ Dž0< D$D$4$Z?4$-I@8ȃ  υtAtft `9?01 t 9Auˉ0B$4BT Dž861%=}`$`_vLljDž `hD  tf t```9tu`;uDž,t$,$t 91RM1'`9u@t p0x@$Y9v$σtft@@F f  xrDž _~ -f:1H-p0t]uu fUS ") EU BJ  D$T$$_ []UVS ΄ utu#[^_]ÉL$$'ԉЋcUWVS轂¸ }MtP49t8u))t7} ttu+U [^_]1E $BƉ[^_]ffffffUWVS8E uuЋuMΉủމuU U 1Ƀ}Muux}]t<(&]EEt$E$UED$4$UEUMẺE}}}9ẺEEEދ}}ED$<$U?9su];]ED$$Ux;uUtω؃}M< ]XJ9u]륋EMEE]}}}E9F+E؉‰)ߋE)+E9vӋE+E9~Ѕt0E)}U։] ZH9u]9f9}9]E)E1uuMΉűU UEM̉MEEEu9(E9Es]339}sJ+}\$<$U~7Mt׉}MىMKP;]u9}rMME;Er8[^_]ËMЉ]܋8Xzu]؃}tUU]} ZH9u]Cu!MM؋}EM؋EEUЋM]9Yxu]E~8[^_]tủu111U)ƒ}EEu]XJ9uu]E)E؃}MU]XJ9u](}]MXV9u][ML$4$U-ML$u4$Uu EEM AMEED$U$UED$M $UE MىM܉)t$M $UED$4$UEE܍ ȉML$E$U\$E$U*\$E$U] 9] 9}rZ1uMЋU]8Xzu]E؋Mut$E$UuED$ ED$1uD$E)${ED$ ED$1uD$E$UЉ]XNu]pEu]0Xruu]E)U] ZHuVML$E$UML$E$UEEU/ED$u4$UuM $U]\$E$U3EE=UЉu 0sHuu%ut$E$UuED$M $U>EE:U+UUfffffffUVS \zc EU M;Mw/9w 4 9r$9fu49rL$T$$ [^]fffffUWVS$y lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$3E ‹Mu`EUD$ T$L$FD$$;uCtVT$VT$$$Ѐf1$[^_]9UWVSy Ƌ; rHu @[t9CuugCtwBCSC t^B C ؃[^_]ËD$$FÅt@C؃[^_]Éډau1F룋KD UWVS:xA u xD$4$E%=D$($+FDžts@@@9uE ED$D$ EЋUԉ$T$EČ[^_]?81Č[^_]UEU U U$]UVS@w? ]tvtWJ}u tFP@Lt4ADTP@SP PS@[^]ËP븉D ,D$ D$%D$8Y$ U D$E D$E$]UWVSJvQ E puPHt,JHPt9Q P E$H1[^_]ËxuL HPuNjEPUWVS0u E}u 9FE NjAX‹9QuMrEMM䋏M1҉E؉U܉L$D$ $T$]:1 ‹MkME؋U܉D$ T$ED$E@D$$]9‹Mt1`VME@T$D$$]*MEpE@EUBAP]YEDCCGC CGtST$t$$$ЋE@0[^_]ËZt]XZAtZPQEDBJB tTA B _BZ BGEuJB0[^_]ÉY AuQ 41։뱉y41EA 1먋]N4O1UE PMt ʈP1]UVSTs[ ut PtH J H $Eu4$E1[^]UWVS s uu $[tCtډu[^_]Ë$؃[^_]fffVSD$ L$t 8trtl@͉ э&t&ލ1΁ €t8u.t(8u!t8ut 8uHu1[^UWVS r uU Et6t.ZYutD$D$ $& [^_]UWVSq÷ u e}tdEE}}EEED$E$aED$E$ht +E1ED$E$U}[^_]Á}{h1[^_]1TEfH @1UWVS$p E܋E XE@ uNtz} :}ruz}]u}tqvD$t$E@$EP,)NjM IM)E Hu1$[^_]ËE$]E@ d3{끨E1E‹u9vEX;H@9‰ÉϋutftU}<$]U)U+U)UE @E)Ћ} GEYEPtEMUED$D$ }<$]<)E]3usu]Ut}OM?fBfB tpEM9UɋuVtft})_UEUE @E)Ћ} G+E@ UVlE9xsN]ڋE9sB؋utftUEu0$]Y)uUyE@u9D$ED$E@$EP,…)Ɖu:M9MVv)6p9rD$$]<…]+CCECSs׉;C E‹ukKUЋus$tft}E)GEt^>9]\$ED$E@$EP,…-EfH @$[^_]Q1EЉϋus;tftE)P)UUE$]u1ɋUuguo믋EE =fPBffEXcf[fE]+]+ UWVS }G tPwtI)7tI1Gu-)t'\$t$G$W,fO @ [^_]ËGDu1 [^_]ËG봋WU [^_]UWVSUj\ utLD$4$? F t$4$ED$4$H [^_]* ,4$$Clj4$[^_]UVSwKx t$ED$EȉD$4$DxE<[^]EӸ<[^])UVS< i' uE EEEEEEN>w@ D̍ED$EȉD$4$x E<[^]ø<[^]c)UShÔ )UT$$:[]ff̀ffff7̀rS[P @[>̀rS[0 @[US h D$0uD$ ED$E D$E$C[]ffffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVSg" uP5tdF tgY$eUWVSOcV Ɖ׋@0$@F0PE9EED$$F0Pt$T$8$KF0PuD$E$V0UOU쉂PF0ǀTu Xt$[^_]ǀX\D$$ZF0NjF0TXtXU0b; Md.5u]1҉]UWVSb ud.58u [^_]ËF0$F0P_V09t'Pt($[^_]ÃT1݉UUPV0ǂT1UVSaah ud.5u[^]ËF0$@F0Tt$'[^]ǀP8$eF0U` MU d.5u]É]sUVS` ud.5u[^]ËF0$F0U t XtTt/$y[^]D$\$KF0ǀP8$F0UVS8#`* 5E1EȉD$E$U+u 8[^]ffff&&$D$4̀D$̀fffffffT̀rS[Ð @[Ḹ̀rS[p @[US M_T E D$D$t,@E$D []UWVS4_ D$(΋ED$$M ED$ED$׋EL$D$ ED$ t$|$D$($gƉT$bUVL$ MҋT$L$u9;D$(tw8u#;t$$}sE"t$$ʉ4[^_]ËEV;t$$|9t$D$}׋Et>t$T$4[^_]ÍD$0E'|$,EW9t$D$}E"t$T$4[^_]UWVS] EU uM] $\$M] Ǡ ,}}$}M] $\$M] [^_]EUWVS EU ]\$u}M] $\$](]M$M $\$M]u} L$ [^_]fffffUWVS\ }D$<$dt(tt$<$&[^_]1[^_]UWVS \ã uD$4$trXt`|$4$~t>UT$D$E $;Es1 [^_]";UE9E r]ø]UE9E r]ø]UWVS[ý x tx 5E1x D$<$ t x PEu׉uD$D$<$l tGƉ}D$t$E$J x 8Gt|$E$ <$~-uEx 9t$$c-ǃx ǃx [^_]ËMx TD$D$$[^_]Ex (UWVSpZw u} t%D$4$tt=t1[^_]À=t[^_]UWVSZ ED$x <$ tƉD$<${ 4$h,[^_]UWVSY }G$$ƅtx @D$x $[^_]USYÆ ED$x $vtU 9P []1[]UWVS ;YB EE5E8o7e1}ƋE D$ED$<$j u E <=+EF fF FfuUT$U T$$p[^]ø(8u F 본UVSDTK uFft<ȋED$ E UD$T$ $H!уtfN FPVT[^]ùff [^]USS E@fu$ []UWVSU׃H΃ J JH щHz11ωz3H}t)HtJ ȋMu"B[^_]ÃHtJ ȃB[^_]UWVSӋt B΃}1Hȉ`Dž0Dž<ϋ\<%t09 <;`s\\<%uЋ\P@ƅXDžhDždDžlHZw b扅8\p1DžHDžLDžhDžTplhƅXdыh9}Hw } LPu atT,pXt$ D$D$ld$覬t$ ED$D$<$mWw 1}`f%9w1~t 8tbDžL$L$$xu~ut Љt=9x KPf)Dž`<$z6fLJWp ~r1fDŽBDŽ|:t&t:1t:qt:q|:y ;uf@@ GDž8<DžDžPe0,lX,#e$ye\eeDUedeeeeAe|hd< 5e Nd@8(e edd4ddddd{dw GtDžxtHxXxtf@<j< DžT$x ЉkGE|t@`XF<<DžxG>D$ |t$D$$H9n&0Gk 0<$2xxt9G iPP9G5${2`<Dž*uL$ML$pL$ L$L$4$Ѓw<$1foLu+7e[^_]ËtF<5Dž87P担xt ƍ$RD$ t$t$$=T$T$T$T$T$T$ $ lXhpD$D$D$D$D$D$ $C)ʍ‹fDž@D$D$$辚DžD$T$D$ ED$|$$ƅ"@ lf9ua t\lPXT$ D$D$d$ȣT$ E9D$|$$dDž$!uT$$6G<ED$ |$|ȉD$ $ @u a ShD$ D$D$\ $ȢhD$ E9'8 0G$VD$ D$ D$D$$.@<$3-DžhD$D$$CzxGD$t$D$ |D$T$$蜖;|t$$@<$d,ua hlPXT$ D$D$DD$ D$D$D$ t$TD$$_t$ xD$0D$,$t@<DžT80@=0$>+DžtЋGDž`Dž,x t 󥋽GGGGfy׉Nj|Nx99 ȋ|99‰ !ȋL 99‰ R Dx9;& Ћt x 9u㋕|1t tt$tt(tt,tAAf9ut 󥋽GPPP f~DžTz0Gh$D$ D$tXUWVSm u }MME@ uyuM[^_]1[^_]ffffUWVSpkrm u} U(Ft~}, ~xBBU(4$ fF@fU(fv  Bf% fJUEt[p[^_]ËE$NEE$'PML$D$ ED$,D$f$臼U(#},~r EML$ED$ M,AD$t$M $:jƉt$E$d=UFD$U$N=uU(fBMM,щ) ML$}|$ D$t$E$9Ɖt$$ Ug$U{UWVSELi U u} E@EЉEMM}E)9UB9E;M}|$4$:GD$}<$:V׋u$s?u3u,}׋ED$+E$9+E[^_]äftu.u=뫍 g$U "MAyEffUWVS, h EU܉M؋M@EU܍gM썋gM荋gM< t< t֋}֋} ֋}OgE@U䍃g$Uu< tt< uJ,[^_]ÍBU$I-U~ƃ}dM dGtUD$g$諶UtBU$,U~uFJUD$g$dU- gt uWEHB U$e,U~uFFUD$g$ݵUitsgujEH@gUE؉D$E܉D$Xg$wEHU%E؉D$T$4g$OWEH ht' huE`EHuEH@ uEHphu^MԅMD$$Uƃ>Uv?t$T$U}ԍ$wƄ7Uhu^EԅD$$Ukƃ>Uv?t$T$U}ԍ($vƄ7(U %hh D$0hD$$UUuEH2D$AD$$U豜U E`UVS4c $@ftN|xEEE%EEEEhD$D$D$ D$E܉D$t$st4[^]UVSjqb Et4D$E$[`EEFEFMfF [^]Í{ UWVSx b 5EEtbUD$E$_Ef3EfF}<$D$t$<$|$4$FFUM+ ux[^_]Í{ $LUWVSrya }x$kLJft/1t$}kDŽ9Ӄ[^_]UWVS` u4$`t&tuOxu:<$Gdžt$+džf[^_]É$j뼋|EL9Eut$jUe`` Et]Í 4]U;6` Et(]Í7h]UWVSu] }4$sfdž1~t1҉u뀃9t`t[{uMt31sqsqs q M31sqsqs q 뀃9uuF [^_]UWVST[_ ED51u1D$Ɖ$0F u uD@@$ID4$^4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$p. WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$?h$蟅 w`D$D$4$jpƇ_WHwDG` \Dž01'< t4t 201Ƀt+9< x< t&uuDž(RD$$18Dž4DžLT, , 8D$ D$D$L$s<;t<#tL8domaL8searL8nameL8sortL8optigfxon[xsQ< t< >D" << ufxinE< t< D(< t< t< Dw`D$T$4$nƇ_XhD$4$[\bDž0]t DA 4DdLʃ Јd8$zD$D$ $dx8$,D$x$Dt6hlp{ { { Dx`0DHHp`pD@H@`tX<.ǃu~=D$.4$ lDNLFHtD$.$kNPFLD@wh$Y…tD2DHu+1V[^_]Áxservfxer< t< 9< t< tVhD$4$@< X11rDž\DžTD$5YD$ D$ D$<$PD$ ,D$|$4$}PB=iDt/Rωփ]tftPB@Dω f fu$0P@~N <9V)<9V)1҉=tftH4@ Ɖ);;,h΃r낋$踂@ $}Dž褏@ D4$#@;c‹ytft‰)‰DžHtftR<lj);44$E@9‹yUff PD$蝟 uKu2kfM/f릋$8@ Dž}UVSv}G y5t$[^]ÍRD$$脚[^]UVS'.G y5t$[^]UF U]UVSF ut$>[^]ÍRD$$[^]UVSÖF ut$[^]UEPM¸t]ËE@ ]UWVS*1F }E0upq @ARD$$:ƅu!yH L$UT$@$gtEG D$GD$ GD$D$4$mu4$4~G [^_]É4$~[^_]ËG [^_]UWVS NUE E`58 ˆ ,:)lj}싓\{ u2EL{ L{ D$T{ $< [^_]Íb7t$E$ t$X{ $t{\{ t1=T{ 9txED$D$賍uًED$hD$ED$ TwD$iD$$ [^_]ÍhD$ED$ TwD$hD$$ܠ [^_]ËED$hUWVS C 4{ ''w}8{ <{ )ƉT$U$ݗtn8{ <{ UT$D{ $趗tGD{ H{ 4{ 8{ D@{ 1 [^_]ÿ'y qUWVS,C LJ { LJ0{ LJ,{ 8{ <{ D{ H{ 11 ,E`5E܉@q54{ )‹H{ ({ ؉Aw `iD>ЉD>T>UT>qHL>@MAD>({ A,{ piE։‹,{ xyt,{ =w ]; ot,{ =w ]; 0{ tG~j,{ LJ,{ ,{ yU U;,{ gU썇$ { 0{ ULJ0{ <{ 8{ M싗H{ 1ɍi]MEUtwM<9ErMt<{ E艇H{ ,[^_]LJ({ 54{ LJ({ D>ED>ЉD>UT>q@op9D> wU0UD>HL>PD>HL>({ Hp;Ë<{ ;@{ mlH<{ PH{ HH{ ${ HLJ,{ 0{ p0{ MULJP{ D>UMD>ЉD>T>q@oف9ilLJ,{ (LJ({ D>ELJP{ D>ЉD>T>quMUD>@ND>EUM7MUEEE܋E䍇T{ $7UMhD$1ۀ} ËE)؉D$ TwD$hD$$UMLJ0{ D>EP{ ]X2 E쉇P{ zLJ({ D>EdLJ({ D>EN${ T{ LJX{ LJ\{ LJ({ D>Elp<{ zW8{ XUUx~,{ Mt <{ H{ 9@{ w t^l<{ H<{ PH{ HH{ ${ Hp #E쉇P{ FLJ,{ h$1ffffffUWVS,Wb< Eԋ|{ `{ u苸{ }9x{ uЋt{ }E xu܍vt@u]؍ w]ȍvENjE]]Ef[^]萯* * l{ ny* h{ ]h* p{ LW* `{ U8C* U]U +* Ul{ ]U* Uh{ ]) d{ U߮) Ud{ ]UWVSɮ) { u"$ { uމ4$LJ{ LJLJ{ LJ{ LJ{ LJ{ LJ|{ LJl{ LJh{ 1[^_]US) E$fx[]US( E D$E$"}[]USʭ( E$@[]øUS衭è( `{ D$ED$D$ TwD$sD$$2[]UVSMT( uD$4$;Lff D$4$OL[^]fffffffUVS ( EpFtD$D$$Q9F!u  [^]smUWVS蓬Ú' uMD$ ED$E D$E$5TDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$DžH t VV€ʀ UTPlD$ D$D$T$d_M L!ЃP Lkk0<$蚎EtT$!0k01[^_]qkfk0DžTGED$D$ D$D$$DžtHƁ   PxD$T$J*E EЋP. 9G6GG .G fdG,Gi7GD$D$L$3PP LLЃHD$PD$L$5H{r  bD$ $Hi8PL  P(vD$T$MYP ƒ@ uD911 lPP D$/UWVS6=# }EpFtD$D$$4F x  D$4$D$BUD$4$N(UV$ED$E D$ T$L$M4$3 !@MF[^_]út9y  u+T$U4$Džut U9B[^_]ËE ug[^_]ËtF(V$^F(MF$PGD$D$$2[^_]UWVS]`! EpFtD$D$$2FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$h !@MuFЃ[^_]úЃ[^_]ÉED$D$$1UЃ[^_]Éf뫺UWVS$ ' }9UEEEEE;E E苷}u mtnG$Vuu}EtD$D$4$YD$ ED$ED$<$0t|$[^_]Éu}D$ ED$ED$<$P0uǃEE;E 71$[^_]ÉD$$Es…tE9E v $[^_]UWVS(貣ù UE䋂Euu܉;E E苏EHMU$pUƃUtS9Etxű})lj}苊U|$$YrUE눋E})lj}uf ([^_]É׋EU)‰UD$ E܉D$ED$<$.uFEE9E 1([^_]D$ ED$ED$$U.Un([^_]UWVS$29 M9}E U䋑U;U ;uUUUt/9wt#UD$MD$<$VUMUD$ ED$}|$ $M-uv}9} MUt9v낉1$[^_]Á $[^_]ÉD$<$mpDžMt$[^_]UWVS( EE] ;M s|9s^]]܉E:t9wU)É]D$ E܉D$L$ME$],uCFM9M Ut9wE ([^_]Ë]1([^_]ø([^_]UWVS EEE utp<0D0?E PE )։t$D$$E fx]\X}?Jft*}M |y f9sf 9u}Dx} WуT)ft%ҍ PPf9sf9uE HE fHE1[^_]ÍGD$E$s UWVS D$T$$tb@D$T$U4$DžUu D$T$$+[^_]D$T$$*[^_]ÿUWVS SZ }EpFtD$D$$*Ftt8^ [^_]ËE t9sF [^_]F(t‹tF$Pun$ 1 [^_]Ãtރ [^_]UWVSD肝É }wFtD$D$$)F}  8uD$4$D$ D$D$$ Q F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"XD$ ẺD$EȉD$<$Wu8E؉D$EԉD$$R;EtD[^_]1D[^_]ËMN$tD$ D$D$$EP!уtD$T$$Mu D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$ЅaEE$D$ ẺD$EȉD$<$W5EԉEE؉ED$EĉD$$"‹E؃9tD$<$}D[^_]UWVS  EpFtD$D$$d'FD$E$< uP1u@t,$6Nu,E$K~tO [^_]Ë$tԿ͋D$$؉Nj 놿UWVS'. uM Ut'}8BEQLPDuh!@u]C1[^_]Íx;D$BUD$ $IU]C1[^_]ÍD$D$ ED$T$4$uz][^_]D$$WhM UtMdžU|$ $)ht#Ux,1[^_]øUWVS螘 EE,E}1EED$ED$$]"ƅ@ yXf]1 ;M wTVÃf9EuUMUfY]][]]}tH}t8M[DF,D$t$$]0$E.D$DFD$Nj]BXE}E9}tyu})D$D$$]#9utCFD$FD$$]*!tVTP‹}u뙋u]W}8[^_]ËEpE )}fG w[^_]fffffUWVS蛖â Ɖ>f}~)ʉL$D$‰U$0EUfFMA)‰D$D$‰U$EUf>fL)fD>fT>[^_]UWVS E xfEEETf}tU)ƋUJ;MLW)ȉD$ЉT$ΉMȉ$JE9EU|HDU+UU\Wff@9tPHftffP9uEftWf4T]TfTEfEh8E H1[^_]ËUƉE봋uv E D$E$[^_]UWVS$薔 E}EW u}EGE9G ED$E@GD$M $sE$[^_]dž(Efufdž $D$ |$UDBD$4$f…tMME$EREyD$ |$UDBD$4$Kf tʋ@f8$dž @UWVS( EE} w8}܋PUEE؋E@E|F5U9vTF)ʉU|$E܉D$M$] )}CUfFfۍD\M)f fTNfDE D$E$] E M5|>fd‹M9vfU;E@L>f+MT$UE؉D$M$]PUU)UMfL>fD>}f)|FfLFE pH|FU0M9vʉ;}|F)ωT$UE؉D$M$]CfUfE D$E$]VE tUU؋pH|F([^_]1TUWVS| E @u E1SfUDPND$ t$D$E$bƅt|$E$FfUUPMuJfwfu Uf|Pu E|U RME @EfE@ =fEMML )ȋMfDJMfLBE Ht$E$t9t|$E$Eh81[^_]DHfBfBFM Ac[^_]fEhUWVSl{s U EzMq uf+4GMM9U t$ED$DM$_u)uD$ U T$MDD$E$"a…tzxEp uf+w;ubLf|Go;uu-t$ED$WUlj<$_Uu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS8z? E 'D$ D$DJD$E$N`tDP2fzuft,΍< f}ED$E D$<$]@fEfEEE܉D$t$<$]EEEE܉EFEEuẺD$ED$ED$t$ D$L$<$]Y…D$E D$<$]QtX@fE҉ED$L$Mԉ<$]MED$L$$]+Uj`]7UWVS(pÌ uExGtD$D$$GF!9t~rd;4D$D$$F)L$L$$!%E䋇E} v&0([^_]ËME} wڋUxE 0t9  ut$<$tH9s`!EEUU,D$ UT$D$<$EOH9r!<ED$ ED$FD$<$u@}} uw$ D$E D$ t$D$<$f([^_]G(w$E 0EE 09뤋$U8E\UUT$L$$=#H(L$$*=…FE$<@fff]]fffff]USxm ff{vqle$Y$Mffff@;61,fff]&&t&UVSl EEEEjuVj x uǃx H5tjjjjVjjj UWVSEE] }3t>uj/V?1ZYtp t0MPVZYMu}] EEAe[^_]Vh4 hu h0,9UWVS ]u 6Yhz VS tful.5D,ۋ=+)]u=D,u h} PZtD, D, hj5D,@, @u5D,h jZ h 3Xu4&h j6 MWRUZYMtCUk uVEHPW P9/Rh j UWVS] 3h-"j:Ah-"Su@t h +DPC'd,Yu d,f$h,t, 5t, jjPh, y 5d,@,;*@,p)=PP+v`,u h j$,u#(,$, 4, 4, ,%H%hPR(, yT4,P,%H%hP5$,ң(, , y5$,h#j[,M),(,u-,uX,H(@,uj,H X,,9ʡ,\,s(@,tá,,(,t@,D,,,p, l,t/0, ,,t0,%h=`u= 0,, , ,,,%,,RP5(,4,P ,t h  jh,h:jh?jd,h,l,`,h/PP+PPP+_,,, t5,=,5,=,9ss X,D, u15X,5D,5h,t,P$ uP,T,Vd, rPPh#%J+XZ`,u5j5\,5X,5h,t,P  t5d,h#_X,X,\,P,T,H,L,B5X,=\,u}5H,=L,9Uu/9Eu*P,T,H,L,,,T,t#EUP,T,׉5H,=L,P,T,H,L,,,,t7H,L,, ,jP&H,L,^s/5P,t,,D,VRR( P,D,,,=wu/$=BuR$=^ub$,t=, ,9ȋ ,,s")1=,,,, , , ,t jf%[\,5, tJ ,1=,,,, , , ,)։,5, u=(,uj4,PY@u$8th 5(,4,PZ@u h& j0jk(UWVSX ] 3@h-"jv: h Su G-$ ,,,,,,,@,t,,,Q,B,,),,,,,,,=,thE =l.5tu hj jr1nuou,j,PZYFt@jVW0,Y^u hz I8pj,WQ_Zt x>hPh h0,/jH&,,=,t t$h @ ,th &,+jWU,ZYu hp ~;T=,u6=,u-=,t$=,jW[^ 1Dž=,u ^=,t ] 4i =,\t 1Z01C PtjZP0PDt 1B 9,h u)V .ZYu h j,RP^_y2u$`u q2ui, RPsZYuh=,i =,t& rhj#3h vX ?Ƥo2uhj#V3h NXG=,3h#:^_=,t4011Dž8hhq$P( ,5,8i, Dž;2t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t/=,t&,,=,tV0&C19,vi &Cޅ(=,hI -1e[^_]USEEE EE0Z1҃vU|r҉T,UEh RPm tvpt.Et?SuFH,Ƀstxu0;l,볡l.5,L,P,aPh h0,) j> E+EE)ЉEEt9E8-u/L,EH~+)EEEHEj8M$[uYhjoXZjjdY[h jVXZh, Yt1h0,h XZh "tY$hj[X%5@,EteE8t[E0_YtLEj0[DYZyjfZrE8!Eh0h@, Eh0,h YXE8tjZugh" PsX`,PÅL<vh0,h XZjYy =h,th,h"h0,' ,u EFyPh#$[Xh,Xua=\,=L,h0,h XZh or$Yf%,\,Ox,| h (r[f%,&`Å1$,SPPKà j\,h0,h AXZh q$PYQ=h,ujOj1[uh,5,h' h0, &h,h"h0,& 븃=h,uj2h,5,h' h0,%UWVSXu} 7Rh!YZu{  ful.5h WV utt +)Nv7E8}WZE1  tAB;EvEUPQMW UuMt6QWh jKփ빅u Wh AE@t1j URP貽E ;F|E8tEph jE1~PS菴YXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmW蒹 UWEffEERhm+fEEERhmWO 1!EPhm8@W3 x E 6Sh!jf9tfuPh EPsh  KUot!袀K U 葀 Cuuuuuh j $uuuuuh2 N uhP A uhi 1 XZQURPWY x%uSh  ,URPW4 ySh#j%Ph jjSUWVShu EE1ۃ}~F8-tEh _th PFZYu X,h \_th PZYu h& M_jh h EEPuhB z0JEYt/tj@uY[t}u U9sUPUxt}uEE1ۋtPZ\tSX\Et'U)RPSSÃ~t C}u"hY hm$KEZYu h 5}uEEuhT,WuuEpEP:u%$ yj=T,y h }tLjuVjhSKy h 轴_jVjh5T,$y h 薴^hY KjuVjpSjVjw5T,,uEEEEY1 H>v  DGu΍EPEPj =X,t}t.D1}tEܮjEP4 B Gu&Ey hr!j~Vh~f5T,>Vh~fS2SMUE|}u j uXZjxUE 0Vj_dUVSEU *J `*,ueE1ۋ4P !VhaY"uU,H,Y^yh,j XZ,P, Cu 1e[^]ÍL$qUWVSQpqO,O,O,O,O,O,O,O,O,O,DžDžDžDžh%!V @0J9$!Q+Q+Q+Q+O,jP5l.5AQ+ :u]5l.5hB%!HO,>O,/O, O,O,O,O,14$!4 !h^%!YC uO,O,O,=l.5j/WcY[ÅtC?t t@tNj/S"_ZDžtG;t t@st j/WZYtA?t,tl@,t9O,PhO,hO,hO,hg%!5l.5Sul.5<t hr%!=O,HO,9PhO,PhO,h%!5l.5~!l.5<uO,O,9v h%!<O,=l.5j/WY[t4PW螂_Zu!%=@ul.5Q+l.5.,O,hQ+Q+l.5O,O5l.5[@tFhS,h(!^[^h(!h(!Mh,jdhS,4)hj!ۋuw1ۉO, O,uQ+P=O,=O,Q+unÃ=O,uMh(!Ytpjh)!XZؙjjjjjщڸF)!hv(!Ett ShW)!]^_1Q,@u Q,O, O, O,1=O,.,Džt~ Džht)!>aQ,Y=tk jhjjjщ¸)!ƒti¶ fQ,j*,DPXZh)!`Gjh)!0Q, 1DžDžQ,tK>tFVh4 Q,1ҋωT u9u @uQ,1;5*, *,؀tet\Ph4 ^ *,1ڋ߉T 9u9uFtDžDž19~JCVSh*!߉D 9u9uF뮋y1RPjjjʉٸ *!TljW f=Q,QQ, !t!u 9rGD8yGQ, P,1ƅt6Q,t-u9uu1@ƅ $utQ,u Q,q*,*,Dž9}ɀ~.t/>t*N219u9tQ,믡O, O, O, O,=O,uYh4*!,]^=O,tLO, N,t h}*!][h*!eYtM@O,FN,<2@O,0~ h+!.ZN,~ h/+!.X"jhP+!jB1ƃu hO'!e\R,11;\R,ǍPPZYx+=w;uv=P,O,5O,jStP 1eY[^_]aUWVS}] DžDžDžDžh=!SW# rfq1ǃstwDž`j P5l.5'l.5 8uPh|=!1:u8"ZM5l.5h=!jLDž,Dž+)OtjhQP2SÃy2h@T,hedAP y h=!=T,9 @fT,V1ɋXt(jh@T,h,   u h=!t o=!u-"Ph=!ZYDžfT,h@T,fT,h@T,-k~PSyh>!.jFu"PhwdS h$>!YXS1e[^_]US] 3tSu US] 3tSu#US] 3tSu(UWVS}u DžHj/6@Y[$V,t@$V,K~ PhwY!`[XZDž(Dž,DžDDž@Dž<Dž4Dž0Dž8hZ!VWà A6$@N!Dž= V,j/W脺YZu]WhZ!hZ!hh@V,xPh@V,cd@u"5 V,hZ!ha$hh@V, V,@V,=tZ,hj5 V,!à 0tPyphh5 V,à x29=pZ,~hPSWG jjjS!y 0hP5 V,h!Vj5 V,蒰XZy 03P5 V,h!gVxPWmZYy 0P5 V,h!4V%= tn=t5 V,hZ!VY^h$PKXZDu DžDD1RPE=DZ,uFDZ,PLP5DZ,W5 V,@u5 V,h O!j u6hZ!NUYX4u2h$R舦YZtRh$6hZ!UDu TDDQ+HtpZ,1DpZ,5pZ,4t(h$P XZt4#t;s @u%9ы@Dž@ s Dž@@1ɾ9։s+@ u"9s h [!jh6[!"^Cr l.5}Crl.5r! F`뼅u/hbr!~Phr ~S~tkhyr!ir!? ~`~9~mhr!xAX1ҋ ~^_=tk,t0=pk,th,h7|!}Y[h6jjh@%]jh{!BXZ:h{!!h{!j+jh{!e)jjR_X1hV4V. thRPVG9u u $k,=R+tW 3ZhxRPW^F9t%hW4WD. uj*X=tk,tjUWVS] };C@,ST,jhh`,jP5`,@u@q8u$jhh`,j5@,`,@u5@,h#j躬@,`,hD,hQ@5`,l `Z+xZ+T,t1MPRUZY UMu܃ SEPQj!`Z+thC!RPh!jUWVSX]u 6@P_tjPh!jʫl.5ԫ,h!VS Dtb$!,,,, ,,,{,l,],N,?+)ÅS=,t , ,u ,=,t=,th!PS= ,t,=,t#1&=,uy!Ph !S4EPnh*!S. u* ,$,EU,,߀;+uYCK ,DJ}PNLk< ,$,EU,,YwxPҋ ,Qt Gu)<:,WZGGGGh.!՞EPS  $D!S0k KDЃ<80k SDkd-lGSK0k [LdGڍZ0k RDωG0k SDЉG 0k SDЉG0k SDЉGW$,,Yu uOQ+EU ,$,y h1!jlFh"P[_u~tO,t5PY)ǃv%,t CRU6SmUӃ f @,h,߯,)PS_ t!;t ޯ,sCޯ,ufޯ, h, Z,$,  ,th,iPhF!x hZ!/XM,ubP8_jr#t,jjj =,u6duhh!qjtPhw!jsj jh!> ,; ,$,| Q5 , $,9Ȼ!} VE9ƉS}M)Mt/jjs sJ;EM} 1Ouz^^SOu,;C| QsK^YC tŸ!=,u!!= ,t!=,u!h,5,Ph!jj]h!.=,th!-jSP=,t3hhh!à xjh!PMS觋h!-j3h&!қjk]h9!-=,u= ,E!! E!!E=,t EY!E=,t \!=,t _!=,t h18,tlh(!PY[u58,h#j<,jjh<,jV'9Ãt;tMtSZVδX"4~FMtK1=,,[+,e[^_]UWVSQE p,EX,h@ "_t8t ,*hh PU|_Zu ,jG,]蔦 3G9EP=,WZY9s x/tHh P{Y_u x,F"=x,u; "PcZt@PP2_X0+u+zt%~Kh1&W{ZYtWP2Y v1um1t q1=x,tY8t ,hK ",Zt8u#hR ",_t8u ,"hY ",Yt8u ,b "1=,tEjhq "XZ36XuWRUj7NjURRKɃ=,u[=,t"5+蚋Yt5+hp5"j褚ct Ph5"j=,u5+\Zu€=,t8jj5,< y h5".Pj5, xh`,j跛,`, 󥾠,%,%,%,f, , f,,Ih,?h,5h,+h@j輐4"=,u4"Ph#q=W,^_G:f=+t jyQg[KE8L+utEt,u tz8́+u1f=++< t< u>jEP5,_ f=+t!} t-"P!cut8l+u褆EE5<+PZYf=+tCۡ ,t ,fEjEP5,̉ f=+EPAXh,"jEUWVS E 0\< ,W10,,hI<"貛_Zt H<"軚L,Q<"hg<"舛^tTL,MBugl.58tpjRPb :uS1ҋ ,buV4,8, ,hy="u u[à uC$8"5l.5h<"@,D,먃 ,륃 ,뜃 ,듺<"l.5̙낃 ,v5l.5u#h<"h8"hW ,h<"VY[ƀ>1h<"V߬_Zÿ8"SRV u<̋5l.5uhA="h8"hKh;"1k$,t!VPrYZuÀ,(,GhP="VhS="j9l.5虘 ,a=+u) , u*~Ѓ=$,u,P3Z@u h="j肕="B ,$,Z!Ãt~8"t%Ft!á$,0Rh="Q  s$,0h="2_X s$,0h="Y^t Sh>"XZj uh2>"tthV>"jE ~C<,3hRǃ u R3h!xPhP虬 tlj=,, ,u $"1H,hPWEy0, uR5,,h>"jh4,P$Y_@u5,,h>"(,t&h ,PZui(,05,,h>"jt=<,tG(,,(,8u5,,h>"jEh ,P_(,u $(,ȃ8t̓=$,uh?"h8"h0hjsKx, u sh*?"h,P6ZY@u shI?",%=tE$,Bt,=@t shj?";5,x,_ sh?"C, ,5,,h?",(,ZYtpp 0h?" ,uB,%<"=@t-"-<"u,u&<"RPh?"½ <,t Ph@"諽_X ,$,th ,P [=<"8th ,PYB<"#Nu@u h3@"jph ,PZ!u Rh]@"<,%=u50,v_@u5,,h{@"@t50,Rw^@u 5,,h@",tP1w[@u5,h@"j jEhT]%V9ZYVPh@" , G ,Ou8=Rh<" 8=tRh<"[^뺉thT]%VǦZYËtt ug(V萱[VJWYwh!jPV‹  9w(<,tuxG ,=QRh<"NVS7h"="UWVS}u 1ۃ~^;-t+1Dž8Dž<Dž4hL"VW| t]it Dž4@+m:;B uBul.5B믃PrSh#huL"G 독udx1jSV}CtjjjUVǃuhbF&VhiP蘣 @u hL"j赎WtY@+7tvFtjNt^HuT,ItBQ0Z.0QXɋ0u hL"jq돃넃<t4t觥8t?j8iul.5IouDž<5DDž8=US] 31h-"j hQ"Suo Btb$P"jj5l.5T-------q-b-S--:jh,YX'-TPhbQ"h0,% +=-tBEEEEEEPj jq @u h j-- - - - - -tS辨S莪Xh,@Zu-]UWVSE 0/h-"j- 1DžtDždDžp11jh+hR"u uPt!HLHl.5뵃xe~P$Q"Džd눃RtiX +lM lL9-uQQ9uIyuClJ+413'DžtDžp +U)tuJu]pt.tt hR"jADžl]t1)ttDžlp\Džl]M 4u0Vh6V0XDž`ۋhu4VhR"xPS"ZY@u ShR"jщE`1jWRPh 1uhR"th TXFHHf wa$Q"puNjVhY ;v -Pvh!Wv Pvh!7J`tFPpS.ZYPvlZYdLDvh#LZY+78t hS"j誈WUWVS]u 6,h-"j(-$-,-0- hS"VS; TvXeR0GDf8$S"H %$TS"a$--(-R0-$-,-Y,-$-#-4$-,-0-(- --- ---- -+)ӃI(-=-t*thS"0- ,- $-tbhS"jst3=0-||=,-t=||)=$-||| Dž|44-j{-PpK<hRxh+Y=xv RhT"h+Z++@xT"Y[ftf tp'5+C,-+=~TSh+h[T"S{DulptZj/RlYYZDžxlt )@xh!xЉlP_YZxl C(xxЋK(+x8/t ~/t/Fꨆ+ʁvPh+h}T" QlPVqGlΉ5+ +=+vx/uP+@߃=$-xt Ph+" Ph+^ZSP@xJ9|uW;uSEJ9MuH;B uCsh+hT"OCP@% =@jStQGB%=@t4M1@u#sh+hT" 1Jl΁@tjw p,`bu|u|t{DuPS脣ZYi PS sH (- -u)fNushT"4Y^jStP fuX58-V8-@-hU"hS"h6nU@'fug=-u*8-P8-@-y+h@U"hS"h?jR&ZYu5h+U"tiCPph+i^X1SshKU"DZY8=(-PR=(-PRi= -h+shM !} (8t hS"jtHW̤Džp=(-t,- 0-1P6,(- -:DžpUWVS|]u >j/WYZtxh&W[_Zu^h-"VS @ui+)Ãu]p0fY[@u jj~je;LtEPtLFu'|.h4X"VS艔 w~fw$V"p.p..t.d.x.t..rl.ch.Td.E+4)Ël.-`.u |.&=|.u=t.u.d.ttu#@%V1ɋP|=x.xt)SWYZuE%=u 訞SW>XZt Wh#j}E%=@p9t薦 ÃSηUWVSu 6 h-"jjЉÁtDžlh$Vup tVmtDžlptc5l.5:#Yu5l.5hR"j;|hP!tWe 딡+p8th1lhW%VYZhW%VYZhW%VYZtthdPSYZdx0tupplcϜdxPS_YZcy詜d=E%=@t 苜!t/tSd^Z@lSh#>Y[lTtS#^Zx,t2tp0JdY[@p0h#>XZW讟UWVSu] 3h-"j趱 h["SV+ tZit)ft8huY8.σvuH0.<.4.4.<.뒡+)ƉlN4jAz,.hjp =8.tluˋVPelTtP2pY[u|%=@puh2pQ耐à =pv2h["jxȉhtx/t>hƄ/C-@PRhT>p lRp˙ZpDp8/u 9tH@j/pKZYptPRd耙Y dXph["GXZfWYUWVS@] 310.0,Su+]Sj=uEUEUSj輇^_Sjzu8Quth"Xt@.؋Ht ʉA?jq£0.[y<. 8.u u1=(.t =$.t@jPW$7ǃ uhЋ"C =<.t.u)W-;XCHHf $"PDs ePsh!jDp=<.tC ?uts $Psh!N@.k=<.^KPSChnHjSW?C C )C  Cu>=<.tCHSft.wRfuIKPSCnus|RTVY+=<.8_=4.usZuC1nt=<.蟐8g葐8?Y胐8Fp8t hS"jnW88Y_xVSkYZu8=(.tCj蚦PSh!@._u=(.EE%=@u"=D.uSh"s@.XZ묃=<.u=uE%=uST2ډzluq=@uS~=4.u S^tXmt:=<.uSh#1g38%8?8u=,.SY5@.诒sh#1@.XZ,.  . .sRXs1e[^_]UVS@jjcXZEEEEjEPjP {{ۭ¸9u ۆ9E`.j jOR[^h.H h.jd.$-"jߣXZhӫ"p+E$.Y4.tt6Hu=P.1}3...E .P.4.t.U=+y=.lc腜=4.tEPX0.,.tA:P+HyP{XP+H J hl+F{XuEHm8..2..ӇEPXu uT,XZu u菇Y[}um=+t,Eh"^E=`.u PEuE=+u}rEjh^=+'7=`.u訆h [u"jh"Pj~ÃP $Y|=+uL=`.uCEP$"蚈Zu EP(X8tEP]$XE.1ۀ=+t$=.uEPwX.+u'j4L"mn^XC̈́RPZY=+=.ԏ+.5P. xh!z$l+&yXUWVSpE 0K h-"j聠E+ 1+] ;E9hH"WZYEW_9EuphN"Su~ tZftatDeuI렃gu=j5l.5MEZYz5l.5h#jdh^+E ]SuiZYy hT"EPhBt @u| y h^"5,X}Whht@u| y hi",XEPht@u| y ht"+Xt$FvE 8uVEPuWS育SYEEE 8URu V腯YZURVZYu1Sh"Vh"jaH.h&"Wuw A6$". ....܋5l.5h!V=ZYuh"V=ZYEMl.5z>j j5l.5׵ƃ u艂8"u 5l.5h"D5.j j5l.5蜵ƃ t 5.C8"u5l.5h"j`j j5l.5\ƃ u8"t5D.5l.5h "뺸o5l.5a^@jfS.R.C.4.%.t9w D.v jhD"uhb" |.tt h"jh_@.p.ƃ;5.u;;.u.t.;.uq.9wu ++..5.tPu=.ۃ+M)L„t =.<1jhh`.P7rPy h`.=.u>xPP_ZYu&%=u..w.$"L1.PL Pjh!a^u{ h"Ph$hS4SyǃuSh#!Y[h=!PnXZthWoFh`.h.VK5H.h.V VqXDž\Dž`DždDžXhVXPj'A Džy0~8#tjVjAhr!!j_jVj@kPCkPclhR "Y`ƃu"SVhJ%TPvTu hR jjPh\"h1j$h1j$ZÃuVj^SM9tTPYyjVj2@TH  h(!PXZuPh# _X.e׋HVVp^t+PuP7[DžLh"@h,Q,H,ZYyh,pX,P,0t- t( ,y h,p_ᡀ,P,΃߃NPYLLPM=L.u L. =P.u P. Ph.]XZL..P=.q=.t .膴,h`.h.h,5H.h.h,Wh._pdL h(!w[^uwh#j%mDž DžLPhmdP h"jrYLq_W(ZYu WhF"D.eȺ.t jSRG h.Z4PcV0~UWVSjj]Sjjh"`/@u h"jXuσYtjjSPjh"-/@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQ MQh#U1G맅u) ,yh,j 7XZ,P, 1e[^_]UWVS uƅ]-ƅ_h.l.h.p.t.p.`.d.`.1h"u Vm ycPtJTtgP$ " P.뭃 P. P.  P.x P.l5l.5(X.Ygl.5:Xj:RXD[ZXuh"]Hp.t5TRX303ZYXTu C[Ǹp.=h.t hE jDVl.5tuhj ݀nuxou|+ |+hT]%P§[_t-"h.֋=l.5X P.L-"l.5`.2h"Ph"h0,Ljz^]T.P.tP.P.t X.+M T)tPDžXh hG 5X.RXRrRhy"RL1ZYTLSjjLRPVD9X}XTPT0VhP Hà uj/SgzZYuShZ!ha$hS~V?Xu"V>Xu9S>^ty2LhVGà LVh#juh !LRl0ZYhQ"LRQ0ZYSh"jjhVjSgǃu Vh"jSh.hzd@PCh uWv9X0.`PhedAWh @uVh0"WE9V_tH__9~VhN"(Zu[ j dR@P~ d:u5l.52PYp5l.5hR"j dR@Ph d88ODžX$+)Ǎ\X=/u/p1\;=/}Vt VP"[Zu?Vh#TiFZYt Phy#?iY[Ft Phy#*iXZj Bh[G 뚅\\8rGvT\jhLP`\L`%\QYYzu?ctptbu.` `*`DžXthy#hy#ju /u#%/VRWc^ZtN xRjVhZ!= u ƃrVWYZuSh /h#jK(=0/u@0/`PP50/h /)@uh /h #1=0/,/=d/ud/ hՙ#? uh /h#ph#S9ZYu&$/ugh#S^_tVuK=$/th4! h~$SY[Dž /t*hp>!h /h #Dž Dž /t'd/RP5l/5h/h/l/5h/=l/19|Y<@ t d/SQRPo  5h/=l/19| h#t5 h/l/9sSQRPh-#j(&tdd/ h/ˋl/%h/RP8 @u+5l/5h/hp#j%'0P_Z@uh#[^ @@uh/h#7=/u/u hՙ#j2tT uh/h#u.h[$P^_/th>!Vh@#j/t(/1RP5/5/////1;|i<@ t" /1SQRP+ //19| h#t0 //9sSQVRPh-#jtSp/ / /%/RPf, @u&5/5/Vhp#j0P觎Y[@uVh#XZ #jhd+hh5,&12h j%1%1%1%1%1%1%1%1Eգ EĀEEEEjEPj#(hգ ja8_X19\$0~h $0jAD&1DTZY~93<&16 6ulPSh#4 +TXDTpp@;T$0pf@flX$0Hff9lu `+#0 $0#0#0 #0u#0P$0P@P$0<&1Dž`Dždh sCp@`p@ h`ȉEEhiE'%Utpp U#0/ݕ`($0($0݅` $0 $0h+ܝ`v ݅`h+݅`0$00$0<$#jXp-<[(p@<$̰#h#Dh#:hɹ#0h#&pf@fPh#h,#h@#hX#hq#h#h#h#hȺ#hٺ#h#h #Ph#jXp;;Y6hC#2XpN1jXp:Zp@<t%w uhQ#<uh#hb#1Xhp#Ph#1^_p5/Phλ#0jXp:[~pf@fp@fRPh#%1 jXp0:Y+h#jXp :Zh#jXp9_p@t <uhE#h/#0^ Phc#0Y[Xp/%jXp9Zzp@Ph#;0Xp/_XjXp69^1h#jXp9[ h#jXp8Yh#gjXp8Zh@%DjXp8_hѼ#!jXp8^|h#H/[Dž`DždDžlqjXp:8Y5pPh#.XZDž`DždDžl<&1htXp--DžhDXT<wY<Tp{CP_=Glh #2.XPO,P\kT1 .ōCPCTw{@9~@@Xl;#0uSSh#0PG u;lt h#u-X@H)ƉTP.#0#0NjP󤃽lu!'.h"#-XDžl h!#-_P+.@P\kTDT r-뵃lh'#,^wluRDppf@fucd`VhX66DžlPh,#-,ZY DžTTNCPTP[lt ,h,tX0P$0;`$0]%=&1C؋lflf`&1!htH&1PP$0Džh%lflf`&1$0@Džl9Dxpf@flfuxbd`WhX4$0P)؃t0(u\4&1Džlub<&1t@4&1h#)4&1Džl u7<&1 t 4&1hո#V*XRSh#G* Džlhuipf@fPffX+f~8<&1t1KQ@PRh%#)<&1t 1+ufX+<&1u[luRDppf@fuad`VhXW3Džl5%1F9X<&1%1)P%0PpDPB a9~p%08DuC烽luODppf@flfuN`d`VhX2pDP%0P+%1ShZ#w(%1;%1}+u h.#W(XpDPh9#@(C^_Džl)Ѓ EMQMQMQMQMQMQMQMQMQMQMQMQMQMQMQPh.#R-Ƌ%1%1H19}L%0@91B<&1h_#'X9%1%0Phɫ!p'CY_UWVS} À8-uCh!S^Zu&d.1EEE+h!SY[1ۅu`.1Eh&#Wu tWdwA$#փEʃ=d.1t 빁뱁멁\1E듡+1;Et`E1WtUPZU<R%XEtPV h$VED>_;tj)2Ph#j }tVSh!j}DžuP_jr#t8=d.1tj jh!1Wh/#=`.1t j jh!1Wh<#j:28j jh!1 tVWhN#j2Wha#j2 h-"h!hD"2jjh-"h!hD"2 }ujjjjjj jj jjjj jjf@u hp#jjjKZY@uL8th}#=j跰X}u"j褰_j j ZY@u 8t+h#覼Y2 u h#RZ WaXVShо#t 0'0jjƒ #Bt-"SPha$jUWVSDu]  't11h#SV v~jq cStITtbLu11뼃dw$|#11111111zp11k11\11M11>+)ƍ膾11=11tjjh $:11 >Ejjj"^11jURh@hPs @u hY%Y=11y hbF&j;u=11% 2 W&up51t&h6#S&^_th#SZYt2=51u)U 5151/=$51F$515$51)+E+EtH:u =51= 51t =51=51tEt h6#W!YZt&h#WYZth$W_ZE U @o97@tCƀ551jj5515 51551Axag551jj5515 51551@>551Sj &Sh#j|5189=51jEPj @u h #IEUuuh'#/n[h`RPXh:#t SnYxE  1SQ%RPhJ#sG1=51t6?5N9phb$V_Zt#h#VZYtuj Sha#j Sh#j} UWVS u] Dždh#SV t"Rtfu0H91Dždʡ+`19EdmPW3ZYxPP|Y^%=`=@uyhPEuyPh#_>XZ``PhW :Wh#jWhDt hDƅ_hh#hW l=H91u Džp?#lPWMQYZ8t Wh#vXZ5H91VY_@Vh#T؍e[^_]UWVS`wh-"js_XE 0%Y1t1$p1$l1$#uZu#l1111P1L1\11,1x1Y1d1`1 1$111111ԛ1̛1Л1ț1Y1x1]1h#^^t/hPh]1 =vj?k$Sh#,"s1h![؛1u ؛1{ h#Yh,#P_Zu P1h,%SY^uP1L1QhZ#S_Zu x14h$SrY^uP1L1 Sh#:XZh#P^_uP1L1h-#SZYu x1h#_t1t8u t1-"=x1tt18uh#::^x1he%[th)"PsZY1ۅf,ftPZ_101,f,ftP1^t^1uP;tG,1;h5l.5h]1 =v*j??$5l.5h!jDž11ۋU Eh#RP P̃D$ #x1x1L1P11뛃 s1111q1b1S5l.5d1$"PZY,010,P1L1l.5t1j P5l.5 1~85l.5h6#:j P5l.5C ܛ1~85l.5hI#j`1i5l.5^1Oj h"W 5l.5_hT]%P.ZYt"8u5l.5h]#GujPWum @6!Dž15l.5OY1,1}1,1d5l.5Zs15l.5hu#s15t.5?u,1Ph#c6^_0,fn5t.5h#Ph#bjjj501{ E+)ЉEE E s11T11tq1x1DžDžhh1RjV5t& u0JP 5[PVh#a1a1h Yt8t PZa1ļuPXt= PXt߃=a1uF t8t PQ_a16DYa1=]1uya1uhW%"Za1ghPh]1 =v&j?d$5a1h#4 ]1hh#h]1F =w=a1tj G$ h#Ps j h#V h'#Xc#?hl#X-"l##hv#|X-"v#h#`Y-"#h#D_-"#h3#(X #h9# X##"hC#X-"#{hN#X-"#_VL jZXZhʌjY^hʌj _XhjXZhjY^hj_XEt7U ESRP1à Y1uSjj_XjXE j:0v[^t*E 0YuU ERP螥XZEjh1s^_uhj:Y[h֟j ,^_E 0j@V ZYÅt @,hPW% E @Dž=1t11ER@PXZ=1=1uu ܛ1ujSV =1t ܛ19s1Ph]#501 5ܛ1 X=1W뻃jh1rXZhjY[h֟j ^_e[^_]UWVS}u h PZYtdh SZYth SZYut169=0~u0+hx$VW9 ctD~σdu,p1ЃVu8h4$h"h0,jDlul1t1h4$h"h0,iShE$h0,Yj+9u!=p1t-#M1{)Y.;u5h1UWVS] 3yh-"j <1 1h $Su- uc`Gt+It2EtJa>$$ 1먁%1뜡l.5u-"<1@1z1k15l.5$P5l.5Ph!W+Hl.51H 1l.5u-"<1@1jjjh,h< $/1jjjh,Rh` $XzPPh $h0,Dj+ 51ut GG;ttG1GSj51ch, t h j25D1iUWVSTuE11hq$u V t4gt$utGu3l.5E8 l.5;u=l.5?+E)ƅvct3SYt@E'UtcMM@uShx$jQEEt cEE}t|t tu1j趘xtPt|XZt c}u@%Q}u ا$?j螗}^~jWƋxZYoV tJF;tujjjjjjjjj jWVjҎǃ4tj|W,W謏VOXx;]}4;|4-C_XP"|j膗à tPj-jSho"2P-2jO22j"C*2[^=T-2t jfY jjxXZ[11e[^_]UWVS(}E 0]pВ2Ԓ22XDž1DžDž1h,$u W @p&ab$$zFjhjj5l.5hU#Bul.5jhjjj5l.5h!$В2Ԓ26l.52'+)Džt&jjS#ǃ y Sh#jt d11PW[X%=LPВ2Ԓ2USh7$PBRh(!)}ÃuhB$TShVr$ uj PV[j jLВ2Ԓ2Sy ha$jY1ؒ2ܒ220,u,2@ftPhht@9ƒ PBt2^Zu h$PPt[y h$5褆y h$u@U jPڮS363h$jP辮hj 菿jWvà y8tjRh $j__Y11PeȃZ…tuʼnue8,9uDž 9u1 [jjj 肾uSDžSP y 8tj$Sh$j01ș ؒ2ܒ2)uyPUZy h$腄ƅy h$t*WجͬjjW襬蚬jh`"h$h$(h$|UWVSDžDž }~]E ph%V薢ZYÅuh%)N_h'%Vs[^Åu!h$h%h%M (1Dž`%+DžDž$Dž DžDž(,Dž\EEEEEjjY[@Sjjͪ^_@Tjj躪ZY@ÈUK DžDžDžƅt%kuu% Rh $Pu u}VSMh 6??4uƅ뙃Nw$$Dž%Džqfe$$Džw%DžEl.5`5l35l.5ۊlXZDžÀt ˀDže%DžhDžDžDžh%eKX ƅeDž%DžLEH;+t dScl|E tEp+U)‰u (W]jjjW]Tƃu$k^ ;+u uPjWgQt kuɅ! h%hJph%JJX;+u;VWQjj+u 4WSƃ u uPjWPnt ,h%I`\(PxX h%Ihd(S)0h!%IplSz  d h ȃHtd @Iu 俀dhd t @S_Xd@RfustS_v"8Sh|!W ?"t^"t-"h@%PSh2%j+(P,h-"h-"h-"h2%j+(Pdkt(P>H[ hW%Y@uh$hL%XZ3 uh$hY% jj 躶(Shjh$ P $@uh$hh%E .SxÍxXwà t=&Sh~%S裤uH8t h%Xv8t h")(P$Y   Sh%$DžDž Dž$DžXZjPգ(Pw @5 @c~Sh% tt Fdhdуhu,PP+} 4 dhu3 Pj+} 4 xdhPjj @H8th$h. %Y[g@t8h? %8s8 hfhhU %,U_Z@u!=8thU %h$hd %R hhr %TY[@u!8thr %h$hd % (S6wZt&uSh$h %~SPh %rh %_St&h,h=!h $ u h %~[e@Pjh0j@uhF&wYUtPjh0jd@t3y(\聡Sh\$UtTj 1_Z@u h+F& [Ttj ZY@t [_/Tt&h,h=!h $ u h %u Y@uh$h %qCxth\hr!h %^h\qSh\UX 3ShX_Ph %/ XZh@(Pt_tPh$h( %q d%h t =u-dr=1r +} QP(Pk @uh$h< %dh% u-"%u-"%r +} QRPhI&4](W`@uh$hN %1҉hSPxZY@u ha %f XWhoudr dRP(Puh$hm %Dž9~T4PZYu4h} %x u4h % _X떋t x tU@h% h %PD (P fuh %9 8t t M U䍅P(W f@tWYt4z t)ЉR ZtRȋdhs%tz tRu;uW1s-r' h %PW "t@tWhRj*VWF0[_~ tVh_jjvg@u h%SXu u(S[ sh %h_g@tzhShRjj@@Sh" ?@PZYy+h$h %[_Dž 1Džfu!(PY@uh$h. %XZtP]MXh t=t HXtYZP P_RDž[V(SeD ZYtPXSPtjP+2S[Si ;+tP*_h@tu h? %8^lY[h@t1\t&jRP@ @uh$h$$XZhu t$S諫h$h % h$h %؍e[^_]ÍL$qUWVSQ@YDžPT21L2Dž,Dž0Dž4Dž8Dž<hC%S@ +H00$88%@4%@45l.5fp21Ɋat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @fp2FaDžLj LP5l.5|ƉP0 8u!l.58tL8u ;PhA%pj LP5l.5x ~l.5:t L:t5l.5hA%ԗ2 @4@wthA%j @4jh,]+++Y^l.54 @4j LP5l.5 x+l.5 :t L9t RhB%jL@=Rh&B%l.58 @4 0LP5l.5l.5_Z8tL:t Pv)ݝ ˾݅ tjPhXB%6#v5l.5h|B%AٽFfF fD٭D߽ ٭F $++߭ D#٭D۝ ٭F +xy5l.5h=B% uhB%? +^ @4TֽtxhB%j LP5l.5@v< xl.58tL85l.5hB%$,%@4 @4 @4 @4 l.55 ,tDFu hB%)B卅(R$R RRRRR RRRRRRRRPh.#QƃH1Ʌ~ )1@4h_#XY12@9u919~2Phɫ! GXZj 5 @4t1DžtDžxDž|Dž:h(4Vj5l.5tPPhC%/(44rJB4R @4@Yj LP5l.5s+ xl.5:t L:t5l.5h2C%=hhNC%@4% - @4l@4%@4% @4DLP5l.52XZL8u5l.5h#6LP5l.5wx2_XL8u5l.5huC%+@)Ht|fp2B4j.S>Y^u SRZ)؉@?wPSP螙@Ƅ t@ ,t ,fBۍ1V^*@KjKPVt*@SVg*VdP+$TVhC%j@5 Hd`hSVjt8S"qX@4t=+ hC%%Xt1DžtDžxDž|Dž:h(4VjStPYPh#jt(4BtÉ2ru hC%e 4Jr rrp4 y hbF&LA4@t"54h4P t h$%!41DžDžDž:PtPj4tPgP4hD%j|xtA4t h2D%Xppj0j)54 t hYD%^$_A4tVDžjSj'j)54t hrD%jSj(j)54t hD%輶P薸豶P苷@4؃Y^u hD% u0+1҃‰2Dž@0 r+0@2+Dž@0 @w4Zu hD%Ktd2ؗ21ؗ2ܗ2Džd@4@t6jdPjh54;@s2@Dž@=4u(jPj j)54?@u hD%4,t/҉jRj*j)P@u7hD%TDžjRj+j)P@u hE%'@4%u) t DžDž j Sjj:54dy h3E%A4t-DžjSj&j)54.t hLE%0փ =+t1ۅt#VnXu hgE%/d25h21҃0t9S 1 C)C.K,h2d2 9v1ۃ8t/08-0B_u8hE%=+tC)C/C A4@"8Džjjjkà 8y hE%\444f4'u$44tjRj.j)St hE% =+tMjh+jj)St hE%=+t"jh+j j)Sft hE%h4S蔉 y h F%Ph4Sa( yhF%uS}^P+tf9} h%F%l[jPShh54yhPF%$jShh54yIhfF%j= ~ h%F%YDždjdPhh54]DžjSj$j)548y h|F%fZjSj%j)54y hF%fX@4  r)r  rr+PR(PhF%4xPhF% 4xP*< ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6 ?izx$Uj-%qE&xx' }E&.l$ ,F!" ' ƅ Ġ v    K   ! #=#" /"Y  a  _Z"  4=#i n ! (}"(#9[" & # % # v# )  /  z$X 5 Q n$H y$! h$% ;  * x#1 D "4 $: J 4A $KA W bA #yA c A o A u A U$vS  B%H] !x !x ,#)|   $ $ $      ̞   $ ! ] %   4 OB%      tx$ r& x" ƈa -"h -"^r | e)["  -"  ̇k   2!usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportal"ߐ   ?#@@ #Ǐ @@ #  #%ԏ * 0 a@@!6w"a@@6 unblock and -DNO_CONV?pYPZYuY00YWoflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputqqsssss:rsXrssssssgrssssssssshqtqqssqqqqsqr!rIrsssssvr 0100prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s(5ER_ly_ly@ NNN"NNNN"??????????N"NNN jX/\ODw oUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undo24!   md{J& m m m|"m/ m)"m m k$m m m m m@ m@  m m m% m,  m7 m? m)["m8@G mL mE9!m P m usage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocachecjHHHHHH܁HHHHHH*Hj [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dUaiulfs_cleaner_mainbrelsegetblkincorelfs_dino_setiblfs_dino_setdbcheck_summarytry_verifylfs_dino_getibpYGYPZ^i^bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALL%s: clean_fs returned %dincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free list?B?8! ! !Usage: %s device %s device command [arg [...]] Available commands: forcerw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgekeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Ɔ҆;'ކ6EBTȈcr Շ%ʇQ; a18!+!+!+!+!+!+!",!I,! ,! ,! ,! -! +-!;-!R-!,!g-!-!-!-!-! .!!.!7.!O.!k.! .!!oB##oB#$.!&oB#1oB#2.!3oB#4oB#5.!6oB#8.!9.!9.!:.!;/!<$/!=8!8!oB#8!9!oB#(9!K9!^9!q9!}9!9!9!/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionreallocarrExtended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. The bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.bad disktabInvalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/#}5!=>!G>!Q>!Z>!a>!p>!w>!}>!~i&>!>!/!>!T5!>!>!>!<$>!>!4!/A#>!>!>!>!t$>!>!>!>!?!||||/#}5!=>!G>!Q>!Z>!a>!p>!w>!}>!~i&>!>!/!>!T5!>!>!>!<$>!>!4!/A#>!>!>!>!t$>!>!>!>!?!~i&*A!.A!3A!24!;A!@A!FA!LA!RA!YA!>!`A!dA!<$d3">!t$/A#jA!t$pA!^+$   usage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdC!C!y" !$#٨$a"h$C!C! C!C! C!C!k$@l$$B% !C!@x$@C!C!usage: %s [-o options] special node getmntoptsspecified device does not match mounted devicemount table fullincorrect super block%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimeWarning: realpath %s"%s" is a relative path.using "%s" instead.*BtC!C!y" !$#٨$a"h$C!C! C!C! C!C!$C!@C!C!usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidgbcaseinsballnamesC!C!y" !$#٨$a"h$C!C! C!C! C!C!C!@usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %slfs_copydirnamelfs_dir_setnamlenlfs_dir_settypemake_dirlfs_dino_setib@%!sWsssɤss\"ssMt¥sssssssssssssѥsssss%sssOsssssssæ%s: can't read disk label; disk type must be specifiedbrelsegetblkincorelfs_dino_setiblfs_dino_setdbcheck_summarytry_verifylfs_dino_getiblfs_writesuperlfs_ss_setocreatelfs_writeseglfs_newseglfs_dino_setiblfs_dino_getiblfs_dino_getdblfs_update_singlelfs_updatemetalfs_gatherlfs_fi_setblocklfs_writeinodepYGYPZ^i^zero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Anblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s50rf_ReadSpareTableT~h!Hrk,Dh!HrQ+Qh!Hrk,Rh!qCh!qIh!q0i!q1"i!q4/i!q5 %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / quitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl23Ldf/aΫ!Ǫ!!! !G!\!s!!!ܬ!!(!?!P!n!!!í!!(!]!!!Ϯ!!!:! b! x! ! ! ! ̯! د! !*!>!U!l!!!˰!!!! /! !?!?޼!?!?!@*!AI!Bn!C.!D!E!Fҽ!G!H!I&!J!aV!bc!c!d!!!N!!!!!ҷ!$!0!>!K![!g!w!>!%13u %8u %4u entire track defective%10u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: scsibus%d target %d lun %d <%s, %s, %s> current disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. failed to clean Unit Attention: %sunable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCIOCDEBUGSCIOCRESETSCBUSIORESETunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sbusunknown %s command: %sresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identifyreassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x J              R;$ PFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'0@EiJ]usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslipCiFFGGFMMMMMMMMMMMMMMMMMNMMMMMMN@PP;QOWWZWZW ^(0<HS^ith#N%!!!!bitmask_printbitmask_scan!1!1!$!10!6!1f#K!10!X!1f!x!15 !2!3!4!1!!1!!6!7,7,!#)!19!A!19!U!19!e!19!w!1!!8!1!!1!!1!!1! !1'!2!1 E!1^!t!1!!1!!1!!1!!1 !!997!1I!N!1\!c!3t!y$!**!1!1!1!1%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor)b5b ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. +=DxPZDDDDDxDDDDDDD w!sw!w!w!w!w!w!w!w! w!w!w!8!w!}w!w!w!w!- w!w!E w!w! w!w!w!T!--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)Waiting for dataHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t-"(!8"- Cannot allocate memoryLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESCOLUMNSkrklkukdkPkNkh@7kDhcxndaticmso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadshifttildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundWXWXXVXXXXXXXXXWXXUXXtutttt disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)~"+~~~~~~4EQ~~~~HZno_editbootno_clearbootno_setbootgetmachinegetubootpathsgetfstypeparseoptionsmaintA"]%# 0$4}A"<A"HMt$@A"@G"8A"#!Dj`$ A"@A"LA"Pk$Tset_sunsumcompute_sunsum$+i386_setbooti386_editboot1$$$‡$ׇ$F"F"F"F"$, Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'Unknown option `-o %.*s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x Boot options: timeout %d, flags %x, speed %d, ioaddr %x, keymap %s Patch area in stage1 bootstrap is too smallconsole %d console %s invalid console name, valid names are:/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbd܌l;HL"L"L"0L"0L"L"L"M"M"usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: )5DSb{%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv........++++++Usage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readddddddd*d9dddHoddddddpopdnepushdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory +:Iusage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw,,,,,,,,,,,,,,,,,U,,,,,d7,_},oԲ,,$,,,,,,,,#ֱ,~K,ְPnŲ<, %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long       A  R   \   s s ^+ + H( + O+ + + + + + + + + m+ |+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + * + + + + "+ + 1+ @+ + + + + + + + + + H( * + + + + /* >* * + + + + + * + + H( >* + * + * + * + + + + + + + y( ( + ( ( + ( + (  ) ) () + 7) p) ) ) ) ) ) ) ) ) +  * e5 5 5 5 5 5 5 5 5 5 5 5 5 V5 G5 5 5 t5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 0 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 i3 ~3 5 3 3 5 74 V4 5 5 5 k4 4 4 4 4 5 5 5 4 4 4 5  5  5 55 5 5 5 5 5 5 0 0 0  1 5 1 5 5 -1 ?1 N1 `1 5 u1 1 1 5 N2 Y2 x2 2 2 2 2 5 Z3 abcdfiklnoprstuvwxABDEGHLMPTUVXYZF F ~F F gF F NF F E F F ` ` ` a ` ` ` ` `  Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot unlink %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot close file descriptor on %sCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./! s s { s c  s s  usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directory1 + = = = = = = = = = = = = = = = = = = = = = 1  = = =   = ~ J ~  < # = P C 8  I W  C g 2 T z j     ف    j       ܒ                      ã" ϣ"!"""#""#""$"8"EI"Z]"r"""#" "_"^"F"<">Ӥ"?"" =    ќ Z   _ _ v  S S  S S S S S S S S S S ԝ  PATH=b  > k o > > > > > > > > > > x   >    9   9 9 9 9 9 k 9 9  / C 5   r r r r    0 0 U   K  (  \   x        L L ,   T     S S    w      J J    p&%tq b"fA#"d""s#b"cĭ""m""l˭"%r %"pҭ""nڭ""v ":D"b    B D D EC D D YC D %D 8D U "E"El l k 3l l l l m m [-$*"""!"$"'"""]%k$@l$""$"*"0"'@%6"@"@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'|.0m"h.1u"T.1{".8"@.0"ɾ .0·".0ɷ".0з"8 .0ٷ"ȉ E L a & h z     &  & ڜ   & & &     7        ˝ ޝ   3 N l   6 A I Y #  ]2#^# 4"#X,""!o "p y! $ $1& (!8" Q=" Zf&=!_#`!#@" #Yc%" "!"Z$(""""[-$                o/" ! @% `"y a" %W" " Ҫ" Z% t$+8 ("k7 # lT&z 9" " #F e" #o& h" P"$ "= n"= r" x" {" $ ;# ": ju& " "f |"& " #- G"' "r ") ,% w&| "]* "{ b"0 "| ", 7$ i.$ "J " ݦ   ݦ ݦ ݦ ݦ ݦ  ݦ ݦ Ʀ ݦ     ) ) ) ) ) # # ) ) < <   Ч             # # c c c c c R R c c   ު      W   ^ e        l    s  z     1 o o o o o o o o  Ʊ β 1    o 1 o o o o o 1 o o o  o 1 o o 1 w {   !   % % % % % % % % % % % % %  Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${(...)$(...)"((<>>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:20240328083333Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failedpB"b !""" )":6""k$)"""&! "p$ )["$ " p&":}$ "n j^&Ĺ "Ĺ "J s+! "¹ " "B F" "%ۻ p" $ۻ S" " 3". .% " "J ,#0 G"O :!ۻ """"'"."5"<"D" K"@"C$"C"C$"Co!"P"V"""]"d"""H"l"t"@"@}" " B":"""@"" """"""""" "@"""6""6""" """" q!#"3&"#%"3-"2,"33"32"#y"S"Z"b" j"@ @q""""option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZS            m owner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.          T        H  P  P P  P P    O  P ? P P P P U P P P P P P P P P P P P P   P P  P P    P P P  P  P - 8  6  |  V  """ "1"E"U"h"""""""#"5"="}"C"H"O"V"]"d"m"t"F"}""""""""""""""""""""""!"("1"6">"D"J"R"Z"b"@="@h"@p"@w"@"@"@"@"@"@" @"@"@"@"@D"J"""""""""""""""""("@/"@4"9"C"I"T"["a"1"g"m"u"z""""F"F""""""F"}""/#}5!=>!G>!Q>!Z>!a>!p>!w>!}>!~i&>!>!/!>!T5!>!>!>!<$>!>!4!/A#>!>!>!>!t$>!>!>!>!?!~i&*A!.A!3A!24!;A!@A!FA!LA!RA!YA!>!`A!dA!<$d3">!t$/A#jA!t$pA!^+$f                J , /#}5!=>!G>!Q>!Z>!a>!p>!w>!}>!~i&>!>!/!>!T5!>!>!>!<$>!>!4!/A#>!>!>!>!t$>!>!>!>!?!~i&*A!.A!3A!24!;A!@A!FA!LA!RA!YA!>!`A!dA!<$d3">!t$/A#jA!t$pA!^+$M  M     M   n     M /#}5!=>!G>!Q>!Z>!a>!p>!w>!}>!~i&>!>!/!>!T5!>!>!>!<$>!>!4!/A#>!>!>!>!t$>!>!>!>!?!~i&*A!.A!3A!24!;A!@A!FA!LA!RA!YA!>!`A!dA!<$d3">!t$/A#jA!t$pA!^+$changing %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tableD5can't get msgbuf q  q q q q q & q  q   q q  q K q W  [-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]W$~$1$$[$~$/#}5!=>!G>!Q>!Z>!a>!p>!w>!}>!~i&>!>!/!>!T5!>!>!>!<$>!>!4!/A#>!>!>!>!t$>!>!>!>!?!returning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %d# V$ V$ V$ V$ # V$ V$ [$ V$ V$ V$ V$ V$ V$ V$ V$ P" " " d# V$ o# V$ V$ V$ V$ V$ V$ {# # V$ # # V$ V$ V$ V$ V$ V$ $  $ $ LJ \  ؈  \ S O  O  1 returning to single-user after filesystem check  ffs_setblockffs_clrblockffs_isfreeblockffs_isblock""""        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?L  2 0 L L wapbl_replay_readwapbl_replay_can_readwapbl_replay_writewapbl_replay_freewapbl_blkhash_freewapbl_blkhash_clearwapbl_circ_advancewapbl_blkhash_remwapbl_blkhash_inswapbl_circ_readwapbl_blkhash_initwapbl_space_useduntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d)#1#1#1#1#1#1#1#&2#02#o&_2#0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-/#)6#5#5#5#5#5#6#6#& & 2& 2& ' &  ' 2& 2& ' ܒ++++(+@+X+t++++ؓ++++(+H+h+L#g` ` E` E` E` E` E` ` E` ` E` E` E` E` E` _ E` _ E` ` ` d d ud ud d ud d d ud ud ud d d ud d ud ud d ud ud d ud d d ud ud ud d d d /#}5!=>!G>!Q>!Z>!a>!p>!w>!}>!~i&>!>!/!>!T5!>!>!>!<$>!>!4!/A#>!>!>!>!t$>!>!>!>!?!8!+!+!+!+!+!+!",!I,! ,! ,! ,! -! +-!;-!R-!,!g-!-!-!-!-! .!!.!7.!O.!k.! .!!oB##oB#$.!&oB#1oB#2.!3oB#4oB#5.!6oB#8.!9.!9.!:.!;/!<$/!=8!8!oB#8!9!oB#(9!K9!^9!q9!}9!9!9!t %t zt Jt Vt bt nt  u vu 2{ J{ i{ i{ i{ i{ 8{ i{ >{ i{ i{ [{ SFH0eC쬦@#N5!SFU0eC쬬@#4!Hah!IdontNeedEFI@#@#(s*K>;d$@#|nQn- q+@#@#|nQn- q+@#@#|nQn- q+A# A#|nQn- q+A#'A#|nQn- q+5A#?!=rGy=iG}9A#DA#;Mt?OA#ZA#mWC 3KOOeA#pA#yD<#*=({A#A#3Dh&j"A#\ M}-A#A#-чH>!A#-чHt$A#ZIчH~$A#IчH$B#IчHUA#B#2IчH}5!,B#S'@ )Ѹ8B#?B#*1@ )ѸYB#>!1x )Ѹ^B#hB#store_tblstore_gptbackupa:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedgpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in6_statusin6_addr_flagsin6_constructor3_#+,%+^#^#+_#~h#in_statusin_addr_flagscommit_addressdo_setethercapssetethercapsla#za#a#, + , + , , , + , , , + , , , , , , + , + + , , , , - , 5+ 5+ 5+ 5+ 5+ - 5+ 5+ 5+ ?- 5+ 5+ , do_setifcapsdo_setifpreferenceusagemainclone_commandsetifflagssetifcapssetifdstormasksetifaddrstatusprintallsetifbroadaddrsetifnetmasksetifprefixlensetifmtusetifmetrich#zi+!yi"""+`#+#""+%@+V%+`#@+h#R$+#+j# +g#x+j#ʹ +"j#ԛ+)j#ԛ+!j# +(j# +Gj#Rj#]j#ij#uj# j#j#j#@j#j#j#j# j#0j#@j#j#j#\%&j# j#k#  k#@,$%media_constructormedia_statussetmediainstsetmediasetmediaoptinit_current_mediasetmediamodel#l#k$k#@+k#l#k$k#@+k$l#k$l#+l#l#l#l#+l#l#k#k$$+r'"l#r'"l+l#Gl#l#&D#l#,%~i&,$l#,% l#,%`l#l#@l#l#l#,%&D#l#      paddr_match    6 {  {  { r { = settunnel*n#R +0n#+print_link_addressessetvlanifsetvlano#+Uo##o#+To#Uo#V -"b                               # * 1 8 ? F M T [ setifbssidsetifnwkeysetifpowersavesleepsetifssidsethidessidsetapbridgesetifpowersavesetifchansetiffragt#t#t#t#setifrtsu#+u# +&u# +%u#&u# +q#+q#q# * +O$++u#l+1u#+0u#K +`%+q#`% * +K%l+p#@+!2 It#It# q#q#[ o#o#  [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %sinet6 address lifetime not allowed for the AFpltimeia6flagcould not determine link local addressinet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sclonecmd[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA; u= u= V; u= _; ; ; ; ffs@#C! ##"#C!%$#$@v$n$f$#C!# C!# C!#####7#J#|" Y#@e#v###@#W$~$1$$P Հ#ڀ#[$ ~$#C$##5A#%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'puffs|already mounted%s on %s type %.*s: %s mount_puffsrump_%sexec:Cannot open fd to mount programexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]Only one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@asynchronousnfs4aclsposix1eaclsextattrnocoredumpsoft dependenciesexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecoreudfefsnilfs  | & | | , | | | | 2 | | c bnorripbgensbextattbnojolietbnocasetransbrrcaseinsC!C!y" !$#٨$a"h$C!C! C!C! C!C!$C!@'#.#3#<#F#J#O#V# egjo:rextattgensmaplcasecasetransnrrrripjolietrrcaseinsC!C!y" !$#٨$a"h$C!C! C!C! C!C!# #k$@l$$B%C!x$@ !@#%C!@#"softdep K K K K l  K  K K K f  x bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorC!C!y" !$#٨$a"h$C!C! C!C! C!C!k$@l$$C!@usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s   ! ! ! ! ! ! ! ! ! ! ! ! !  !   ! ! ! ! j ! ! m ! ! !  !  !  ]! ! ! E! ! ! ! ! ! ! ! !    ; ! ! G !  ! !  ! !       Q! ! ! *! bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacC!C!y" !$#٨$a"h$C!C! C!C! C!C! !$C!@e"B#G#)"%Q# W#@`#g#o#1p!Y E %u# r#@$ ##{##%#/# :#@rpc_getportrecvrpcrpc_callsendrecvConflicting version options rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm][-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s Illegal value `%s' for option -%cwsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfsnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s+ ". ". ". ". ". , ", `, ". ". ". , ". - $C!C!y" !$#٨$a"h$C!C! C!C! C!C!C!@C!C!usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o : ; ; ; : ; : ; ; ; ; ; : : B H H H  H B H B H H H H  C /C H H H uC C H C H H H /H H H H H H H C D H 9D ]D D D -E TE H H H {E E E F WF H F H G RG %s partition type is not `%s'#6#d##Ԝ##g#~##ǝ## ##?#u###О###=#o##˟###5#%s: can't read disk label; disk type must be specifiedWTWTbSS usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock>)T nV 2V nV nV T nV nV nV nV mT T nV nV nV T nV nV T nV nV nV AV  U nV nV nV JU nV nV tU nV nV nV U U nV nV nV nV U nV nV V %s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk labelwtfsiputallocinit_resizeinofsinitrdfsSSSWTWTbilog2usage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir :a u^ b b b b ` b b  ` b b b _ _ ` b q` b b b b b b b b b b b b 5^ b A^ ^ b ^ ` ^ ^ b b _ b =_ L_ [_ _ _ _ /` b ` ` l m n p p n n  o 2o o o p ,p Op rp p m (m 2m ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()     x  x x x x x x x x ʱ K x x ٯ x    s z       W 9 0 E c P P ?| f| | f| f| f| f| f| f| f| | f| f| | f| | | f| |  k k D k  ~ k Ԁ  k  ~   e  s   k   k k ~ N (  Y # . ~  ~ ~ Z ~ k ~ Z k k k k k O   k k 9             ́  ؁ DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR#####?#i######O#w#####dfLnqSsTtv0123456789abcdefUGHRBD M@dmCLS1@2plbatalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s InternetInternet6AppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspec S S r S S S S S S S S S S S S S S S S  S S S S S S S S S S S  S  ̊ S    S S  $ @ O ^ m  S  ŋ hw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Y@Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_urlrecvrequestsendrequest###:  C         ԗ  L                                b   n  }            P   L s   ***************************************************************************************************************************************************************************************************************************************-"######TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230505NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sNLSTMLSDMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandEPSVLPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream{2P` #)dH]kzzANetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gz=Z}>1T} } } }  ٟ  }  } } ! } C } } } F } } R 111111G11111111I1111111111111111Sw11311F1`1F<11[91S\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i3P\k#/;G~Pr2T`lx0Z3+Z3/Z33Z33Z3Z3Z3Z3Z3/Z3Z3Z3Z3H3V/?0152 20Ψ$^$#F"D:2$$` 2 $-"22$-")2$&$-2ɩ$5$.2D$L$~/2c$n$"2$$`!2$$}02$-"02$-"12$-" 42$ɨ$`2֨$(-2ݨ$$-2$-"X-2$~$32$Ψ$`2 $$ 2($+$325$+$`"2F$&$$2O$5$%2]$e$&2$$#2$$'2$-"'2$-"(2$&$ 52©$5$62ө$-"72ީ$$*2$$82 $-";82$-":92collect$$2$M$8$Q$d$cФdQ7mount_disks[$$1$#W$NAME=/#}5!=>!G>!Q>!Z>!a>!p>!w>!}>!~i&>!>!/!>!T5!>!>!>!<$>!>!4!/A#>!>!>!>!t$>!>!>!>!?!str_arg_subst> get_available_cds    !"#$%&'()   !"   !"   edit_and_check_labeledit_fs_type_ext1Ll_o<[MJ"+ /#}5!=>!G>!Q>!Z>!a>!p>!w>!}>!~i&>!>!/!>!T5!>!>!>!<$>!>!4!/A#>!>!>!>!t$>!>!>!>!?!1$$$‡$ׇ$F"F"F"F"Q$h$disklabel_set_part_infodisklabel_write_to_diskdisklabel_change_geomdisklabel_freecdtPr\\)_Z7_W_T]dUWTSkZgEYVOOV_beDO3g@U(UTXsT/#}5!=>!G>!Q>!Z>!a>!p>!w>!}>!~i&>!>!/!>!T5!>!>!>!<$>!>!4!/A#>!>!>!>!t$>!>!>!>!?!^?"$@)$@2pq(qOqqselect_part_schemeouter_fill_part_menu_optsedit_outer_partst$$!$$$!$*6#$F"$$$5&$p" $a#&$ T"/$)6"7$!G$L$Z$d$ t$x$F2!$ ]%$)o!$%$E"$<$$ !$ s&$F&$$$ il!$ $$ $8 $)"$>#"$,$7$B$L$normalize_clones   !"replace_by_default----------------------------------- - --------------------//tmp/usr/var>Qy@[}>R_is}TPfvs /Ez ,=(?Af*=^5g4N2N2pN2 PN2LQQbG     pm_from_pepm_whole_disk./0123456/#}5!%q"$$$~$1$$$$P /!Հ#$ڀ#[$ t$>!$#/A##C$##t$$>!YB#$5A#gpt_get_uuid_part_typegpt_get_part_alignment$gpt_get_part_deviceDetails for index GPT part - gpt_read_from_diskgpt_create_newgpt_free`"$  ,{,a-++'!"9(X'3! "k6S5r87M.8q(&+~$}5!j"j"d$d$@#$ 9A#@#>!t$UA#8B#YB#^B# 5A#!)#1#1#1#&2#o& SFH0eC쬦@#N5!SFU0eC쬬@#4!Hah!IdontNeedEFI@#@#(s*K>;d$@#|nQn- q+@#@#|nQn- q+@#@#|nQn- q+A# A#|nQn- q+A#'A#|nQn- q+5A#?!=rGy=iG}9A#DA#;Mt?OA#ZA#mWC 3KOOeA#pA#yD<#*=({A#A#3Dh&j"A#\ M}-A#A#-чH>!A#-чHt$A#ZIчH~$A#IчH$B#IчHUA#B#2IчH}5!,B#S'@ )Ѹ8B#?B#*1@ )ѸYB#>!1x )Ѹ^B#hB#DDDDDDDDDDDDDDRRRRRRRRRRRRRRVVVVBVV VBVBVBVVVBVVBVBVVBVBVVBVVBV;VBVBVVVVmbr_get_generic_part_typembr_get_part_deviceadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_read_from_diskmbr_create_newmbr_init_default_alignmentsmbr_free $$)$)$R}]LVRMY]NEYXF=FMOM(NZN^JKkhn[LGv|6e\GJZQOO|~}4! $$$4!h2!pA#$>!A$`2!6! $$*$ =$K$/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 10.0 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.0 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.0 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.0 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.0 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeWi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.0 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.0 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the first serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogxfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgcdn.NetBSD.orgftp dirpub/NetBSD/NetBSD-10.0ftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:iwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr/usr/mdec/mbr_ext/usr/mdec/mbr_bootselCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)Ukrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal errorparts->geo_sec != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition : : Ш ۨ : : : : :  : : :  ***************************************************************************************************************************************************************************************************************************************-"######usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_writeonecontrol_handle1control_recvdatacontrol_free w  w w w  ΰ ݰ 2 e w w B  w w  w e t w w w w w w  ###dhcpcd_readdumptimeoutdhcpcd_readdump2dhcpcd_readdump1dhcpcd_readdump0dhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_stderr_cbdhcpcd_handlelinkmaindhcpcd_handlehwaddrdhcpcd_linkoverflowdhcpcd_handleinterfacedhcpcd_prestartinterfacedhcpcd_initstate2dhcpcd_reportssiddhcpcd_handlecarrierconfigure_interface1dhcpcd_selectprofile Copyright (c) 2006-2021 Roy Marplesduid_geteloop_starteloop_signal_maskeloop_signal_set_cbeloop_exiteloop_q_timeout_deleteeloop_q_timeout_addeloop_event_delete_writeeloop_event_add_rwif_discovercwdfz,@GG9GGG&cwxGGMXGGBG;p';Gt -Q>  (Mu9aL`*dr_splitvadd_environparse_optionread_configdefault_configb%bn6"c&d%ed %f %g%hB%i"jΨ$k%l%m"%n"o)%p6)"q#r4%s;%#!t%u!vC%w%xJ%z!yZ%A`%Bm%C2 %Dt%E@%F~%G%He%I`#J%K%L7!M%N%O%P%Q#S7$T%U%V%W%X%Z$1%4%6#%%| ~ %}+%)%2%B%T%b%`%i%g%n%v%{%%%%٨$$$%%%%%%%%%%%% 7%%%%R$%% %%%*%%3%%?%rt_deletert_addrt_buildrt_descrt_recvrtrt_freert_proto_addrt_newrt_setifrt_new0rt_disposert_headclear0rt_compare_proto      sa_in6_initsa_in_initsa_cmpsa_addrtopsa_fromprefixsa_toprefixsa_is_loopbacksa_is_allonessa_is_unspecifiedsa_addrlensa_addroffsetscript_runscript_runreasonmake_envscript_buftoenv&%%o& 7%%#g#%]F!%%%,`#K%"%dhcp_envoption0123456789abcdefdefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt )if_ifaif_initrtif_copysaif_routeif_carrierif_opensockets_osq#%%!x%%%@CD@DCPT@P HEPT$ ( read_leasedhcp_initdhcp_start1dhcp_recvmsglog_dhcpdhcp_handledhcpdhcp_packetdhcp_informget_leasedhcp_readudpdhcp_binddhcp_readbpfdhcp_openbpfR%%]%%i%%* x%%%%#%%%%%r%.#%%%x% %%ipv4_handleifaipv4_addaddripv4_getstateipv4_deladdrinet_dhcproutesipv6_tempdadcallbackipv6_newaddripv6_addlinklocalcallbackipv6_getstateipv6_regentempaddr0ipv6_addaddr1ipv6_deleteaddripv6_readsecret^^ipv6nd_handledataipv6nd_sendrsprobeipv6nd_startrs1ipv6nd_dadcallbackipv6nd_handleraipv6nd_recvmsgipv6nd_expireraipv6nd_applyraipv6nd_rtprefx      DD;)2 d]i33533>335554dhcp6_startreleasedhcp6_startconfirmdhcp6_readleasedhcp6_startinitdhcp6_recvdhcp6_start1dhcp6_openudpdhcp6_startrebinddhcp6_startrequestdhcp6_validateleasedhcp6_startdeclinedhcp6_startinformdhcp6_startdiscoverdhcp6_checkstatusokdhcp6_recvifdhcp6_recvmsgdhcp6_sendmessagedhcp6_startrenew7%7%.7%E7%P7%\7%j7% '')*PQ'|}w~7%7%7%7%10%80%7% "0%7% 7% _5%.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %s%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRESTOPPED%s: removing interfaceNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d %s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinfreopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccallback != NULLnseconds <= NSEC_PER_SECread_cb != NULL || write_cb != NULL%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initnd_dhcp6_invalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundtemptemporarymudurloption %d requires an argument%s: embedded config too bigarpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSfwefwipvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigreading standard input%s: reading lease: %s%s: %s: truncated leasebootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s not foundNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: %s: became stale%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 router solicitation for %0.1f secondsreachable again%s: %s is %s%s: DHCPv6 Vendor Class too big%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.c%s: %s received from %sTIMEOUT6INFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completedelayingbroadcastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: extending DHCPv6 lease%s: no advertising IPv6 router wants DHCP%s: failed to decline duplicated DHCPv6 addresses%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%s: failed to request DHCPv6 information%s: failed to request DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %s%s: redirecting DHCP6 message to %s%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6`??@_J_T_^_h_r_|____a`a>^E^L^S^Z^3XP`Z`d`n`KaRaYa`agaz               ,           U     j     5            E 7%F%0L"F%@%R$-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limit%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s failed to get receiving packet informationinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 addressGnXo`oPo@o`o`o`o`o`o`o`o8o`o`o`oHo`o0or̂0[sK{ĂׂOggfVU%I@843.*c'$#" rbFCV{JY%="%Y%*#@Y%VZ%lx&Z%A$%Z%ƨZ%ިBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~Z% ,Z%M%U%"Z%Q%U%Y%="%Y%#Y%Z%x&Z% A$@%Z%Z%&&`& .׷$@>>EY%u="%Y%<#}Y%Z%x&@Z%A$Ɠ%Z%Z%L/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d %ju%s%0*jusnaparchivedsappendschangesimmutableuappenduchangeuimmutable ,^^E^^^^^^^^^^^^^kN/Alink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02xti A%5|=R`s``````````````/`````pqrstuwxyzPQRST/dev/ptm0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pidjanuarygmtmidnightyeartomorrowa.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayt^66DK||Da6UMz<&x,.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c !"#$'+: ,2/ +0-*1. )#'"%56!    full-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT.sysctl hw.disknames failed/rdkno match for `%s'sysctl kern.root_device failedkern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot allocate %zu blocks of size %zuCannot re-allocate %zu * %zu bytesCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]Cannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string$$%%%%%%%%%%%%%%%x%$h%`%X%P%H%@%8%%(% %%p%%0%%%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakech5MS7) Jۏbq!rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb n    #$ ! acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$^G^M^Ikbskcub1kcud1^M^J͠cc͠ccccccccc%cccccccccccZʡʡʡʡԡʡʡԡԡʡԡʡԡʡʡʡʡʡʡʡʡʡʡʡʡԡԡԡʡʡԡʡʡʡʡʡʡʡʡʡʡʡʡʡԡ}ʡʡʡʡʡʡʡ'ʡʡʡʡʡԡʡʡʡʡ'ʡGʡʡʡԡʡ'Nʡʡ?ʡʡʡ'ʡʡԡʡiccccccccccicccccccccciccccccci̢̢̢ʢ̢̢̢̢̢̢̢̢̢̢̢̢̢̢5&̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢̢ب̢̢̢̢̢̢̢̢̢̢̢̢̢̢Ĩ̢̢̢̢̢̢̢̢̢̢̢̢̢̢٢٢٢Ȣ٢٢٢٢٢٢٢٢٢٢٢٢٢٢3$٢٢٢٢٢٢٢٢٢٢٢٢٢٢٢ߨ٢٢٢٢٢٢٢٢٢٢٢٢٢٢֨٢٢٢٢٢٢٢٢٢٢٢٢٢٢¨٢٢٢٢٢٢٢٢٢٢٢٢٢٢unknown error%s: generic terminal%s: hardcopy terminalTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo database%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeE[qEf99P|b A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe    # "  !""$acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerombitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswslbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon2Kn,X` %K/usr/bin/rshRCMD_CMDCannnot exec %sR%zu W%zu L%lld %d *0*12aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz   !"#$1234%&'(5678)*+,9:;<-./0=>?@                                                                                                                                   #& +6 )4%/7(3-!0,1'8"5.*2$ 91)! :2*" ;3+# <4,$?7/'>6.&=5-%      :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'argon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzArgon2idArgon2iArgon2dUnknown error codeOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureOutput pointer is NULLPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0The free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Some of encoded parameters are too long or too shortThe password does not match the supplied hash..///....>/6/./&/////////////~/v/n/f/^/V/N/F/...                                         ɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[acosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error neg**non-integral: DOMAIN error B“tW;gY ^׏*Xҋq qBі 8ܒ>B“tW;gY ^׏*Xҋq qBі 8ܒ>ҋ-DT! @incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checktoo many length or distance symbolsinvalid code -- missing end-of-blockؾQ6Zi#08ɼ[ŷ@EA@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler @  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N60w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-need dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version  0@`  0@`  (08@P`p        L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c      str != ((void *)0)fmt != ((void *)0)src != ((void *)0)ps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)prop_string_append_cstringprop_string_create_nocopy_prop_string_rb_compare_nodes_prop_string_rb_compare_keyprop_string_create_formatprop_string_create_cstringctx->poec_capacity != 0ctx->poec_buf != ((void *)0)<>&plist version="1.0"!((*cp) == '\0')?xml !DOCTYPE plist