
                                  prophet 
                                      
   
   
Function

   Gapped alignment for profiles
   
Description

   prophet finds matches between a GRIBSKOV or HENIKOFF profile produced
   by prophecy and one or more sequences.
   
   Note: prophet does NOT use the 'simple frequency matrices' produced by
   prophecy. If you have a 'simple frequency matrix'you should use the
   program profit to scan sequences.
   
Usage

   Here is a sample session with prophet
   

% prophet 
Gapped alignment for profiles
Input sequence(s): tsw:h*
Profile or matrix file: ../../data/globins.gribskov
Gap opening coefficient [1.0]: 
Gap extension coefficient [1.0]: 
Output file [hd_fugru.prophet]: 
   
   Go to the input files for this example
   Go to the output files for this example
   
Command line arguments

   Standard (Mandatory) qualifiers:
  [-sequence]          seqall     Sequence database USA
  [-infile]            infile     Profile or matrix file
   -gapopen            float      Gap opening coefficient
   -gapextend          float      Gap extension coefficient
  [-outfile]           outfile    Output file name

   Additional (Optional) qualifiers: (none)
   Advanced (Unprompted) qualifiers: (none)
   Associated qualifiers:

   "-sequence" associated qualifiers
   -sbegin1             integer    Start of each sequence to be used
   -send1               integer    End of each sequence to be used
   -sreverse1           boolean    Reverse (if DNA)
   -sask1               boolean    Ask for begin/end/reverse
   -snucleotide1        boolean    Sequence is nucleotide
   -sprotein1           boolean    Sequence is protein
   -slower1             boolean    Make lower case
   -supper1             boolean    Make upper case
   -sformat1            string     Input sequence format
   -sdbname1            string     Database name
   -sid1                string     Entryname
   -ufo1                string     UFO features
   -fformat1            string     Features format
   -fopenfile1          string     Features file name

   "-outfile" associated qualifiers
   -odirectory3         string     Output directory

   General qualifiers:
   -auto                boolean    Turn off prompts
   -stdout              boolean    Write standard output
   -filter              boolean    Read standard input, write standard output
   -options             boolean    Prompt for standard and additional values
   -debug               boolean    Write debug output to program.dbg
   -verbose             boolean    Report some/full command line options
   -help                boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning             boolean    Report warnings
   -error               boolean    Report errors
   -fatal               boolean    Report fatal errors
   -die                 boolean    Report deaths
   

   Standard (Mandatory) qualifiers Allowed values Default
   [-sequence]
   (Parameter 1) Sequence database USA Readable sequence(s) Required
   [-infile]
   (Parameter 2) Profile or matrix file Input file Required
   -gapopen Gap opening coefficient Any numeric value 1.0
   -gapextend Gap extension coefficient Any numeric value 1.0
   [-outfile]
   (Parameter 3) Output file name Output file <sequence>.prophet
   Additional (Optional) qualifiers Allowed values Default
   (none)
   Advanced (Unprompted) qualifiers Allowed values Default
   (none)
   
Input file format

   prophet reads a GRIBSKOV or a HENIKOFF profile produced by prophecy
   and searches one or more sequence USAs.
   
  Input files for usage example
  
   'tsw:h*' is a sequence entry in the example protein database 'tsw'
   
  File: ../../data/globins.gribskov
  
# Gribskov Protein Profile
# Columns are amino acids A->Z
# Last column is indel penalty
# Rows are alignment positions 1->n
Gribskov
Name            globins
Matrix          pprofile
Length          164
Max_score       645.45
Threshold       75
Gap_open        3.00
Gap_extend      0.30
Consensus       PIVDTGSVVSLSEEELSAVDKAWVKANSVAEVGGHALERGLFASEPMTLEFFDTFKYLSTFDL
SKGSADVKAHGKKVLDALGDAVAHLDDLEGTLAALSDLHAHKLKKGVDPVNFKLLSHCLLVVLASHLPGDFTPEVQASM
DKFLASVATVLASKYRELGYQG
0.15 0.00 0.03 0.03 0.03 -0.18 0.09 0.06 -0.06 0.00 0.03 -0.09 -0.06 0.00 0.00
0.45 0.09 0.09 0.12 0.09 0.00 0.03 -0.24 0.00 -0.24 0.00 0.87 0.87
0.00 0.00 0.06 -0.06 -0.06 0.18 -0.09 -0.09 0.45 0.00 -0.06 0.24 0.18 -0.09 0.0
0 -0.06 -0.09 -0.09 -0.03 0.06 0.00 0.33 -0.15 0.00 0.03 0.00 0.87 0.87
0.06 0.00 0.06 -0.06 -0.06 0.06 0.06 -0.09 0.33 0.00 -0.06 0.24 0.18 -0.09 0.00
 0.03 -0.06 -0.09 -0.03 0.06 0.00 0.45 -0.24 0.00 -0.03 0.00 0.87 0.87
0.09 0.00 -0.15 0.45 0.30 -0.30 0.18 0.12 -0.06 0.00 0.09 -0.15 -0.12 0.18 0.00
 0.03 0.18 0.00 0.06 0.06 0.00 -0.06 -0.33 0.00 -0.15 0.00 0.87 0.87
0.12 0.00 0.06 0.06 0.06 -0.09 0.12 -0.03 0.06 0.00 0.06 -0.03 0.00 0.06 0.00 0
.09 -0.03 -0.03 0.09 0.45 0.00 0.06 -0.18 0.00 -0.09 0.00 0.87 0.87
0.18 0.00 0.06 0.18 0.15 -0.18 0.45 -0.06 -0.09 0.00 -0.03 -0.15 -0.09 0.12 0.0
0 0.09 0.06 -0.09 0.18 0.12 0.00 0.06 -0.30 0.00 -0.18 0.00 0.87 0.87
0.12 0.00 0.18 0.06 0.06 -0.09 0.18 -0.06 -0.03 0.00 0.06 -0.12 -0.09 0.09 0.00
 0.12 -0.03 0.03 0.45 0.09 0.00 -0.03 0.09 0.00 -0.12 0.00 0.87 0.87
0.13 0.00 0.13 -0.13 -0.13 0.13 0.13 -0.19 0.69 0.00 -0.13 0.50 0.38 -0.19 0.00
 0.06 -0.13 -0.19 -0.06 0.13 0.00 0.94 -0.50 0.00 -0.06 0.00 0.87 0.87
0.59 0.00 -0.06 -0.07 -0.02 0.24 0.31 -0.25 0.68 0.00 -0.20 0.72 0.60 -0.14 0.0
0 0.14 -0.03 -0.39 0.03 0.23 0.00 0.97 -0.55 0.00 -0.12 0.00 0.87 0.87
0.52 0.00 0.12 0.35 0.35 -0.54 0.38 0.41 -0.22 0.00 0.20 -0.30 -0.22 0.31 0.00
0.76 0.53 0.27 0.61 0.20 0.00 -0.08 -0.38 0.00 -0.48 0.00 0.87 0.87
0.01 0.00 -0.88 -0.10 0.24 0.83 -0.26 -0.04 0.62 0.00 -0.16 1.19 0.96 -0.18 0.0
0 -0.22 0.11 -0.34 -0.28 -0.02 0.00 0.62 0.07 0.00 0.09 0.00 0.87 0.87
0.54 0.00 0.44 0.37 0.34 -0.45 0.94 -0.20 -0.08 0.00 0.14 -0.40 -0.25 0.35 0.00
 0.41 -0.02 -0.08 1.07 0.80 0.00 0.08 -0.38 0.00 -0.51 0.00 0.87 0.87
0.82 0.00 -0.13 0.71 0.92 -0.68 0.80 0.16 -0.20 0.00 0.14 -0.34 -0.20 0.38 0.00
 0.56 0.45 -0.09 0.42 0.36 0.00 0.03 -1.13 0.00 -0.61 0.00 0.87 0.87
0.37 0.00 -0.47 0.17 0.38 -0.05 0.14 0.07 -0.26 0.00 0.19 -0.05 -0.22 0.21 0.00
 -0.01 0.13 0.35 0.52 0.05 0.00 -0.30 -0.16 0.00 0.01 0.00 0.87 0.87
0.41 0.00 -0.61 0.90 1.26 -0.71 0.55 0.42 0.25 0.00 0.31 0.13 0.15 0.40 0.00 0.
26 1.04 0.04 0.05 0.19 0.00 0.49 -1.41 0.00 -0.69 0.00 4.55 4.55
0.13 0.00 -1.04 -0.15 0.01 0.48 -0.39 -0.11 0.51 0.00 0.83 0.99 1.12 -0.01 0.00
 -0.10 0.23 0.20 -0.13 0.12 0.00 0.54 0.36 0.00 -0.23 0.00 4.55 4.55
1.00 0.00 0.64 0.24 0.24 -0.41 0.81 -0.30 0.35 0.00 0.13 -0.08 -0.01 0.24 0.00
0.58 -0.09 -0.17 1.23 0.86 0.00 0.56 -0.52 0.00 -0.50 0.00 4.55 4.55
1.09 0.00 -0.33 0.08 0.18 -0.09 0.21 -0.09 0.27 0.00 0.33 0.48 0.58 0.07 0.00 0
.55 0.27 -0.09 0.23 0.35 0.00 0.48 -0.45 0.00 -0.42 0.00 4.55 4.55
0.81 0.00 0.28 0.11 0.11 0.02 0.25 0.19 0.96 0.00 -0.14 0.57 0.42 0.00 0.00 0.3
0 0.09 -0.24 0.04 0.33 0.00 1.16 -1.02 0.00 -0.07 0.00 4.55 4.55
0.18 0.00 -0.48 0.64 0.44 -0.46 0.23 0.20 0.36 0.00 0.51 0.16 0.35 0.23 0.00 0.
18 0.36 0.36 0.10 0.44 0.00 0.49 -0.41 0.00 -0.54 0.00 4.55 4.55
0.54 0.00 -0.30 0.00 0.00 -0.24 0.14 -0.11 -0.31 0.00 0.85 -0.20 -0.13 0.31 0.0
0 0.17 0.07 0.74 1.03 0.20 0.00 -0.32 0.34 0.00 -0.23 0.00 4.55 4.55
1.15 0.00 0.04 0.11 0.19 -0.01 0.45 -0.22 0.41 0.00 0.00 0.45 0.45 0.10 0.00 0.
39 0.02 -0.39 0.45 0.98 0.00 0.54 -0.54 0.00 -0.27 0.00 4.55 4.55
-0.59 0.00 -1.37 -0.55 -0.60 0.59 -0.70 0.19 -0.64 0.00 0.77 0.14 -0.34 0.60 0.
00 -0.65 -0.10 1.43 0.47 -0.35 0.00 -0.90 1.17 0.00 0.70 0.00 4.55 4.55
0.84 0.00 0.10 0.51 0.46 -0.41 0.84 -0.17 0.76 0.00 -0.08 0.37 0.31 0.10 0.00 0
.33 0.15 -0.39 0.23 0.43 0.00 1.25 -1.48 0.00 -0.47 0.00 4.55 4.55
0.29 0.00 -0.79 0.77 1.01 -1.00 0.24 0.34 -0.33 0.00 1.52 -0.50 0.03 0.60 0.00
0.59 0.73 0.81 0.39 0.36 0.00 -0.24 -0.67 0.00 -1.02 0.00 4.55 4.55
1.29 0.00 0.37 -0.04 0.02 -0.05 0.55 -0.31 0.87 0.00 -0.23 0.66 0.50 -0.12 0.00
 0.39 -0.09 -0.53 0.21 0.43 0.00 1.26 -1.05 0.00 -0.13 0.00 4.55 4.55
0.85 0.00 0.11 0.82 0.60 -0.46 0.53 0.45 -0.20 0.00 0.14 -0.35 -0.33 1.10 0.00
0.04 0.34 -0.27 0.31 0.28 0.00 -0.17 -0.59 0.00 0.08 0.00 4.55 4.55
0.33 0.00 0.22 0.10 0.10 -0.16 0.27 -0.07 -0.03 0.00 0.06 -0.13 -0.09 0.12 0.00
 0.19 0.00 -0.01 0.51 0.15 0.00 0.00 -0.02 0.00 -0.16 0.00 3.49 3.49
-0.07 0.00 -0.59 -0.28 -0.19 0.40 -0.10 -0.08 0.31 0.00 0.12 0.51 0.09 0.08 0.0
0 -0.22 -0.19 0.46 0.27 0.34 0.00 0.38 -0.15 0.00 0.27 0.00 4.55 4.55
0.76 0.00 0.40 0.62 0.60 -0.23 0.69 0.08 0.07 0.00 -0.05 -0.21 -0.21 0.39 0.00
0.11 0.11 -0.36 0.62 0.32 0.00 0.13 -0.59 0.00 -0.08 0.00 4.55 4.55
0.48 0.00 -0.64 1.07 1.40 -1.00 0.84 0.30 -0.37 0.00 0.92 -0.57 -0.17 0.68 0.00
 0.43 0.73 0.33 0.49 0.41 0.00 -0.16 -1.18 0.00 -0.96 0.00 4.55 4.55
0.27 0.00 0.12 0.05 0.05 -0.03 0.22 0.21 0.92 0.00 0.13 0.58 0.47 0.01 0.00 0.2
6 0.04 -0.02 -0.04 0.63 0.00 1.28 -0.92 0.00 -0.17 0.00 4.55 4.55
0.84 0.00 0.41 0.85 0.73 -0.84 1.99 -0.09 -0.44 0.00 -0.05 -0.76 -0.50 0.65 0.0
0 0.52 0.30 -0.27 1.16 0.57 0.00 0.17 -1.15 0.00 -0.81 0.00 4.55 4.55
1.04 0.00 0.09 0.88 0.78 -1.00 1.73 -0.04 -0.37 0.00 0.06 -0.56 -0.30 0.60 0.00
 0.54 0.72 -0.24 0.69 0.66 0.00 0.20 -1.41 0.00 -0.90 0.00 4.55 4.55
0.22 0.00 -0.42 1.10 1.14 -0.58 0.34 1.15 -0.01 0.00 0.23 -0.17 -0.22 0.63 0.00
 0.23 0.76 0.22 -0.01 0.15 0.00 0.11 -1.12 0.00 -0.21 0.00 4.55 4.55
1.40 0.00 0.14 0.65 0.50 -0.62 0.58 0.00 0.39 0.00 0.14 -0.03 0.11 0.28 0.00 0.
46 0.32 -0.15 0.40 0.47 0.00 0.44 -1.03 0.00 -0.47 0.00 4.55 4.55
0.15 0.00 -0.45 -0.28 -0.13 0.99 0.18 -0.35 0.98 0.00 -0.42 1.28 1.00 -0.26 0.0
0 -0.22 -0.18 -0.60 -0.08 0.14 0.00 1.05 -0.09 0.00 0.15 0.00 4.55 4.55


  [Part of this file has been deleted for brevity]

0.16 0.00 -0.11 0.88 0.64 -0.34 0.31 0.88 -0.34 0.00 0.27 -0.44 -0.47 1.57 0.00
 -0.20 0.43 -0.04 0.17 0.13 0.00 -0.41 -0.25 0.00 0.30 0.00 4.55 4.55
-0.40 0.00 -0.34 -1.18 -0.69 1.78 -0.70 -0.11 0.83 0.00 -0.69 1.65 0.86 -0.65 0
.00 -0.27 -0.78 -0.56 -0.32 -0.26 0.00 0.50 1.18 0.00 1.21 0.00 4.55 4.55
0.11 0.00 -0.78 0.67 0.83 -1.02 0.09 0.60 -0.41 0.00 1.29 -0.48 0.09 0.52 0.00
0.51 1.05 1.17 0.23 0.13 0.00 -0.33 -0.04 0.00 -1.00 0.00 4.55 4.55
-0.32 0.00 -0.42 -0.96 -0.65 1.99 -0.80 -0.17 1.10 0.00 -0.68 1.95 1.30 -0.60 0
.00 -0.69 -0.56 -0.75 -0.59 -0.25 0.00 0.97 1.06 0.00 1.13 0.00 4.55 4.55
-0.21 0.00 -0.66 -0.84 -0.54 1.76 -0.70 -0.35 1.55 0.00 -0.54 2.09 1.51 -0.65 0
.00 -0.50 -0.46 -0.65 -0.50 -0.09 0.00 1.36 0.53 0.00 0.68 0.00 4.55 4.55
0.57 0.00 0.31 0.54 0.50 -0.76 1.07 -0.20 -0.29 0.00 0.79 -0.67 -0.28 0.59 0.00
 0.49 0.18 0.31 1.56 0.50 0.00 -0.09 -0.13 0.00 -0.84 0.00 4.55 4.55
0.24 0.00 -0.40 0.85 1.05 -0.48 0.36 1.03 -0.03 0.00 0.30 -0.16 -0.18 1.01 0.00
 0.17 0.68 0.19 0.09 0.19 0.00 0.09 -0.93 0.00 -0.16 0.00 4.55 4.55
0.91 0.00 0.71 -0.33 -0.32 0.16 0.31 -0.28 0.79 0.00 -0.46 0.35 0.32 -0.30 0.00
 0.24 -0.31 -0.53 0.32 0.34 0.00 1.05 -1.14 0.00 0.39 0.00 4.55 4.55
0.36 0.00 -0.54 -0.45 -0.27 1.21 -0.41 -0.35 1.43 0.00 -0.36 1.70 1.36 -0.44 0.
00 -0.21 -0.17 -0.59 -0.29 0.12 0.00 1.30 -0.03 0.00 0.23 0.00 4.55 4.55
0.47 0.00 -0.26 -0.37 -0.25 0.88 -0.15 -0.38 1.45 0.00 -0.34 1.51 1.20 -0.41 0.
00 -0.06 -0.18 -0.56 -0.21 0.21 0.00 1.55 -0.42 0.00 0.09 0.00 4.55 4.55
0.28 0.00 0.49 -0.02 -0.04 -0.07 0.27 0.21 0.69 0.00 0.04 0.21 0.17 0.02 0.00 0
.28 -0.04 0.03 0.42 0.26 0.00 0.98 -0.76 0.00 0.03 0.00 4.55 4.55
0.40 0.00 0.33 -0.08 -0.08 0.14 0.31 -0.38 1.39 0.00 -0.08 0.77 0.63 -0.19 0.00
 0.20 -0.30 -0.38 0.08 1.15 0.00 1.57 -1.12 0.00 -0.23 0.00 4.55 4.55
0.33 0.00 -0.86 -0.55 -0.31 1.41 -0.48 -0.32 1.20 0.00 -0.40 1.93 1.56 -0.47 0.
00 -0.25 -0.11 -0.62 -0.39 0.03 0.00 1.20 0.30 0.00 0.29 0.00 4.55 4.55
1.41 0.00 0.00 0.89 0.74 -0.87 0.64 0.54 -0.19 0.00 0.34 -0.35 -0.19 0.58 0.00
0.56 0.61 0.01 0.38 0.42 0.00 -0.01 -1.07 0.00 -0.41 0.00 4.55 4.55
0.59 0.00 0.21 0.36 0.43 -0.45 0.47 0.27 0.17 0.00 0.31 -0.13 0.02 0.31 0.00 0.
47 0.22 0.28 0.65 0.68 0.00 0.32 -0.37 0.00 -0.45 0.00 4.55 4.55
-0.10 0.00 -0.10 0.27 0.27 -0.17 -0.19 1.38 0.12 0.00 0.26 0.04 0.06 0.35 0.00
0.32 0.58 0.81 -0.19 -0.03 0.00 0.30 -0.02 0.00 0.03 0.00 4.55 4.55
0.19 0.00 -0.34 -0.46 -0.20 1.05 -0.35 0.28 0.70 0.00 -0.39 1.24 0.78 -0.22 0.0
0 -0.16 -0.15 -0.37 -0.28 -0.06 0.00 0.65 0.35 0.00 0.68 0.00 4.55 4.55
1.19 0.00 0.28 0.51 0.45 -0.97 1.26 0.02 -0.33 0.00 0.03 -0.55 -0.33 0.28 0.00
1.54 0.42 -0.01 0.78 0.59 0.00 0.25 -1.45 0.00 -1.08 0.00 4.55 4.55
0.97 0.00 -0.10 0.77 0.68 -0.94 1.22 0.02 -0.35 0.00 0.67 -0.58 -0.19 0.90 0.00
 0.41 0.47 0.06 0.68 0.53 0.00 0.03 -0.95 0.00 -0.76 0.00 4.55 4.55
0.46 0.00 -0.89 2.13 1.78 -1.45 0.86 0.63 -0.33 0.00 0.67 -0.72 -0.50 0.93 0.00
 0.17 0.97 0.11 0.33 0.33 0.00 -0.33 -1.67 0.00 -0.85 0.00 4.55 4.55
-0.28 0.00 -0.20 -1.30 -0.80 1.86 -0.70 -0.17 0.67 0.00 -0.72 1.52 0.57 -0.60 0
.00 -0.70 -0.99 -0.52 -0.21 -0.33 0.00 0.19 1.45 0.00 1.66 0.00 4.55 4.55
0.79 0.00 0.39 0.59 0.52 -0.69 1.39 -0.24 -0.02 0.00 0.15 -0.46 -0.23 0.47 0.00
 0.52 0.02 -0.26 0.86 1.64 0.00 0.29 -1.13 0.00 -0.70 0.00 4.55 4.55
0.84 0.00 0.07 0.03 0.22 -0.34 0.36 0.17 -0.03 0.00 -0.05 0.01 -0.06 -0.01 0.00
 1.35 0.18 0.02 0.43 0.34 0.00 0.19 -0.78 0.00 -0.50 0.00 4.55 4.55
1.12 0.00 -0.39 1.32 1.48 -1.09 0.88 0.39 -0.24 0.00 0.32 -0.47 -0.30 0.62 0.00
 0.64 0.75 -0.09 0.47 0.45 0.00 -0.08 -1.63 0.00 -0.80 0.00 4.55 4.55
0.59 0.00 -0.23 -0.13 -0.06 0.22 0.13 -0.28 0.98 0.00 0.21 0.96 0.90 -0.16 0.00
 0.16 0.01 -0.21 -0.02 0.29 0.00 1.32 -0.60 0.00 -0.24 0.00 4.55 4.55
0.10 0.00 -0.78 0.58 0.62 -0.35 -0.04 1.19 -0.17 0.00 0.31 0.22 0.17 0.63 0.00
0.23 1.43 0.43 -0.25 -0.12 0.00 -0.10 -0.31 0.00 -0.22 0.00 4.55 4.55
1.60 0.00 0.24 0.38 0.40 -0.54 1.03 -0.27 0.07 0.00 0.06 0.05 0.31 0.26 0.00 0.
55 0.23 -0.29 0.68 0.53 0.00 0.41 -1.10 0.00 -0.55 0.00 4.55 4.55
1.41 0.00 0.80 0.40 0.40 -0.64 1.00 -0.27 -0.10 0.00 0.20 -0.47 -0.30 0.43 0.00
 0.74 0.03 -0.10 1.77 0.57 0.00 0.03 -0.24 0.00 -0.60 0.00 4.55 4.55
-0.29 0.00 -0.52 -0.86 -0.64 1.61 -0.82 -0.18 0.74 0.00 -0.25 1.68 1.44 -0.47 0
.00 -0.72 -0.37 -0.13 -0.51 -0.26 0.00 0.61 0.72 0.00 0.86 0.00 4.55 4.55
0.35 0.00 -0.50 1.14 0.87 -0.84 0.47 0.50 0.16 0.00 0.41 -0.19 -0.11 0.89 0.00
0.16 0.94 0.09 0.17 0.40 0.00 0.08 -1.08 0.00 -0.54 0.00 4.55 4.55
0.09 0.00 -0.26 0.19 0.16 -0.68 -0.11 0.05 0.03 0.00 1.63 -0.49 0.15 0.36 0.00
0.12 0.27 0.85 0.41 0.33 0.00 -0.03 -0.31 0.00 -0.42 0.00 4.55 4.55
0.55 0.00 0.24 -0.49 -0.29 0.76 -0.02 -0.31 1.20 0.00 -0.43 1.11 0.67 -0.36 0.0
0 -0.07 -0.47 -0.60 -0.03 0.19 0.00 1.14 -0.28 0.00 0.48 0.00 4.55 4.55
-0.07 0.00 -0.67 -0.71 -0.49 1.61 -0.56 -0.30 1.36 0.00 -0.50 2.05 1.57 -0.58 0
.00 -0.41 -0.28 -0.66 -0.54 -0.07 0.00 1.50 0.38 0.00 0.51 0.00 4.55 4.55
1.16 0.00 -0.16 0.64 0.79 -0.38 0.64 0.01 0.12 0.00 0.11 0.11 0.16 0.34 0.00 0.
38 0.35 -0.28 0.63 0.40 0.00 0.24 -0.79 0.00 -0.44 0.00 4.55 4.55
0.36 0.00 -0.06 0.32 0.42 -0.24 0.73 -0.04 -0.03 0.00 0.24 -0.07 0.16 0.28 0.00
 0.32 0.21 0.24 0.90 0.28 0.00 0.18 0.13 0.00 -0.60 0.00 4.55 4.55
0.12 0.00 0.21 -0.52 -0.36 0.75 0.09 -0.39 1.27 0.00 -0.36 1.21 0.79 -0.40 0.00
 -0.03 -0.49 -0.46 0.20 0.16 0.00 1.50 -0.16 0.00 0.26 0.00 4.55 4.55
1.38 0.00 0.45 0.35 0.35 -0.74 0.71 -0.02 -0.15 0.00 0.36 -0.41 -0.08 0.35 0.00
 0.72 0.25 0.28 1.10 0.46 0.00 0.02 -0.11 0.00 -0.65 0.00 4.55 4.55
0.19 0.00 0.10 0.27 0.22 -0.07 0.10 0.24 0.15 0.00 0.55 -0.11 0.00 0.78 0.00 -0
.09 0.03 0.03 0.20 0.82 0.00 0.03 -0.12 0.00 0.08 0.00 4.55 4.55
0.85 0.00 0.09 0.49 0.33 -0.41 0.57 -0.10 0.63 0.00 -0.03 0.30 0.25 0.09 0.00 0
.30 0.15 -0.31 0.17 0.36 0.00 0.96 -1.20 0.00 -0.35 0.00 0.92 0.92
-0.09 0.00 -0.63 -0.54 -0.36 1.36 -0.59 -0.32 1.43 0.00 -0.36 1.73 1.36 -0.50 0
.00 -0.36 -0.23 -0.50 -0.41 0.00 0.00 1.24 0.21 0.00 0.32 0.00 0.92 0.92
1.31 0.00 0.23 0.36 0.36 -0.60 0.63 -0.11 0.07 0.00 0.31 -0.17 0.03 0.30 0.00 0
.53 0.16 -0.16 0.47 1.05 0.00 0.22 -0.87 0.00 -0.45 0.00 0.92 0.92
0.65 0.00 0.26 0.40 0.40 -0.44 0.39 0.51 -0.20 0.00 0.35 -0.35 -0.24 0.48 0.00
0.46 0.32 0.27 0.81 0.26 0.00 -0.14 -0.14 0.00 -0.25 0.00 0.92 0.92
0.04 0.00 -0.82 0.51 0.58 -0.82 -0.05 0.18 -0.27 0.00 1.89 -0.41 0.22 0.56 0.00
 0.14 0.58 0.98 0.27 0.27 0.00 -0.27 -0.03 0.00 -0.81 0.00 0.92 0.92
-0.37 0.00 1.14 -0.67 -0.64 1.67 -0.78 0.33 0.21 0.00 -0.71 0.54 0.09 -0.17 0.0
0 -1.01 -0.74 -0.71 -0.53 -0.37 0.00 -0.04 1.31 0.00 1.83 0.00 0.92 0.92
-0.16 0.00 -0.43 0.35 0.34 -0.55 -0.20 0.97 -0.38 0.00 0.98 -0.43 0.00 0.60 0.0
0 0.26 0.63 1.21 0.07 0.00 0.00 -0.38 0.58 0.00 -0.38 0.00 0.92 0.92
0.14 0.00 -0.27 0.54 0.64 -0.34 0.25 0.19 -0.09 0.00 0.14 -0.17 -0.12 0.25 0.00
 0.05 0.28 0.00 0.09 0.09 0.00 -0.09 -0.52 0.00 -0.24 0.00 0.92 0.92
0.18 0.00 -0.22 -0.12 -0.06 0.32 -0.08 -0.08 0.26 0.00 -0.10 0.48 0.39 -0.10 0.
00 -0.03 0.00 -0.17 -0.07 0.02 0.00 0.29 0.05 0.00 0.06 0.00 0.92 0.92
0.41 0.00 0.11 0.24 0.21 -0.27 0.58 -0.08 -0.10 0.00 -0.03 -0.18 -0.10 0.16 0.0
0 0.17 0.09 -0.14 0.25 0.19 0.00 0.09 -0.44 0.00 -0.24 0.00 0.92 0.92
-0.10 0.00 0.33 -0.16 -0.16 0.43 -0.20 0.10 0.03 0.00 -0.20 0.10 -0.03 -0.03 0.
00 -0.26 -0.20 -0.20 -0.13 -0.10 0.00 -0.03 0.36 0.00 0.49 0.00 0.92 0.92
0.07 0.00 -0.20 0.20 0.20 -0.26 0.07 0.20 -0.10 0.00 0.13 -0.03 0.00 0.13 0.00
0.10 0.49 0.13 -0.03 -0.03 0.00 -0.07 -0.16 0.00 -0.20 0.00 0.92 0.92
0.20 0.00 0.07 0.20 0.16 -0.20 0.49 -0.07 -0.10 0.00 -0.03 -0.16 -0.10 0.13 0.0
0 0.10 0.07 -0.10 0.20 0.13 0.00 0.07 -0.33 0.00 -0.20 0.00 0.92 0.92
   
Output file format

  Output files for usage example
  
  File: hd_fugru.prophet
  
Local: Consensus vs HD_FUGRU
Score: 74.34

Consensus       3        VDTGSV.VSLS.EEELSAVDKAWVKANSVAEVGGHALERGLFASE 45
                         :: ::|  :|| :|  : : ::   :: :: ::::: : :|: :|
HD_FUGRU        2289     LQQPCVWNKLSTPEYNTHTCSLIYCLHHIILAVAVSPGDQLLHPE 2333

Consensus       46       PMTLEFFDTFKYLSTFDLSKGSADVKAHGKKVLDALGDAVAHLDD 90
                         ::  : ::: :: :::| :::::::: :: :::::|::::::: :
HD_FUGRU        2334     RKKTKALRHSDDEDQVDSVHDNHTLEWQACEIMAELVEGLQSVLS 2378

Consensus       91       LEGT.LAALSDLHAHKLKKGVDPVNFKLLSHCLLVVLASHLPGDF 134
                         |:    :|:::: :::|:: : :::   | :: ::| : ::: ::
HD_FUGRU        2379     LGHHRNTAFPAFLTPTLRNIIISLSRLPLVNSHTRVPPLVWKLGW 2423

Consensus       135      TPEVQASMDKFLASVATV.LASK..YRELGYQ              163
                         :|:: ::::::|:::::: |::|  :||: |:
HD_FUGRU        2424     SPQPGGEFGTTLPEIPVDFLQEKDVFREFLYR              2455
Local: Consensus vs HIRA_FUGRU
Score: 66.14

Consensus       1        PIVDTGSVVSLSEE.ELSAVDKAWVKANSVAEVGGHALERGLFAS 44
                         ::::::| ::|::: : ::::::  :::|:::::::: :::: :
HIRA_FUGRU      574      ATAAIASSTGLTPSERPKESTPMQKDVKSKEDTSSDSEDKMATIN 618

Consensus       45       EPMTLEFFDTFKYLSTFDLSKGSADVKAHGKKVLDALGDAVAHLD 89
                          :::::  ::   ::::::::::::::::::|:::::::::::::
HIRA_FUGRU      619      KNLAFNKRKPELLMDGAEVVEKRKKGRPRKDKMAASIAQPLTQTT 663

Consensus       90       DLEGTLAALSDLHAHKLKKGVDPVNFKLLSHCLLVVLASHLPGDF 134
                         : ::  :: :: ::: :  :::::::|| :::: :::: ::: |
HIRA_FUGRU      664      SPAEREPSRAAAAGAGAAAPTAAAALKLPTPSIKKAFTLQVSMDP 708

Consensus       135      TPEVQASMDKFLASVATVLASKY.RE                    159
                         :: :::: :  ::::::: : :: |:
HIRA_FUGRU      709      SVVLEVENEVSVVAGSRLSQLRCSRD                    734
Local: Consensus vs HBA_HUMAN
Score: 170.08

Consensus       15       ELSAVDKAWVKAN.SVAEVGGHALERGLFASEPMTLEFFDTFKYL 58
                         :||::||::|||: : ::||:||:|:|::|:|:|:|:|::|::|:
HBA_HUMAN       1        VLSPADKTNVKAAWG.GKVGAHAGEYGAEALERMFLSFPTTKTYF 44

Consensus       59       STFDLSKGSADVKAHGKKVLDALGDAVAHLDDLEGTLAALSDLHA 103
                         ::||||:|||:||:|||||:|||::||||:||::::|:|||||||
HBA_HUMAN       45       PHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHA 89

Consensus       104      HKLK.KGVDPVNFKLLSHCLLVVLASHLPGDFTPEVQASMDKFLA 147
                         |||: :  ||||||||||||||:||:|||::|||:|:||:|||||
HBA_HUMAN       90       HKLRVD..DPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLA 132

Consensus       148      SVATVLASKYR                                   158
                         ||:|||:||||
HBA_HUMAN       133      SVSTVLTSKYR                                   143
Local: Consensus vs HBB_HUMAN
Score: 178.29

Consensus       9        VSLSEEELSAVDKAWVKAN.SVAEVGGHALE.RGLFASEPMTLEF 51
                         |:|::||:|||:::|:|:| : :||||:||: : |::::| |::|
HBB_HUMAN       1        VHLTPEEKSAVTALWGKVNVD.DEVGGEALGRL.LLVVYPWTQRF 43

Consensus       52       FDTFKYLSTFDLSKGSADVKAHGKKVLDALGDAVAHLDDLEGTLA 96
                         |::|::|||:|:::|:::|||||||||:|::|::||||:|:||:|
HBB_HUMAN       44       FESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFA 88

Consensus       97       ALSDLHAHKLK.KGVDPVNFKLLSHCLLVVLASHLPGDFTPEVQA 140
                         :||:||::||: :  ||:||:||:::|::|||:|::::|||:|||
HBB_HUMAN       89       TLSELHCDKLHVD..DPENFRLLGNVLVCVLAHHFGKEFTPPVQA 131

Consensus       141      SMDKFLASVATVLASKYR                            158
                         :::|::|:||::||:||:
HBB_HUMAN       132      AYQKVVAGVANALAHKYH                            149
   
Data files

   None.
   
Notes

   None.
   
References

   None.
   
Warnings

   prophet does NOT use the 'simple frequency matrices' produced by
   prophecy. If you have a 'simple frequency matrix'you should use the
   program profit to scan sequences.
   
Diagnostic Error Messages

   If you see something like:
   
   EMBOSS An error in prophet.c at line 110:
Unrecognised profile/matrix file format

   then you have probably given prophet a 'simple frequency matrix' and
   not a a GRIBSKOV or HENIKOFF profile produced by prophecy.
   
   If you see something like:
   
Uncaught exception
Allocation Failed
raised at prophet.c:147

   then you have run out of memory. This will occur if your sequence
   and/or your profile are large.
   
   prophet allocates space based on the length of the sequence and the
   size of the profile (8 x seqlen x profilelen)
   
Exit status

   It exists with a status of 0.
   
Known bugs

   None.
   
See also

   Program name                     Description
   profit       Scan a sequence or database with a matrix or profile
   prophecy     Creates matrices/profiles from multiple alignments
   
Author(s)

   Alan Bleasby (ableasby  rfcgr.mrc.ac.uk)
   MRC Rosalind Franklin Centre for Genomics Research Wellcome Trust
   Genome Campus, Hinxton, Cambridge, CB10 1SB, UK
   
History

   Written (1999) - author - Alan Bleasby
   
Target users

   This program is intended to be used by everyone and everything, from
   naive users to embedded scripts.
   
Comments
