
                                  recoder 
                                      
   
   
Function

   Remove restriction sites but maintain the same translation
   
Description

   recoder scans a given nucleotide sequence for restriction sites. It
   reports single base positions in the restriction pattern which when
   mutated remove the restriction site whilst maintaining the same
   translation (in frame 1 of the input sequence).
   
   Several restriction enzymes can be specified or alternatively all the
   enzymes in the REBASE database can be investigated. To find out
   whether the single point mutations found by 'recoder', introduce new
   restriction sites, 'silent' should be run on the original sequence.
   ('Silent' searches for silent point mutation sites which maintain the
   same translation.
   
   The output for 'recoder' is similar to the format used by 'silent'.
   
Usage

   Here is a sample session with recoder
   

% recoder 
Remove restriction sites but maintain the same translation
Input sequence: tembl:hsfau
Comma separated enzyme list [all]: EcoRII
Output report [hsfau.recoder]: 
   
   Go to the input files for this example
   Go to the output files for this example
   
Command line arguments

   Standard (Mandatory) qualifiers:
  [-sequence]          sequence   Sequence USA
   -enzymes            string     Comma separated enzyme list
  [-outfile]           report     Output report file name

   Additional (Optional) qualifiers: (none)
   Advanced (Unprompted) qualifiers:
   -sshow              boolean    Display untranslated sequence
   -tshow              boolean    Display translated sequence

   Associated qualifiers:

   "-sequence" associated qualifiers
   -sbegin1             integer    Start of the sequence to be used
   -send1               integer    End of the sequence to be used
   -sreverse1           boolean    Reverse (if DNA)
   -sask1               boolean    Ask for begin/end/reverse
   -snucleotide1        boolean    Sequence is nucleotide
   -sprotein1           boolean    Sequence is protein
   -slower1             boolean    Make lower case
   -supper1             boolean    Make upper case
   -sformat1            string     Input sequence format
   -sdbname1            string     Database name
   -sid1                string     Entryname
   -ufo1                string     UFO features
   -fformat1            string     Features format
   -fopenfile1          string     Features file name

   "-outfile" associated qualifiers
   -rformat2            string     Report format
   -rname2              string     Base file name
   -rextension2         string     File name extension
   -rdirectory2         string     Output directory
   -raccshow2           boolean    Show accession number in the report
   -rdesshow2           boolean    Show description in the report
   -rscoreshow2         boolean    Show the score in the report
   -rusashow2           boolean    Show the full USA in the report

   General qualifiers:
   -auto                boolean    Turn off prompts
   -stdout              boolean    Write standard output
   -filter              boolean    Read standard input, write standard output
   -options             boolean    Prompt for standard and additional values
   -debug               boolean    Write debug output to program.dbg
   -verbose             boolean    Report some/full command line options
   -help                boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning             boolean    Report warnings
   -error               boolean    Report errors
   -fatal               boolean    Report fatal errors
   -die                 boolean    Report deaths
   

   Standard (Mandatory) qualifiers Allowed values Default
   [-sequence]
   (Parameter 1) Sequence USA Readable sequence Required
   -enzymes Comma separated enzyme list Any string is accepted all
   [-outfile]
   (Parameter 2) Output report file name Report output file
   Additional (Optional) qualifiers Allowed values Default
   (none)
   Advanced (Unprompted) qualifiers Allowed values Default
   -sshow Display untranslated sequence Boolean value Yes/No No
   -tshow Display translated sequence Boolean value Yes/No No
   
Input file format

   recoder reads a normal nucleic acid sequence USA.
   
  Input files for usage example
  
   'tembl:hsfau' is a sequence entry in the example nucleic acid database
   'tembl'
   
  Database entry: tembl:hsfau
  
ID   HSFAU      standard; RNA; HUM; 518 BP.
XX
AC   X65923;
XX
SV   X65923.1
XX
DT   13-MAY-1992 (Rel. 31, Created)
DT   23-SEP-1993 (Rel. 37, Last updated, Version 10)
XX
DE   H.sapiens fau mRNA
XX
KW   fau gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia
;
OC   Eutheria; Primates; Catarrhini; Hominidae; Homo.
XX
RN   [1]
RP   1-518
RA   Michiels L.M.R.;
RT   ;
RL   Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.
RL   L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,
RL   Universiteisplein 1, 2610 Wilrijk, BELGIUM
XX
RN   [2]
RP   1-518
RX   MEDLINE; 93368957.
RA   Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;
RT   " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed as
RT   an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";
RL   Oncogene 8:2537-2546(1993).
XX
DR   SWISS-PROT; P35544; UBIM_HUMAN.
DR   SWISS-PROT; Q05472; RS30_HUMAN.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..518
FT                   /chromosome="11q"
FT                   /db_xref="taxon:9606"
FT                   /organism="Homo sapiens"
FT                   /tissue_type="placenta"
FT                   /clone_lib="cDNA"
FT                   /clone="pUIA 631"
FT                   /map="13"
FT   misc_feature    57..278
FT                   /note="ubiquitin like part"
FT   CDS             57..458
FT                   /db_xref="SWISS-PROT:P35544"
FT                   /db_xref="SWISS-PROT:Q05472"
FT                   /gene="fau"
FT                   /protein_id="CAA46716.1"
FT                   /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLA
G
FT                   APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKT
G
FT                   RAKRRMQYNRRFVNVVPTFGKKKGPNANS"
FT   misc_feature    98..102
FT                   /note="nucleolar localization signal"
FT   misc_feature    279..458
FT                   /note="S30 part"
FT   polyA_signal    484..489
FT   polyA_site      509
XX
SQ   Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;
     ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc        6
0
     agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg       12
0
     cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc       18
0
     tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc       24
0
     tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc       30
0
     gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga       36
0
     agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca       42
0
     cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc       48
0
     tctaataaaa aagccactta gttcagtcaa aaaaaaaa                               51
8
//
   
Output file format

  Output files for usage example
  
  File: hsfau.recoder
  
########################################
# Program: recoder
# Rundate: Tue Apr 06 14:32:52 2004
# Report_format: table
# Report_file: hsfau.recoder
########################################

#=======================================
#
# Sequence: HSFAU     from: 1   to: 518
# HitCount: 34
#
# KEY:
# Dir: Direction (Rev for reverse complement)
# EnzymeName: Enzyme name
# RS-Pattern: Restriction enzyme recognition site pattern
# Base-Posn: Position of base to be mutated
# AAs: Amino acid. Original sequence(.)After mutation
# Mutation: The base mutation to perform
#
# Creating silent mutations
#
#=======================================

  Start     End Dir    EnzymeName RS-Pattern Base-Posn    AAs Mutation
     77      81 .      EcoRII     CCWGG             78    P.P     C->G
     77      81 .      EcoRII     CCWGG             78    P.P     C->A
     77      81 .      EcoRII     CCWGG             78    P.P     C->T
     77      81 .      EcoRII     CCWGG             79    R.R     A->C
     77      81 .      EcoRII     CCWGG             81    R.R     G->A
    107     111 .      EcoRII     CCWGG            108    A.A     C->G
    107     111 .      EcoRII     CCWGG            108    A.A     C->A
    107     111 .      EcoRII     CCWGG            108    A.A     C->T
    107     111 .      EcoRII     CCWGG            109    R.R     A->C
    107     111 .      EcoRII     CCWGG            111    R.R     G->A
    182     186 .      EcoRII     CCWGG            183    S.S     C->T
    182     186 .      EcoRII     CCWGG            183    S.S     C->A
    182     186 .      EcoRII     CCWGG            183    S.S     C->G
    197     201 .      EcoRII     CCWGG            198    P.P     C->G
    197     201 .      EcoRII     CCWGG            198    P.P     C->A
    197     201 .      EcoRII     CCWGG            198    P.P     C->T
    248     252 .      EcoRII     CCWGG            249    P.P     C->G
    248     252 .      EcoRII     CCWGG            249    P.P     C->A
    248     252 .      EcoRII     CCWGG            249    P.P     C->T
    293     297 .      EcoRII     CCWGG            294    P.P     C->G
    293     297 .      EcoRII     CCWGG            294    P.P     C->A
    293     297 .      EcoRII     CCWGG            294    P.P     C->T
     81      77 Rev    EcoRII     CCWGG             79    P.P     T->G
     81      77 Rev    EcoRII     CCWGG             79    P.P     T->C
    111     107 Rev    EcoRII     CCWGG            109    P.P     T->G
    111     107 Rev    EcoRII     CCWGG            109    P.P     T->C
    186     182 Rev    EcoRII     CCWGG            184    P.P     A->G
    186     182 Rev    EcoRII     CCWGG            184    P.P     A->C
    201     197 Rev    EcoRII     CCWGG            199    P.P     A->G
    201     197 Rev    EcoRII     CCWGG            199    P.P     A->C
    252     248 Rev    EcoRII     CCWGG            250    P.P     A->G
    252     248 Rev    EcoRII     CCWGG            250    P.P     A->C
    297     293 Rev    EcoRII     CCWGG            295    P.P     A->C
    297     293 Rev    EcoRII     CCWGG            295    P.P     A->G

#---------------------------------------
#---------------------------------------
   
Data files

   None.
   
Notes

   None.
   
References

   None.
   
Warnings

   None.
   
Diagnostic Error Messages

   None.
   
Exit status

   It always exits with status 0.
   
Known bugs

   None.
   
See also

   Program name                          Description
   recite       Find changes to an enzyme site that introduce new enzyme sites
   redata       Search REBASE for enzyme name, references, suppliers etc
   remap        Display a sequence with restriction cut sites, translation etc
   restover     Finds restriction enzymes that produce a specific overhang
   restrict     Finds restriction enzyme cleavage sites
   showseq      Display a sequence with features, translation etc
   silent       Silent mutation restriction enzyme scan
   
   silent does the opposite to recoder. silent finds sites where a
   restriction enzyme site can be introduced without changing the
   translation in frame 1 of the sequence. recoder finds sites where a
   restriction enzyme site can be removed without changing the
   translation in frame 1 of the sequence.
   
Author(s)

   Tim Carver (tcarver  rfcgr.mrc.ac.uk)
   MRC Rosalind Franklin Centre for Genomics Research Wellcome Trust
   Genome Campus, Hinxton, Cambridge, CB10 1SB, UK
   
History

   Written (January 2001) - Tim Carver
   
   Renamed from recode to recoder 16 May 2001 as the old name clashed
   with a common UNIX print utility:
   http://www.iro.umontreal.ca/contrib/recode/HTML/
   
Target users

   This program is intended to be used by everyone and everything, from
   naive users to embedded scripts.
   
Comments
