
    
                                     
                    Biopython Tutorial and Cookbook
                    *******************************
       Jeff Chang, Brad Chapman, Iddo Friedberg, Thomas Hamelryck
       ==========================================================
                       Last Update--16 Feb 2005 
                       =========================
  

Table of Contents
*****************
   
  
 - Chapter 1  Introduction 
     
    - 1.1  What is Biopython? 
        
       - 1.1.1  What can I find in the Biopython package 
     
    - 1.2  Installing Biopython 
    - 1.3  FAQ 
  
 - Chapter 2  Quick Start -- What can you do with Biopython? 
     
    - 2.1  General overview of what Biopython provides 
    - 2.2  Working with sequences 
    - 2.3  A usage example 
    - 2.4  Parsing biological file formats 
        
       - 2.4.1  General parser design 
       - 2.4.2  Writing your own consumer 
       - 2.4.3  Making it easier 
       - 2.4.4  FASTA files as Dictionaries 
       - 2.4.5  I love parsing -- please don't stop talking about it! 
     
    - 2.5  Connecting with biological databases 
    - 2.6  What to do next 
  
 - Chapter 3  Cookbook -- Cool things to do with it 
     
    - 3.1  BLAST 
        
       - 3.1.1  Running BLAST over the Internet 
       - 3.1.2  Parsing the output from the WWW version of BLAST 
       - 3.1.3  The BLAST record class 
       - 3.1.4  Running BLAST locally 
       - 3.1.5  Parsing BLAST output from local BLAST 
       - 3.1.6  Parsing a file full of BLAST runs 
       - 3.1.7  Finding a bad record somewhere in a huge file 
       - 3.1.8  Dealing with PSIBlast 
     
    - 3.2  SWISS-PROT 
        
       - 3.2.1  Retrieving a SWISS-PROT record 
     
    - 3.3  PubMed 
        
       - 3.3.1  Sending a query to PubMed 
       - 3.3.2  Retrieving a PubMed record 
     
    - 3.4  GenBank 
        
       - 3.4.1  Retrieving GenBank entries from NCBI 
       - 3.4.2  Parsing GenBank records 
       - 3.4.3  Making your very own GenBank database 
     
    - 3.5  Dealing with alignments 
        
       - 3.5.1  Clustalw 
       - 3.5.2  Calculating summary information 
       - 3.5.3  Calculating a quick consensus sequence 
       - 3.5.4  Position Specific Score Matrices 
       - 3.5.5  Information Content 
       - 3.5.6  Translating between Alignment formats 
     
    - 3.6  Substitution Matrices 
        
       - 3.6.1  Using common substitution matrices 
       - 3.6.2  Creating your own substitution matrix from an alignment 
     
    - 3.7  More Advanced Sequence Classes -- Sequence IDs and Features 
        
       - 3.7.1  Sequence ids and Descriptions -- dealing with SeqRecords
         
       - 3.7.2  Features and Annotations -- SeqFeatures 
     
    - 3.8  BioRegistry -- automatically finding sequence sources 
        
       - 3.8.1  Finding resources using a configuration file 
       - 3.8.2  Finding resources through a biopython specific interface
         
     
    - 3.9  BioSQL -- storing sequences in a relational database 
    - 3.10  BioCorba 
    - 3.11  Going 3D: The PDB module 
        
       - 3.11.1  Structure representation 
       - 3.11.2  Disorder 
       - 3.11.3  Hetero residues 
       - 3.11.4  Some random usage examples 
       - 3.11.5  Common problems in PDB files 
       - 3.11.6  Other features 
     
    - 3.12  Miscellaneous 
        
       - 3.12.1  Translating a DNA sequence to Protein 
     
  
 - Chapter 4  Advanced 
     
    - 4.1  Sequence Class 
    - 4.2  Regression Testing Framework 
        
       - 4.2.1  Writing a Regression Test 
     
    - 4.3  Parser Design 
        
       - 4.3.1  Design Overview 
       - 4.3.2  Events 
       - 4.3.3  'noevent' EVENT 
       - 4.3.4  Scanners 
       - 4.3.5  Consumers 
       - 4.3.6  BLAST 
       - 4.3.7  Enzyme 
       - 4.3.8  Fasta 
       - 4.3.9  Medline 
       - 4.3.10  Prosite 
       - 4.3.11  SWISS-PROT 
     
    - 4.4  Substitution Matrices 
        
       - 4.4.1  SubsMat 
       - 4.4.2  FreqTable 
     
  
 - Chapter 5  Where to go from here -- contributing to Biopython 
     
    - 5.1  Maintaining a distribution for a platform 
    - 5.2  Bug Reports + Feature Requests 
    - 5.3  Contributing Code 
  
 - Chapter 6  Appendix: Useful stuff about Python 
     
    - 6.1  What the heck in a handle? 
        
       - 6.1.1  Creating a handle from a string 
     
  
   
  

Chapter 1    Introduction
*************************
  
  

1.1  What is Biopython?
*=*=*=*=*=*=*=*=*=*=*=*

  
  The Biopython Project is an international association of developers of
freely available Python (http://www.python.org) tools for computational
molecular biology. The web site http://www.biopython.org provides an
online resource for modules, scripts, and web links for developers of
Python-based software for life science research.
  Basically, we just like to program in python and want to make it as
easy as possible to use python for bioinformatics by creating
high-quality, reusable modules and scripts.
  

1.1.1  What can I find in the Biopython package
===============================================
  
  The main Biopython releases have lots of functionality, including:
  
   
 - The ability to parse bioinformatics files into python utilizable data
   structures, including support for the following formats:
 
      
    - Blast output -- both from standalone and WWW Blast  
    - Clustalw  
    - FASTA  
    - GenBank  
    - PubMed and Medline  
    - Expasy files, like Enzyme, Prodoc and Prosite  
    - SCOP, including 'dom' and 'lin' files  
    - Rebase  
    - UniGene  
    - SwissProt  
 
 
 - Files in the supported formats can be iterated over record by record
   or indexed and accessed via a Dictionary interface.
 
 - Code to deal with popular on-line bioinformatics destinations such
   as:
 
      
    - NCBI -- Blast, Entrez and PubMed services  
    - Expasy -- Prodoc and Prosite entries  
 
 
 - Interfaces to common bioinformatics programs such as:
 
      
    - Standalone Blast from NCBI  
    - Clustalw alignment program.  
 
 
 - A standard sequence class that deals with sequences, ids on
   sequences, and sequence features.
 
 - Tools for performing common operations on sequences, such as
   translation, transcription and weight calculations.
 
 - Code to perform classification of data using k Nearest Neighbors,
   Naive Bayes or Support Vector Machines.
 
 - Code for dealing with alignments, including a standard way to create
   and deal with substitution matrices.
 
 - Code making it easy to split up parallelizable tasks into separate
   processes.
 
 - GUI-based programs to do basic sequence manipulations, translations,
   BLASTing, etc.
 
 - Extensive documentation and help with using the modules, including
   this file, on-line wiki documentation, the web site, and the mailing
   list.
 
 - Integration with other languages, including the Bioperl and Biojava
   projects, using the BioCorba interface standard (available with the
   biopython-corba module).
  
  We hope this gives you plenty of reasons to download and start using
Biopython!
  

1.2  Installing Biopython
*=*=*=*=*=*=*=*=*=*=*=*=*

  
  All of the installation information for Biopython was separated from
this document to make it easier to keep updated. The instructions cover
installation of python, Biopython dependencies and Biopython itself. It
is available in pdf
(http://www.biopython.org/docs/install/Installation.pdf) and html
formats (http://www.biopython.org/docs/install/Installation.html).
  

1.3  FAQ
*=*=*=*=

  
  
   
 1. I looked in a directory for code, but I couldn't seem to find the
   code that does something. Where's it hidden?
 One thing to know is that we put code in `__init__.py' files. If you
   are not used to looking for code in this file this can be confusing.
   The reason we do this is to make the imports easier for users. For
   instance, instead of having to do a ``repetitive'' import like `from
   Bio.GenBank import GenBank', you can just import like `from Bio
   import GenBank'.
 
 2. What happened to the `br_regrtest.py' regression tests?  We updated
   the regression testing framework to use PyUnit, and also to fix
   newline problems. `br_regrtest.py' is still there, but almost all of
   its functionality has been moved (well, copy and pasted) to
   `run_tests.py'.
 
 3. Why do some of the tests fail when running the regression tests with
   output like:
 `Writing: '\012', expected: '\015''
 This shouldn't happen any more! We updated the regression testing suite
   so that it uses PyUnit and we hopefully have fixed newline problems.
   Please let us know if any tests fail. 
  
  

Chapter 2    Quick Start -- What can you do with Biopython?
***********************************************************
  
  This section is designed to get you started quickly with Biopython,
and to give a general overview of what is available and how to use it.
All of the examples in this section assume that you have some general
working knowledge of python, and that you have successfully installed
Biopython on your system. If you think you need to brush up on your
python, the main python web site provides quite a bit of free
documentation to get started with (http://www.python.org/doc/). 
  Since much biological work on the computer involves connecting with
databases on the internet, some of the examples will also require a
working internet connection in order to run. 
  Now that that is all out of the way, let's get into what we can do
with Biopython.
  

2.1  General overview of what Biopython provides
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  As mentioned in the introduction, Biopython is a set of libraries to
provide the ability to deal with ''things'' of interest to biologists
working on the computer. In general this means that you will need to
have at least some programming experience (in python, of course!) or at
least an interest in learning to program. Biopython's job is to make
your job easier as a programmer by supplying reusable libraries so that
you can focus on answering your specific question of interest, instead
of focusing on the internals of parsing a particular file format (of
course, if you want to help by writing a parser that doesn't exist and
contributing it to Biopython, please go ahead!). So Biopython's job is
to make you happy!
  One thing to note about Biopython is that it often provides multiple
ways of ``doing the same thing.'' To me, this can be frustrating since I
often way to just know the one right way to do something. However, this
is also a real benefit because it gives you lots of flexibility and
control over the libraries. The tutorial helps to show you the common or
easy ways to do things so that you can just make things work. To learn
more about the alternative possibilities, look into the Cookbook section
(which tells you some cools tricks and tips) and the Advanced section
(which provides you with as much detail as you'd ever want to know!). 
  

2.2  Working with sequences
*=*=*=*=*=*=*=*=*=*=*=*=*=*

   
  Disputedly (of course!), the central object in bioinformatics is the
sequence. Thus, we'll start with the Biopython mechanisms for dealing
with sequences. When I think of a sequence the first thing that pops
into my mind is a string of letters:` 'AGTACACTGGT'' which seems natural
since this is the most common way that sequences are seen in biological
file formats. However, a simple string of letters by itself is also very
uninformative -- is it a DNA or protein sequence (okay, a protein with a
lot of Alanines, Glycines, Cysteines and Threonines!), what type of
organism did it come from, what is so interesting about it, and so on.
The challenge in designing a sequence interface is to pick a
representation that is informative enough to take into account the more
complex information, yet is as lightweight and easy to work with as just
a simple sequence.
  The approach taken in the Biopython sequence class is to utilize a
class that holds more complex information, yet can be manipulated as if
it were a simple string. This is accomplished by utilizing operator
overloading to make manipulating a sequence object feel like
manipulating a python string. The sequence class, referred to simply as
Seq, is defined in the file `Bio/Seq.py.' Let's look at the Seq class
deeper to see what it has to offer.
  A biopython Seq object has two important attributes:
  
 
 1. `data' -- as the name implies, this is the actual sequence data
   string of the sequence.
 
 2. `alphabet' -- an object describing what the individual characters
   making up the string ``mean'' and how they should be interpreted.
  
  Clearly the alphabet object is the important thing that is making the
Seq object more than just a string. The currently available alphabets
for Biopython are defined in the `Bio/Alphabet' module. We'll use the
IUPAC alphabets (http://www.chem.qmw.ac.uk/iupac/) here to deal with
some of our favorite objects: DNA, RNA and Proteins. 
  `Bio/Alphabet/IUPAC.py' provides basic definitions for proteins, DNA
and RNA, but additionally provides the ability to extend and customize
the basic definitions. For instance, for proteins, there is a basic
IUPACProtein class, but there is an additional ExtendedIUPACProtein
class providing for the additional elements ``Asx'' (asparagine or
aspartic acid), ``Sec'' (selenocysteine), and ``Glx'' (glutamine or
glutamic acid). For DNA you've got choices of IUPACUnambiguousDNA, which
provides for just the basic letters, IUPACAmbiguousDNA (which provides
for ambiguity letters for every possible situation) and
ExtendedIUPACDNA, which allows letters for modified bases. Similarly,
RNA can be represented by IUPACAmbigousRNA or IUPACUnambigousRNA.
  The advantages of having an alphabet class are two fold. First, this
gives an idea of the type of information the `data' object contains.
Secondly, this provides a means of constraining the information you have
in the data object, as a means of type checking.
  Now that we know what we are dealing with, let's look at how to
utilize this class to do interesting work.
  First, create a Sequence object from a string of information we've
got. We'll create an unambiguous DNA object:
<<
  >>> from Bio.Alphabet import IUPAC
  >>> my_alpha = IUPAC.unambiguous_dna
  >>> from Bio.Seq import Seq
  >>> my_seq = Seq('GATCGATGGGCCTATATAGGATCGAAAATCGC', my_alpha)
  >>> print my_seq
  Seq('GATCGATGGGCCTATATAGGATCGAAAATCGC', IUPACUnambiguousDNA())
>>
  
  Even though this is a sequence object, we can deal with it in some
ways as if it were a normal python string. For instance, let's get a
slice of the sequence.
<<
  >>> my_seq[4:12]
  Seq('GATGGGCC', IUPACUnambiguousDNA())
>>
  
  Two things are interesting to note. First, this follows the normal
conventions for python sequences. So the first element of the sequence
is 0 (which is normal for computer science, but not so normal for
biology). When you do a slice the first item is included (i. e. 4 in
this case) and the last is excluded (12 in this case), which is the way
things work in python, but of course not necessarily the way everyone in
the world would expect. The main goal is to stay consistent with what
python does. The second thing to notice is that the slice is performed
on the sequence data string, but the new object produced retains the
alphabet information from the original Seq object.
  You can treat the Seq object like the string in many ways:
<<
  >>> len(my_seq)
  32
  >>> new_seq = my_seq[0:5]
  >>> print new_seq
  Seq('GATCG', IUPACUnambiguousDNA())
  >>> my_seq + new_seq
  Seq('GATCGATGGGCCTATATAGGATCGAAAATCGCGATCG', IUPACUnambiguousDNA())
  >>> my_seq[5]
  'A'
  >>> my_seq == new_seq
  0
>>
  
  In all of the operations, the alphabet property is maintained. This is
very useful in case you accidentally end up trying to do something weird
like add a protein sequence and a DNA sequence:
<<
  >>> protein_seq = Seq('EVRNAK', IUPAC.protein)
  >>> dna_seq = Seq('ACGT', IUPAC.unambiguous_dna)
  >>> protein_seq + dna_seq
  Traceback (most recent call last):
    File "<stdin>", line 1, in ?
    File "/usr/local/lib/python1.6/site-packages/Bio/Seq.py", line 42,
in __add__
      raise TypeError, ("incompatable alphabets", str(self.alphabet),
  TypeError: ('incompatable alphabets', 'IUPACProtein()',
'IUPACUnambiguousDNA()')
>>
  
  And if you are really just need the string to insert into something,
this is very easy to extract:
<<
  >>> my_seq.tostring()
  'GATCGATGGGCCTATATAGGATCGAAAATCGC'
>>
  
  The sequence object is not mutable by default, since in many
biological applications you want to ensure you are not changing your
data:
<<
  >>> my_seq[5] = 'G'
  Traceback (most recent call last):
    File "<stdin>", line 1, in ?
  AttributeError: 'Seq' instance has no attribute '__setitem__'
>>
  
  However, you can convert it into a mutable sequence and do pretty much
anything you want with it:
<<
  >>> mutable_seq = my_seq.tomutable()
  >>> print mutable_seq
  MutableSeq('GATCGATGGGCCTATATAGGATCGAAAATCGC', IUPACUnambiguousDNA())
  >>> mutable_seq[5] = 'T'
  >>> print mutable_seq
  MutableSeq('GATCGTTGGGCCTATATAGGATCGAAAATCGC', IUPACUnambiguousDNA())
  >>> mutable_seq.remove('T')
  >>> print mutable_seq
  MutableSeq('GACGTTGGGCCTATATAGGATCGAAAATCGC', IUPACUnambiguousDNA())
  >>> mutable_seq.reverse()
  >>> print mutable_seq
  MutableSeq('CGCTAAAAGCTAGGATATATCCGGGTTGCAG', IUPACUnambiguousDNA())
>>
  
  Now that the nature of the sequence object makes some sense, the next
thing to look at is what kind of things we can do with a sequence. The
`Bio' directory contains two useful modules to transcribe and translate
a sequence object. These tools work based on the alphabet of the
sequence. For instance, let's supposed we want to transcribe our
`my_seq' object. Remember that this contains an unambiguous alphabet, so
to transcribe we would do the following:
<<
  >>> from Bio import Transcribe
  >>> transcriber = Transcribe.unambiguous_transcriber
  >>> my_rna_seq = transcriber.transcribe(my_seq)
  >>> print my_rna_seq
  Seq('GAUCGAUGGGCCUAUAUAGGAUCGAAAAUCGC', IUPACUnambiguousRNA())
>>
  
  The alphabet of the new RNA Seq object is created for free, so again,
dealing with a Seq object is no more difficult then dealing with a
simple string.
  You can also reverse transcribe RNA sequences:
<<
  >>> transcriber.back_transcribe(my_rna_seq)
  Seq('GATCGATGGGCCTATATAGGATCGAAAATCGC', IUPACUnambiguousDNA())
>>
  
  To translate our DNA object we have quite a few choices. First, we can
use any number of translation tables depending on what we know about our
DNA sequence. The translation tables available in biopython were taken
from information at ftp://ncbi.nlm.nih.gov/entrez/misc/data/gc.prt. So,
you have tons of choices to pick from. For this, let's just focus on two
choices: the Standard translation table, and the Translation table for
Vertebrate Mitochondrial DNA. These tables are labeled with id numbers 1
and 2, respectively. Now that we know what tables we are looking to get,
we're all set to perform a basic translation. First, we need to get our
translators that use these tables. Since we are still dealing with our
unambiguous DNA object, we want to fetch translators that take this into
account:
<<
  >>> from Bio import Translate
  >>> standard_translator = Translate.unambiguous_dna_by_id[1] 
  >>> mito_translator = Translate.unambiguous_dna_by_id[2]
>>
  
  Once we've got the proper translators, it's time to go ahead and
translate a sequence:
<<
  >>> my_seq = Seq('GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA',
IUPAC.unambiguous_dna)
  >>> standard_translator.translate(my_seq)
  Seq('AIVMGR*KGAR', IUPACProtein())
  >>> mito_translator.translate(my_seq)
  Seq('AIVMGRWKGAR', IUPACProtein())
>>
  
  Notice that the default translation will just go ahead and proceed
blindly through a stop codon. If you are aware that you are translating
some kind of open reading frame and want to just see everything up until
the stop codon, this can be easily done with the `translate_to_stop'
function:
<<
  >>> standard_translator.translate_to_stop(my_seq)
  Seq('AIVMGR', IUPACProtein())
>>
  
  Similar to the transcriber, it is also possible to reverse translate a
protein into a DNA sequence:
<<
  >>> my_protein = Seq('AVMGRWKGGRAAG', IUPAC.protein)
  >>> standard_translator.back_translate(my_protein)
  Seq('GCTGTTATGGGTCGTTGGAAGGGTGGTCGTGCTGCTGGT', IUPACUnambiguousDNA())
>>
  
  This covers the basic features and uses of the Biopython sequence
class. There is a more detailed description of the design ideas behind
the sequence class in the Advanced section of this tutorial. This class
is still under development and comments on the design and use are, of
course, very welcome. Now that you've got some idea of what it is like
to interact with the Biopython libraries, it's time to delve into the
fun, fun world of dealing with biological file formats!
  

2.3  A usage example
*=*=*=*=*=*=*=*=*=*=

   
  Before we jump right into parsers and everything else to do with
Biopython, let's set up an example to motivate everything we do and make
life more interesting. After all, if there wasn't any biology in this
tutorial, why would you want you read it?
  Since I love plants, I think we're just going to have to have a plant
based example (sorry to all the fans of other organisms out there!).
Having just completed a recent trip to our local greenhouse, we've
suddenly developed an incredible obsession with Lady Slipper Orchids (if
you wonder why take a look at
http://www.millicentorchids.com/greenhouse/images/papesq01.jpg. If that
doesn't convince you, you can look at all of the available photos at
http://www.millicentorchids.com/greenhouse/indexphoto.htm). Of course,
orchids are not only beautiful to look at, they are also extremely
interesting for people studying evolution and systematics. So we're
thinking about writing a little proposal to do a molecular study of Lady
Slipper evolution and would like to see what kind of research has
already been done and how we can add to that.
  After a little bit of reading up we discover that the Lady Slipper
Orchids are in the Orchidaceae family and the Cypripedioideae sub-family
and are made up of 5 genera: Cypripedium, Paphiopedilum, Phragmipedium,
Selenipedium and Mexipedium. That gives us enough information to get
started delving for more information. So, let's look at how biopython
tools can help us.
  

2.4  Parsing biological file formats
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  A large part of much bioinformatics work involves dealing with the
many types of file formats designed to hold biological data. These files
are loaded with interesting biological data, and a special challenge is
parsing these files into a format so that you can manipulate them with
some kind of programming language. However the task of parsing these
files can be frustrated by the fact that the formats can change quite
regularly, and that formats may contain small subtleties which can break
even the most well designed parsers. 
  

2.4.1  General parser design
============================
  
  The biopython solution to these problem is to develop a structured
parser framework that is applicable to all of the parsers. The
advantages are two fold. First, this allows code reuse between parsers
(see `Bio/ParserSupport.py'). Second, this provides a similar framework
for all the parsers so that it is relatively easy to jump into the
internals of a parser and figure out problems you might be having. 
  All of the parsers have two components:
  
 
 1. Scanner - The part of the parser that actually does the work or
   going through the file and extracting useful information. This useful
   information is converted into Events.
 
 2. Consumer - The consumer does the job of processing the useful
   information and spitting it out in a format that the programmer can
   use. The consumer does this by receiving the events created by the
   scanner.
  
  So, the parser design is event oriented. The general idea is that a
scanner will go through and produce events for every item that might be
of interest in a file. For instance, let's say we've got the following
FASTA formatted entry (edited to fit the page):
<<
  >gi|6273290|gb|AF191664.1|AF191664 Opuntia clavata rpl16 gene;
chloroplast gene for...
  TATACATTAAAGGAGGGGGATGCGGATAAATGGAAAGGCGAAAGAAAGAAAAAAATGAA
  TCTAAATGATATAGGATTCCACTATGTAAGGTCTTTGAATCATATCATAAAAGACAATGTAAT
  AAA...
>>
  
  As a scanner moved through a file containing this entry, it would
create the following events:
  
   Event Name                          Entry input                      
  
------------------------------------------------------------------------
---
 begin_sequence         (as soon as we notice we've got a new `>')      
  
     title       `>gi|6273290|gb|AF191664.1|AF191664 Opuntia clavata...'
  
    sequence                 `TATACATTAAAGGAGGGGGATGCGGAT...'           
  
    sequence                `TCTAAATGATATAGGATTCCACTATGTAA...'          
  
    sequence           `AAA...' (and so on -- you've got the idea!)     
  
  end_sequence  (as soon as we reach a blank line after the sequence
data) 

  
  So, events are being produced. Big deal, unless we are able to capture
these events and do something interesting with them! This is where the
consumer comes in. The consumer needs to do two things:
  
 
 1. Register itself with the the scanner to let it know that it wants to
   receive those events that are being generated.
 
 2. Do something with the events (and the information associated with
   them).
  
  An example should make it more clear how this works.
  

2.4.2  Writing your own consumer
================================
   
  Now it's time to understand our parser framework, and also start
looking at our friends, the lady slipper orchids. To start our search,
let's just take a look through the nucleotide databases at NCBI, using
an Entrez search
(lhttp://www.ncbi.nlm.nih.gov:80/entrez/query.fcgi?db=Nucleotide) for
everything mentioning the text Cypripedioideae (this is the subfamily of
lady slipper orchids). This search gives us 94 hits, which we save into
a FASTA formatted text file.
  Now, let's try and use a parser to summarize the type of information
we got. To take a simple example, why don't we go through and grab all
of the organism names mentioned, to see how many different species of
lady slipper orchids are represented in this data.
  To do this kind of useful work, we need to do get our hands dirty and
write the solution to all of our problems -- a consumer. This is what
our consumer implementation to extract the organisms will look like:
<<
  import string
  from Bio.ParserSupport import AbstractConsumer
  
  class SpeciesExtractor(AbstractConsumer):
  
      def __init__(self):
          self.species_list = []
  
      def title(self, title_info):
          title_atoms = string.split(title_info)
          new_species = title_atoms[1]
  
          if new_species not in self.species_list:
              self.species_list.append(new_species)
>>
  
  The first thing we do is import the base class which Consumers should
derive from, `AbstractConsumer'. This base class does nice things for us
like take care of all the sections we aren't interested in. Then we
create our personal consumer class by deriving from this base
AbstractConsumer class.
  Just like any other python class, we define a `__init__' function that
will be called when a new instance of the class is created. In the
initialization we set a `species_list' class attribute. This will store
the species information as the file is parsed, and will allow us to
extract this information later on.
  Now we come to the function that is really nifty, the `title'
function. This function will be called by the Scanner every time a
'title' event is generated. So, when the Scanner comes to the first line
in our example FASTA file:
<<
  >gi|2765658|emb|Z78533.1|CIZ78533 C.irapeanum 5.8S rRNA gene and ITS1
and ITS2 DNA
>>
  
  It will recognize this as a title, and call the `title' function with
the `title_info' argument set as the value of the title.
  Now that we've captured the title, we want to extract the information
from it we are interested in. Looking at the FASTA title info, we notice
that the second item in the info string is the organism name. To get
this out we can just use the built-in python function `string.split' to
split the string at every space, creating the list `title_atoms'. Since
the second element of this list is the species name, we then grab this
out of the list. Then we simply check to see if the species is already
in our current list of organisms, and if not, we add it.
  Okay, well that was easy enough -- so now we need to call the Scanner
and actual do this work. To do this, we write a little function:
<<
  
  from Bio import Fasta
  
  def extract_organisms(file, num_records):
      scanner = Fasta._Scanner()
      consumer = SpeciesExtractor()
  
      file_to_parse = open(file, 'r')
  
      for fasta_record in range(num_records):
          scanner.feed(file_to_parse, consumer)
  
      file_to_parse.close()
  
      return handler.species_list
  
>>
  
  Let's walk though the function step by step. First, we import the
Fasta parser from the Biopython library, then we proceed to define our
function. It takes two arguments, the FASTA formatted file to parse, and
the number of records in the file. It then creates a Scanner for
scanning through FASTA files, and a SpeciesExtractor consumer which will
get all of the organisms, as we described above.
  We then open our file to parse and get it ready to go. All of the
Biopython parsers take file handles as inputs. This means that you can
pass them any kind of ``file-like'' object. For instance, the `url'
library allows to you work with a document on a remote URL as if it was
a local file, so you could use this to pass the parser a document
somewhere on the net.
  Now that we've got the open file, it's time to parse it. The way the
parser works is that you call `feed' for every item in the file you want
to parse, passing it the file-like object to parse, and the consumer to
call back to. So we loop through all records in the file, and scan them,
relying on the consumer to deal with the files as appropriate. Finally,
once that is all done, we get the `species_list' attribute of the
consumer class, containing all of the information extracted and return
that.
  Whew, with all of that work out of the way, parsing the file will be
really easy:
<<
  all_species = extract_organisms("ls_orchid.fasta", 94)
  print "number of species:", len(all_species)
  print 'species names:', all_species
>>
  
  Running this all as one big program (the program is available as
`fasta_consumer.py' in the `Doc/examples' directory) give us the
information we desire:
<<
  [chapmanb@taxus examples]# python fasta_consumer.py
  number of species: 92
  species names: ['C.irapeanum', 'C.californicum', 'C.fasciculatum', 
  'C.margaritaceum', 'C.lichiangense', 'C.yatabeanum', 'C.guttatum',
  ...
>>
  
  

2.4.3  Making it easier
=======================
   
  The last section explained all of the nitty gritty of writing a
specialized consumer. The flexibility of being able to write your own
consumer is very nice, however for many applications it can be overkill.
For a simple application, the nice Biopython folks have provided some
useful classes that act more like full parsers. So, for quick and dirty
applications, these are what you want to look at. 
  One big problem with the parser we used above was that we were
required to know the number of elements in the file. This can be pretty
impractical for a lot of applications when you just want to parse
through a file and look for something. To help deal with this problem,
we can use the `Iterator' interface for FASTA files. This interface
allows you to not worry about consumers and scanners and all of that
jazz, and just march through a file one record at a time. However, doing
this requires that the Iterator return some kind of object that you can
manipulate to extract the info you want.
  To deal with this problem, a very useful class was written into many
of the Biopython parsers -- a `RecordParser', which parses a file into a
python class that represents it. For instance, for FASTA files, the
Record class is just an object with `title' and `sequence' attributes. 
  Let's make all of this talk more concrete by using the Iterator and
Record interfaces to do what we did before -- extract a unique list of
all species in our FASTA file. First we need to set up our parser and
iterator:
<<
  >>> from Bio import Fasta
  >>> parser = Fasta.RecordParser()
  >>> file = open("ls_orchid.fasta")
  >>> iterator = Fasta.Iterator(file, parser)
>>
  
  First we create our parser -- a RecordParser that parses a FASTA entry
into the Record class representing it. Then we open the file, and create
an iterator, and we are ready to start parsing.
  Like most iterator interfaces, we retrieve the objects by calling
`next()'. When there are no sequences left to parse, `next()' will
return `None', so we know that it is time to stop. To get our first
record:
<<
  >>> cur_record = iterator.next()
>>
  
  Let's take a look at the record object. It has sequence and title
attributes that we can easily get at:
<<
  >>> dir(cur_record)
  ['_colwidth', 'sequence', 'title']
  >>> print cur_record.title
  gi|2765658|emb|Z78533.1|CIZ78533 C.irapeanum 5.8S rRNA gene and ITS1
and ITS2 DN>>> print cur_record.sequence
  CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGGAATAAACGATCGAGTG
AATCCGGA
  ...
>>
  
  In my opinion, the coolest thing is how easy it is to get the FASTA
record right back:
<<
  >>> print cur_record
  >gi|2765658|emb|Z78533.1|CIZ78533 C.irapeanum 5.8S rRNA gene and ITS1
and ITS2 DNA
  CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGGAATAAA
  CGATCGAGTGAATCCGGAGGACCGGTGTACTCAGCTCACCGGGGGCATTGCTCCCGTGGT
  GACCCTGATTTGTTGTTGGGCCGCCTCGGGAGCGTCCATGGCGGGTTTGAACCTCTAGCC
  CGGCGCAGTTTGGGCGCCAAGCCATATGAAAGCATCACCGGCGAATGGCATTGTCTTCCC
  CAAAACCCGGAGCGGCGGCGTGCTGTCGCGTGCCCAATGAATTTTGATGACTCTCGCAAA
  CGGGAATCTTGGCTCTTTGCATCGGATGGAAGGACGCAGCGAAATGCGATAAGTGGTGTG
  AATTGCAAGATCCCGTGAACCATCGAGTCTTTTGAACGCAAGTTGCGCCCGAGGCCATCA
  GGCTAAGGGCACGCCTGCTTGGGCGTCGCGCTTCGTCTCTCTCCTGCCAATGCTTGCCCG
  GCATACAGCCAGGCCGGCGTGGTGCGGATGTGAAAGATTGGCCCCTTGTGCCTAGGTGCG
  GCGGGTCCAAGAGCTGGTGTTTTGATGGCCCGGAACCCGGCAAGAGGTGGACGGATGCTG
  GCAGCAGCTGCCGTGCGAATCCCCCATGTTGTCGTGCTTGTCGGACAGGCAGGAGAACCC
  TTCCGAACCCCAATGGAGGGCGGTTGACCGCCATTCGGATGTGACCCCAGGTCAGGCGGG
  GGCACCCGCTGAGTTTACGC
>>
  
  We can use all of this to do a rewrite of our `extract_organisms'
function:
<<
  def extract_organisms(file_to_parse):
  
      parser = Fasta.RecordParser()
      file = open(file_to_parse, 'r')
      iterator = Fasta.Iterator(file, parser)
  
      all_species = []
  
      while 1:
          cur_record = iterator.next()
  
          if cur_record is None:
              break
  
          # extract the info from the title
          title_atoms = string.split(cur_record.title)
          new_species = title_atoms[1]
  
          # append the new species to the list if it isn't there
          if new_species not in all_species:
              all_species.append(new_species)
  
      return all_species
>>
  
  Running this will give us identical results to what we saw earlier.
Whether you choose to use this interface or the previous one depends on
your needs and what you feel most comfortable with. Hey, Perl isn't the
only place where there's more that one way to do things!
  

2.4.4  FASTA files as Dictionaries
==================================
  
  The final thing that we'll do with our ubiquitous orchid fasta file is
to show how to index it and access it like a database. This is very
useful for large files where you only need to access certain elements of
the file, and makes for a nice quick 'n dirty database.
  Let's index our record via their GenBank accession number, which seems
like a useful way to get track of them. To do this, we first need to
write a small function which returns accession numbers from a FASTA
record (this is the Record class we discussed earlier):
<<
  import string
  
  def get_accession_num(fasta_record):
      title_atoms = string.split(fasta_record.title)
  
      # all of the accession number information is stuck in the first
element
      # and separated by '|'s
      accession_atoms = string.split(title_atoms[0], '|')
   
      # the accession number is the 4th element
      gb_name = accession_atoms[3]
  
      # strip the version info before returning
      return gb_name[:-2]
>>
  
  Now we need to create an index from this file, which will show us why
writing this function was important. The general format for indexing a
file is:
<<
  index_file(file_to_index, index_file_to_create,
function_to_get_index_key)
>>
  
  The tricky argument is the `function_to_get_index_key'. Basically,
this is a reference to a function that can get called and return an
element to use as a key. The idea here is that the `index_file' should
be general purpose, and there isn't any good way for the Biopython
developers to read your mind and know how you want to index your files.
So now the `get_accession_num' function above makes a lot of sense!
  Using all of this, we can now create an index file and see how it
works. First, let's create the index file:
<<
  >>> from Bio import Fasta 
  >>> Fasta.index_file("ls_orchid.fasta", "my_orchid_dict.idx",
get_accession_num)
>>
  
  This creates an index file `my_orchid_dict.idx' based on the input
from `ls_orchid.fasta' and indexed by the values returned by our
`get_accession_number' function.
  Now that we've got the index, we can create an in-memory dictionary to
access the file contents using the index:
<<
  >>> from Bio.Alphabet import IUPAC
  >>> dna_parser = Fasta.SequenceParser(IUPAC.ambiguous_dna)
  >>> orchid_dict = Fasta.Dictionary("my_orchid_dict.idx", dna_parser)
>>
  
  The dictionary is created from our `my_orchid_dict.idx' file, and
returns Sequence objects. The type of objects returned by the index file
are based on the second argument passed. This argument should be a
parser that the index file will pass the information through before
returning it. If no parser is passed, then the dictionary will just
return the raw object (i. e. exactly as it appears in the file). 
  The parser that we pass here is a `SequenceParser' which converts
FASTA files into `SeqRecord' objects. The `SequenceParser' takes an
argument of the alphabet we should be using for the sequences. Since the
parser can't be smart enough to know exactly what it will be parsing, we
need to tell it. If no alphabet is provided, then the parser will
default to `Alphabet.generic_alphabet'.
  Since this is a dictionary, we can look at all of the keys we have
available:
<<
  >>> print orchid_dict.keys()
  ['Z78475', 'Z78519', 'Z78516', 'Z78517', 'Z78514', 'Z78515', 'Z78512',

   'Z78513', 'Z78510', 'Z78511', 'Z78457', 'Z78456', 'Z78455', 'Z78454',

  ...
>>
  
  We can access a single sequence object via the keys and manipulate the
object as a normal `SeqRecord' object:
<<
  >>> seq_record = orchid_dict['Z78475']
  >>> print seq_record
  <Bio.SeqRecord.SeqRecord instance at 0x102c1f2c>
  >>> print seq_record.description
  gi|2765600|emb|Z78475.1|PSZ78475 P.supardii 5.8S rRNA gene and ITS1
and ITS2 DNA
  >>> print seq_record.seq
  Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACATAATAAT
...', IUPACAmbiguousDNA())
>>
  
  That easily, we have created a database of our FASTA file that will
spit out sequence objects. 
  

2.4.5  I love parsing -- please don't stop talking about it!
============================================================
  
  Biopython has a lot of parsers, and each has its own little special
niches based on the sequence format it is parsing and all of that. The
best place to look for information about specific parsers and how to do
cool things with them is in the Cookbook section of the Tutorial. If you
don't find the information you are looking for, please consider helping
out your poor overworked documentors and submitting a cookbook entry
about it! (once you figure out how to do it, that is!)
  

2.5  Connecting with biological databases
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  One of the very common things that you need to do in bioinformatics is
extract information from biological databases. It can be quite tedious
to access these databases manually, especially if you have a lot of
repetitive work to do. Biopython attempts to save you time and energy by
making some on-line databases available from python scripts. Currently,
Biopython has code to extract information from the following databases:
  
   
 - ExPASy -- http://www.expasy.org/ See section 3.2 in the Cookbook for
   more information.  
 - Entrez from NCBI -- http://www.ncbi.nlm.nih.gov/Entrez/  
 - PubMed from NCBI -- http://www.ncbi.nlm.nih.gov/PubMed/. See section
   3.3 in the Cookbook for example code detailing how to use this.  
 - SCOP -- http://scop.mrc-lmb.cam.ac.uk/scop/ 
  
  The code is these modules basically makes it easy to write python code
that interact with the CGI scripts on these pages, so that you can get
results in an easy to deal with format. In some cases, the results can
be tightly integrated with the Biopython parsers to make it even easier
to extract information.
  Here we'll show a simple example of performing a remote Entrez query.
More information on the other services is available in the Cookbook,
which begins on page ??.
  In section 2.4.2 of the parsing examples, we talked about using Entrez
to search the NCBI nucleotide databases for info on Cypripedioideae, our
friends the lady slipper orchids. Now, we'll look at how to automate
that process using a python script. For Entrez searching, this is more
useful for displaying results then as a tool for getting sequences. The
NCBI web site is mostly set up to allow remote queries so that you could
write our own local CGI scripts that return information from NCBI pages.
For this reason, the results are returned as HTML and it is pretty tough
to get a flat file in a quick manner.
  In this example, we'll just show how to connect, get the results, and
display them in a web browser. First, we'll start by defining our search
and how to display the results:
<<
  search_command = 'Search'
  search_database = 'Nucleotide'
  return_format = 'FASTA'
  search_term = 'Cypripedioideae'
  
  my_browser = 'lynx'
>>
  
  The first four terms define the search we are going to do. To use the
Entrez module, you'll need to know a bit about how the remote CGI
scripts at NCBI work, and you can find out more about this at
http://www.ncbi.nlm.nih.gov/entrez/query/static/linking.html. The final
term just describes the browser to display the results in.
  Now that we've got this all set up, we can query Entrez and get a
handle with the results. This is done with the following code:
<<
  from Bio.WWW import NCBI
  
  result_handle = NCBI.query(search_command, search_database, term =
search_term,
                             doptcmdl = return_format)
>>
  
  The query function does all of the work of preparing the CGI script
command line and rounding up the HTML results.
  Now that we've got the results, we are ready to save them to a file
and display them in our browser, which we can do with code like:
<<
  import os
  
  result_file_name = os.path.join(os.getcwd(), 'results.html')
  result_file = open(result_file_name, 'w')
  result_file.write(result_handle.read())
  result_file.close()
  
  if my_browser == 'lynx':
      os.system('lynx -force_html ' + result_file_name)
  elif my_browser == 'netscape':
      os.system('netscape file:' + result_file_name)
>>
  
  Snazzy! We can fetch things and display them automatically -- you
could use this to quickly set up searches that you want to repeat on a
daily basis and check by hand, or to set up a small CGI script to do
queries and locally save the results before displaying them (as a kind
of lab notebook of our search results). Hopefully whatever your task,
the database connectivity code will make things lots easier for you!
  

2.6  What to do next
*=*=*=*=*=*=*=*=*=*=

  
  Now that you've made it this far, you hopefully have a good
understanding of the basics of Biopython and are ready to start using it
for doing useful work. The best thing to do now is to start snooping
around in the source code and looking at the automatically generated
documentation. 
  Once you get a picture of what you want to do, and what libraries in
Biopython will do it, you should take a peak at the Cookbook, which may
have example code to do something similar to what you want to do. 
  If you know what you want to do, but can't figure out how to do it,
please feel free to post questions to the main biopython list
(biopython@biopython.org). This will not only help us answer your
question, it will also allow us to improve the documentation so it can
help the next person do what you want to do.
  Enjoy the code!
  

Chapter 3    Cookbook -- Cool things to do with it
**************************************************
   
  

3.1  BLAST
*=*=*=*=*=

  
  Hey, everybody loves BLAST right? I mean, geez, how can get it get any
easier to do comparisons between one of your sequences and every other
sequence in the known world? Heck, if I was writing the code to do that
it would probably take about a day and a half to complete, and the
results still wouldn't be as good. But, of course, this section isn't
about how cool BLAST is, since we already know that. It is about the
problem with BLAST -- it can be really difficult to deal with the volume
of data generated by large runs, and to automate BLAST runs in general.
  Fortunately, the Biopython folks know this only too well, so they've
developed lots of tools for dealing with BLAST and making things much
easier. This section details how to use these tools and do useful things
with 'em. 
  

3.1.1  Running BLAST over the Internet
======================================
   
  The first step in automating BLASTing is to make everything accessible
from python scripts. So, biopython contains code that allows you to run
the WWW version of BLAST (http://www.ncbi.nlm.nih.gov/BLAST/) directly
from your python scripts. This is very nice, especially since BLAST can
be a real pain to deal with from scripts, especially with the whole
BLAST queue thing and the separate results page. Keeping the Biopython
code up to date with all of the changes at NCBI is hard enough!
  The code to deal with the WWW version of BLAST is found in the
`Bio.Blast.NCBIWWW' module, and the `qblast' function. Let's say we want
to BLAST info we have in a FASTA formatted file against the database.
First, we need to get the info in the FASTA file. The easiest way to do
this is to use the Fasta iterator to get a record. In this example,
we'll just grab the first FASTA record from a  file, using an Iterator
(section 2.4.3 explains FASTA iterators in more detail).
<<
  from Bio import Fasta
  
  file_for_blast = open('m_cold.fasta', 'r')
  f_iterator = Fasta.Iterator(file_for_blast)
  
  f_record = f_iterator.next()
>>
  
  Now that we've got the FASTA record, we are ready to blast it. The
code to do the simplest possible BLAST (a simple blastn of the FASTA
file against all of the non-redundant databases) is:
<<
  from Bio.Blast import NCBIWWW
  result_handle = NCBIWWW.qblast('blastn', 'nr', f_record)
>>
  
  The `qblast' function also take a number of other option arguments
which are basically analogous to the different parameters you can set on
the basic BLAST page
(http://www.ncbi.nlm.nih.gov/blast/blast.cgi?Jform=0), but for this I'll
just talk about the first few arguments, which are the most important
(and are also non-optional).
  The first argument is the blast program to use for the search. The
options and descriptions of the programs are available at
http://www.ncbi.nlm.nih.gov/BLAST/blast_program.html. The second
argument specifies the databases to search against. Again, the options
for this are available on the NCBI web pages at
http://www.ncbi.nlm.nih.gov/BLAST/blast_databases.html.
  Note that in version 1.40 of Biopython, `blast' is deprecated, and
`qblast' is used instead. Also, currently `qblast' only works with
blastn and blasp as program arguments.
  After you have set the search options, you just need to pass in your
Fasta sequence as a string, which is the third argument, and you are all
ready to BLAST. Biopython takes care of worrying about when the results
are available, and will pause until it can get the results and return
them.
  Before parsing the results, it is often useful to save them into a
file so that you can use them later without having to go back and
re-blast everything. I find this especially useful when debugging my
code that extracts info from the BLAST files, but it could also be
useful just for making backups of things you've done. If you want to
save the results returned, and also parse the results, we need to be
careful since using `handle.read()' to write the results to the file
will result in not having the info in the handle anymore. The best way
to handle this is to first use `read()' to get all of the information
from the handle into a string, and then deal with this  string (note:
using the `copy' module will not work, despite what  was written here
before (whoops!), since it is not possible to copy a handle). We can get
a string with the BLAST results and write it to a file by doing:
<<
  # save the results for later, in case we want to look at it
  save_file = open('my_blast.out', 'w')
  blast_results = result_handle.read()
  save_file.write(blast_results)
  save_file.close()
>>
  
  After doing this, the results are in the file `my_blast.out' and the
variable `blast_results' contains the blast results in a string form.
  The `parse' function of the BLAST parser, as described in 3.1.2, takes
a file-handle-like object to be parsed. We can get a handle-like object
from our string of BLAST results using the python standard library
module `cStringIO'. The  following code will give us a handle we can
feed directly into the parser:
<<
  import cStringIO
  blast_out = cStringIO.StringIO(blast_results)
>>
  
  Now that we've got the BLAST results, we are ready to do something
with them, so this leads us right into the parsing section.
  

3.1.2  Parsing the output from the WWW version of BLAST
=======================================================
   
  The WWW version of BLAST is infamous for continually changing the
output in a way that will break parsers that deal with it. Because of
this, having a centralized parser in libraries such as Biopython is very
important, since then you can have multiple people testing and using it
and keeping it up to date. This is so much nicer than trying to keep a
tool such as this running yourself.
  You can get information to parse with the WWW BLAST parser in one of
the two ways. The first is to grab the info using the biopython function
for dealing with blast -- doing this is described in section 3.1.1. The 
second way is to manually do the BLAST on the NCBI site, and then save
the results. In order to have your output in the right format, you need
to save the final BLAST page you get (you know, the one with all of the
interesting results!) as HTML (i. e. do not save as text!) to a file.
The important point is that you do not have to use biopython scripts to
fetch the data in order to be able to parse it.
  Doing things either of these two ways, you then need to get a handle
to the results. In python, a handle is just a nice general way of
describing input to any info source so that the info can be retrieved
using `read()' and `readline()' functions. This is the type of input the
BLAST parser (and the other biopython parsers take). 
  If you followed the code above for interacting with BLAST through a
script, then you already have `blast_results', which is great for
passing to a parser via a `cStringIO.StringIO'. If you saved the results
in a file, then opening up the file with code like the following will
get you what you need:
<<
  blast_out = open('my_blast.out', 'r')
>>
  
  Now that we've got a handle, we are ready to parse the output. The
code to parse it is really quite small:
<<
  from Bio.Blast import NCBIWWW
  
  b_parser = NCBIWWW.BlastParser()
  b_record = b_parser.parse(blast_out)
>>
  
  What this accomplishes is parsing the BLAST output into a Blast Record
class. The section below on the Record class describes what is contained
in this class, but in general, it has got everything you might ever want
to extract from the output. Right now we'll just show an example of how
to get some info out of the BLAST report, but if you want something in
particular that is not described here, look at the info on the record
class in detail, and take a gander into the code or automatically
generated documentation -- the docstrings have lots of good info about
what is stored in each piece of information.
  To continue with our example, let's just print out some summary info
about all hits in our blast report greater than a particular threshold.
The following code does this:
<<
  E_VALUE_THRESH = 0.04
  
  for alignment in b_record.alignments:
      for hsp in alignment.hsps:
          if hsp.expect < E_VALUE_THRESH:
              print '****Alignment****'
              print 'sequence:', alignment.title
              print 'length:', alignment.length
              print 'e value:', hsp.expect
              print hsp.query[0:75] + '...'
              print hsp.match[0:75] + '...'
              print hsp.sbjct[0:75] + '...'
>>
  
  This will print out summary reports like the following:
<<
  ****Alignment****
  sequence: >gb|AF283004.1|AF283004 Arabidopsis thaliana cold
acclimation protein WCOR413-like protein
  alpha form mRNA, complete cds
  length: 783
  e value: 0.034
  tacttgttgatattggatcgaacaaactggagaaccaacatgctcacgtcacttttagtcccttacatat
tcctc...
  ||||||||| | ||||||||||| || ||||  || || |||||||| |||||| |  | ||||||||
||| ||...
  tacttgttggtgttggatcgaaccaattggaagacgaatatgctcacatcacttctcattccttacatct
tcttc...
>>
  
  Basically, you can do anything you want to with the info in the BLAST
report once you have parsed it. This will, of course, depend on what you
want to use it for, but hopefully this helps you get started on doing
what you need to do!
  

3.1.3  The BLAST record class
=============================
  
  An important consideration for extracting information from a BLAST
report is the type of objects that the information is stored in. In
Biopython, the parsers return `Record' objects, either `Blast' or
`PSIBlast' depending on what you are parsing. These objects are defined
in `Bio.Blast.Record' and are quite complete.
  Here are my attempts at UML class diagrams for the `Blast' and
`PSIBlast' record classes. If you are good at UML and see
mistakes/improvements that can be made, please let me know. The Blast
class diagram is shown in Figure 3.1.3.
    *images/BlastRecord.png* 
  
  The PSIBlast record object is similar, but has support for the rounds
that are used in the iteration steps of PSIBlast. The class diagram for
PSIBlast is shown in Figure 3.1.3.
    *images/PSIBlastRecord.png* 
  
  

3.1.4  Running BLAST locally
============================
  
  If you want to make your own database to search for sequences against,
then local BLAST is definitely the way you want to go. As with online
BLAST, biopython provides lots of nice code to make you able to call
local BLAST executables from your scripts, and have full access to the
many command line options that these executables provide. You can obtain
local BLAST precompiled for a number of platforms at
ftp://ncbi.nlm.nih.gov/blast/executables/, or can compile it yourself in
the NCBI toolbox (ftp://ncbi.nlm.nih.gov/toolbox/).
  The code for dealing with local BLAST is found in
`Bio.Blast.NCBIStandalone', specifically in the functions `blastall' and
`blastpgp', which correspond with the BLAST executables that their names
imply.
  Let's use these functions to run a `blastall' against a local database
and return the results. First, we want to set up the paths to everything
that we'll need to do the blast. What we need to know is the path to the
database (which should have been prepared using `formatdb') to search
against, the path to the file we want to search, and the path to the
`blastall' executable.
<<
  import os
  
  my_blast_db = os.path.join(os.getcwd(), 'at-est', 'a_cds-10-7.fasta')
  my_blast_file = os.path.join(os.getcwd(), 'at-est', 'test_blast',
                               'sorghum_est-test.fasta')
  my_blast_exe = os.path.join(os.getcwd(), 'blast', 'blastall')
>>
  
  Now that we've got that all set, we are ready to run the blast and
collect the results. We can do this with two lines:
<<
  from Bio.Blast import NCBIStandalone
  
  blast_out, error_info = NCBIStandalone.blastall(my_blast_exe,
'blastn',
                                                  my_blast_db,
my_blast_file)
>>
  
  Note that the biopython interfaces to local blast programs returns two
values. The first is a handle to the blast output, which is ready to
either be saved or passed to a parser. The second is the possible error
output generated by the blast command.
  The error info can be hard to deal with, because if you try to do a
`error_info.read()' and there was no error info returned, then the
`read()' call will block and not return, locking your script. In my
opinion, the best way to deal with the error is only to print it out if
you are not getting `blast_out' results to be parsed, but otherwise to
leave it alone.
  If you are interested in saving your results to a file before parsing
them, see the section on WWW blast above for some info on how to use the
`copy' module to do this.
  Well, now that you've got output, we should start parsing them, so
read on to learn about parsing local BLAST output.
  

3.1.5  Parsing BLAST output from local BLAST
============================================
  
  Since the output generated by local BLAST is different than that
generated by the web-based BLAST, we use the parsers located in
`Bio.Blast.NCBIStandalone' to parse and deal with the results.
  As with WWW blast (see the info on this above) we need to have a
handle object that we can pass to the parser. The handle must implement
the `readline()' method and do this properly. The common ways to get
such a handle are to either use the provided `blastall' or `blastpgp'
functions to run the local blast, or to run a local blast via the
command line, and then do something like the following:
<<
  blast_out = open('my_file_of_blast_output', 'r')
>>
  
  So, as with WWW blast, there is no need to use the biopython
convenience functions if you don't want to.
  Well, now that we've got a handle (which we'll call `blast_out'), we
are ready to parse it. This can be done with the following code:
<<
  from Bio.Blast import NCBIStandalone
  
  b_parser = NCBIStandalone.BlastParser()
  b_record = b_parser.parse(blast_out)
>>
  
  This will parse the BLAST report into a Blast Record class (either a
Blast or a PSIBlast record, depending on what you are parsing) so that
you can extract the information from it. In our case, let's just use
print out a quick summary of all of the alignments greater than some
threshold value.
<<
  E_VALUE_THRESH = 0.04
  for alignment in b_record.alignments:
      for hsp in alignment.hsps:
          if hsp.expect < E_VALUE_THRESH:
              print '****Alignment****'
              print 'sequence:', alignment.title
              print 'length:', alignment.length
              print 'e value:', hsp.expect
              print hsp.query[0:75] + '...'
              print hsp.match[0:75] + '...'
              print hsp.sbjct[0:75] + '...'
>>
  
  If you also read the section on parsing BLAST from the WWW version,
you'll notice that the above code is identical to what is found in that
section. Once you parse something into a record class you can deal with
it independent of the format of the original BLAST info you were
parsing. Pretty snazzy!
  Sure, parsing one record is great, but I've got a BLAST file with tons
of records -- how can I parse them all? Well, fear not, the answer lies
in the very next section.
  

3.1.6  Parsing a file full of BLAST runs
========================================
  
  Of course, local blast is cool because you can run a whole bunch of
sequences against a database and get back a nice report on all of it.
So, biopython definitely has facilities to make it easy to parse
humongous files without memory problems. 
  We can do this using the blast iterator. To set up an iterator, we
first set up a parser, to parse our blast reports in Blast Record
objects:
<<
  from Bio.Blast import NCBIStandalone
  
  b_parser = NCBIStandalone.BlastParser()
>>
  
  Then we will assume we have a handle to a bunch of blast records,
which we'll call `blast_out'. Getting a handle is described in full
detail above in the blast parsing sections. 
  Now that we've got a parser and a handle, we are ready to set up the
iterator with the following command:
<<
  b_iterator = NCBIStandalone.Iterator(blast_out, b_parser)
>>
  
  The second option, the parser, is optional. If we don't supply a
parser, then the iterator will just return the raw BLAST reports one at
a time.
  Now that we've got an iterator, we start retrieving blast records
(generated by our parser) using `next()':
<<
  b_record = b_iterator.next()
>>
  
  Each call to next will return a new record that we can deal with. Now
we can iterate through this records and generate our old favorite, a
nice little blast report:
<<
  while 1:
      b_record = b_iterator.next()
  
      if b_record is None:
          break
  
      E_VALUE_THRESH = 0.04
      for alignment in b_record.alignments:
          for hsp in alignment.hsps:
              if hsp.expect < E_VALUE_THRESH:
                  print '****Alignment****'
                  print 'sequence:', alignment.title
                  print 'length:', alignment.length
                  print 'e value:', hsp.expect
  
                  if len(hsp.query) > 75:
                      dots = '...'
                  else:
                      dots = ''
                  
                  print hsp.query[0:75] + dots
                  print hsp.match[0:75] + dots
                  print hsp.sbjct[0:75] + dots
>>
  
  Notice that `b_iterator.next()' will return `None' when it runs out of
records to parse, so it is easy to iterate through the entire file with
a while loop that checks for the existence of a record.
  The iterator allows you to deal with huge blast records without any
memory problems, since things are read in one at a time. I have parsed
tremendously huge files without any problems using this.
  

3.1.7  Finding a bad record somewhere in a huge file
====================================================
  
  One really ugly problem that happens to me is that I'll be parsing a
huge blast file for a while, and the parser will bomb out with a
SyntaxError. This is a serious problem, since you can't tell if the
SyntaxError is due to a parser problem, or a problem with the BLAST. To
make it even worse, you have no idea where the parse failed, so you
can't just ignore the error, since this could be ignoring an important
data point.
  We used to have to make a little script to get around this problem,
but the `Bio.Blast' module now includes a `BlastErrorParser' which
really helps make this easier. The `BlastErrorParser' works very similar
to the regular `BlastParser', but it adds an extra layer of work by
catching SyntaxErrors that are generated by the parser, and attempting
to diagnose the errors.
  Let's take a look at using this parser -- first we define the file we
are going to parse and the file to write the problem reports to:
<<
  import os
   
  b_file = os.path.join(os.getcwd(), 'blast_out', 'big_blast.out')
  error_file = os.path.join(os.getcwd(), 'blast_out',
'big_blast.problems')
>>
  
  Now we want to get a `BlastErrorParser':
<<
  from Bio.Blast import NCBIStandalone
  
  error_handle = open(error_file, 'w')
  
  b_error_parser = NCBIStandalone.BlastErrorParser(error_handle)
>>
  
  Notice that the parser take an optional argument of a handle. If a
handle is passed, then the parser will write any blast records which
generate a SyntaxError to this handle. Otherwise, these records will not
be recorded.
  Now we can use the `BlastErrorParser' just like a regular blast
parser. Specifically, we might want to make an iterator that goes
through our blast records one at a time and parses them with the error
parser:
<<
  blast_out = open(b_file)
  iterator = NCBIStandalone.Iterator(blast_out, b_error_parser)
>>
  
  Just like before, we can read these records one a time with, but now
we can catch and deal with errors that are due to problems with Blast
(and not with the parser itself):
<<
  try:
      next_record = iterator.next()
  except NCBIStandalone.LowQualityBlastError, info:
      print "LowQualityBlastError detected in id %s" % info[1]
>>
  
  Right now the `BlastErrorParser' can generate the following errors:
  
   
 - `SyntaxError' -- This is the same error generated by the regular
   BlastParser, and is due to the parser not being able to parse a
   specific file. This is normally either due to a bug in the parser, or
   some kind of discrepancy between the version of BLAST you are using
   and the versions the parser is able to handle.
 
 - `LowQualityBlastError' -- When BLASTing a sequence that is of really
   bad quality (for example, a short sequence that is basically a
   stretch of one nucleotide), it seems that Blast ends up masking out
   the entire sequence and ending up with nothing to parse. In this case
   it will produce a truncated report that causes the parser to generate
   a SyntaxError. `LowQualityBlastError' is reported in these cases.
   This error returns an info item with the following information:  
      
    - `item[0]' -- The error message  
    - `item[1]' -- The id of the input record that caused the error.
      This is really useful if you want to record all of the records
      that are causing problems.  
  
  
  As mentioned, with each error generated, the BlastErrorParser will
write the offending record to the specified `error_handle'. You can then
go ahead and look and these and deal with them as you see fit. Either
you will be able to debug the parser with a single blast report, or will
find out problems in your blast runs. Either way, it will definitely be
a useful experience!
  Hopefully the `BlastErrorParser' will make it much easier to debug and
deal with large Blast files.
  

3.1.8  Dealing with PSIBlast
============================
  
  We should write some stuff to make it easier to deal directly with
PSIBlast from scripts (i. e. output the align file in the proper format
from an alignment). I need to look at PSIBlast more and come up with
some good ways of going this...
  

3.2  SWISS-PROT
*=*=*=*=*=*=*=*

   
  

3.2.1  Retrieving a SWISS-PROT record
=====================================
  
  SwissProt (http://www.expasy.org/sprot/sprot-top.html) is a
hand-curated database of protein sequences. Let's look at how we connect
with it from a script and parse SwissProt formatted results. 
  First, we need to retrieve some results to parse. Let's say we are
looking at chalcone synthases for Orchids (see section 2.3 for some
justification for looking for interesting things about orchids).
Chalcone synthase is involved in flavanoid biosynthesis in plants, and
flavanoids make lots of cool things like pigment colors and UV
protectants. 
  If you do a search on SwissProt, you can find three orchid proteins
for Chalcone Synthase, id numbers O23729, O23730, O23731. Now, let's
write a script which grabs these, and parses out some interesting
information.
  First, we grab the records, using the `get_sprot_raw()' function of
`Bio.WWW.ExPASy'. This function is very nice since you can feed it an id
and get back a raw text record (no html to mess with!). As we get the
three records we are interested in, we'll just put them together into
one big string, which we'll then use for parsing. The following code
accomplishes what I just wrote:
<<
  from Bio.WWW import ExPASy
  
  ids = ['O23729', 'O23730', 'O23731']
  
  all_results = ''
  for eid in ids:
      results = ExPASy.get_sprot_raw(eid)
      all_results = all_results + results.read()
>>
  
  Now that we've got the results, we are ready to parse them into
interesting information. As with most parsers, we set up an iterator and
parser. The parser we use here parses the SwissProt files into a Record
object where the interesting features are attributes:
<<
  from Bio.SwissProt import SProt
  from Bio import File
  
  s_parser = SProt.RecordParser()
  s_iterator = SProt.Iterator(File.StringHandle(all_results), s_parser)
>>
  
  Note that we convert `all_results', which is a string, into a handle
before passing it. The iterator requires a handle to be passed so that
it can read in everything one line at a time. The `Bio.File' module has
a nice StringHandle, which conveniently will convert a string into a
handle. Very nice! Now we are ready to start extracting information.
  To get out the information, we'll go through everything record by
record using the iterator. For each record, we'll just print out some
summary information:
<<
  while 1:
      cur_record = s_iterator.next()
  
      if cur_record is None:
          break
  
      print "description:", cur_record.description
      for ref in cur_record.references:
          print "authors:", ref.authors
          print "title:", ref.title
  
      print "classification:", cur_record.organism_classification
      print
>>
  
  This prints out a summary like the following:
<<
  description: CHALCONE SYNTHASE 8 (EC 2.3.1.74) (NARINGENIN-CHALCONE
SYNTHASE 8)
  authors: Liew C.F., Lim S.H., Loh C.S., Goh C.J.;
  title: "Molecular cloning and sequence analysis of chalcone synthase
cDNAs of
  Bromheadia finlaysoniana.";
  classification: ['Eukaryota', 'Viridiplantae', 'Embryophyta',
'Tracheophyta', 
  'Spermatophyta', 'Magnoliophyta', 'Liliopsida', 'Asparagales',
'Orchidaceae', 
  'Bromheadia']
>>
  
  Since Python 2.2, we can simplify the loop:
<<
  for cur_record in s_iterator:
      print "description:", cur_record.description
      for ref in cur_record.references:
          print "authors:", ref.authors
          print "title:", ref.title
  
      print "classification:", cur_record.organism_classification
      print
>>
  
  It is equally easy to extract any kind of information you'd like from
SwissProt records.
  Now, you may remark that I knew the records' accession numbers
beforehand. Indeed, `get_sprot_raw()' needs either the entry name or an
accession number. When you don't have them handy, you can use one of the
`sprot_search_de()' or `sprot_search_ful()' functions.
  `sprot_search_de()' searches in the ID, DE, GN, OS and OG lines;
`sprot_search_ful()' searches in (nearly) all the fields. They are
detailed on http://www.expasy.org/cgi-bin/sprot-search-de and
http://www.expasy.org/cgi-bin/sprot-search-ful respectively. Note that
thet don't search in TrEMBL by default (argument `trembl'). Note also
that they return html pages; however, accession numbers are quite easily
extractable:
<<
  from Bio.WWW import ExPASy
  import re
  
  handle = ExPASy.sprot_search_de("Orchid Chalcone Synthase")
  # or:
  # handle = ExPASy.sprot_search_ful("Orchid and {Chalcone Synthase}")
  html_results = handle.read()
  if "Number of sequences found" in html_results:
      ids = re.findall(r'HREF="/cgi-bin/niceprot\.pl\?(\w+)"',
html_results)
  else:
      ids = re.findall(r'href="/cgi-bin/get-sprot-raw\.pl\?(\w+)"',
html_results)
>>
  
  

3.3  PubMed
*=*=*=*=*=*

   
  

3.3.1  Sending a query to PubMed
================================
  
  If you are in the Medical field or interested in human issues (and
many times even if you are not!), PubMed
(http://www.ncbi.nlm.nih.gov/PubMed/) is an excellent source of all
kinds of goodies. So like other things, we'd like to be able to grab
information from it and use it in python scripts.
  Querying PubMed using Biopython is extremely painless. To get all of
the article ids for articles having to do with orchids, we only need the
following three lines of code:
<<
  from Bio import PubMed
  
  search_term = 'orchid'
  orchid_ids = PubMed.search_for(search_term)
>>
  
  This returns a python list containing all of the orchid ids
<<
  ['11070358', '11064040', '11028023', '10947239', '10938351',
'10936520', 
  '10905611', '10899814', '10856762', '10854740', '10758893',
'10716342', 
  ...
>>
  
  With this list of ids we are ready to start retrieving the records, so
follow on ahead to the next section.
  

3.3.2  Retrieving a PubMed record
=================================
  
  The previous section described how to get a bunch of article ids. Now
that we've got them, we obviously want to get the corresponding Medline
records and extract the information from them. 
  The interface for retrieving records from PubMed should be very
intuitive to python programmers -- it models a python dictionary. To set
up this interface, we need to set up a parser that will parse the
results that we retrieve. The following lines of code get everything set
up:
<<
  from Bio import PubMed
  from Bio import Medline
  
  rec_parser = Medline.RecordParser()
  medline_dict = PubMed.Dictionary(parser = rec_parser)
>>
  
  What we've done is create a dictionary like object `medline_dict'. To
get an article we access it like `medline_dict[id_to_get]'. What this
does is connect with PubMed, get the article you ask for, parse it into
a record object, and return it. Very cool! 
  Now let's look at how to use this nice dictionary to print out some
information about some ids. We just need to loop through our ids
(`orchid_ids' from the previous section) and print out the information
we are interested in:
<<
  for oid in orchid_ids[0:5]:
      cur_record = medline_dict[oid]
      print 'title:', string.rstrip(cur_record.title)
      print 'authors:', cur_record.authors
      print 'source:', string.strip(cur_record.source)
      print
>>
  
  The output for this looks like:
<<
  title: Sex pheromone mimicry in the early spider orchid (ophrys
sphegodes):
  patterns of hydrocarbons as the key mechanism for pollination by
sexual
  deception [In Process Citation]
  authors: ['Schiestl FP', 'Ayasse M', 'Paulus HF', 'Lofstedt C',
'Hansson BS', 
  'Ibarra F', 'Francke W']
  source: J Comp Physiol [A] 2000 Jun;186(6):567-74
>>
  
  Especially interesting to note is the list of authors, which is
returned as a standard python list. This makes it easy to manipulate and
search using standard python tools. For instance, we could loop through
a whole bunch of entries searching for a particular author with code
like the following:
<<
  search_author = 'Waits T'
  
  for our_id in our_id_list:
      cur_record = medline_dict[our_id]
      
      if search_author in cur_record.authors:
          print "Author %s found: %s" % (search_author,
                                        
string.strip(cur_record.source))
>>
  
  The PubMed and Medline interfaces are very mature and nice to work
with -- hopefully this section gave you an idea of the power of the
interfaces and how they can be used.
  

3.4  GenBank
*=*=*=*=*=*=

  
  The GenBank record format is a very popular method of holding
information about sequences, sequence features, and other associated
sequence information. The format is a good way to get information from
the NCBI databases at http://www.ncbi.nlm.nih.gov/. 
  

3.4.1  Retrieving GenBank entries from NCBI
===========================================
  
  One very nice feature of the GenBank libraries is the ability to
automate retrieval of entries from GenBank. This is very convenient for
creating scripts that automate a lot of your daily work. In this example
we'll show how to query the NCBI databases, and to retrieve the records
from the query.
  First, we want to make a query and find out the ids of the records to
retrieve. Here we'll do a quick search for Opuntia, my favorite organism
(since I work on it). We can do quick search and get back the GIs
(GenBank identifiers) for all of the corresponding records:
<<
  from Bio import GenBank
  
  gi_list = GenBank.search_for("Opuntia AND rpl16")
>>
  
  `gi_list' will be a list of all of the GenBank identifiers that match
our query:
<<
  ['6273291', '6273290', '6273289', '6273287', '6273286', '6273285',
'6273284']
>>
  
  Now that we've got the GIs, we can use these to access the NCBI
database through a dictionary interface. For instance, to retrieve the
information for the first GI, we'll first have to create a dictionary
that accesses NCBI:
<<
  ncbi_dict = GenBank.NCBIDictionary('nucleotide', 'genbank')
>>
  
  Now that we've got this, we do the retrieval:
<<
  gb_record = ncbi_dict[gi_list[0]]
>>
  
  In this case, `gb_record' will be GenBank formatted record:
<<
  LOCUS       AF191665      902 bp    DNA             PLN      
07-NOV-1999
  DEFINITION  Opuntia marenae rpl16 gene; chloroplast gene for
chloroplast
              product, partial intron sequence.
  ACCESSION   AF191665
  VERSION     AF191665.1  GI:6273291
  ...
>>
  
  In this case, we are just getting the raw records. We can also pass
these records directly into a parser and return the parsed record. For
instance, if we wanted to get back SeqRecord objects with the GenBank
file parsed into SeqFeature objects we would need to create the
dictionary with the GenBank FeatureParser:
<<
  record_parser = GenBank.FeatureParser()
  ncbi_dict = GenBank.NCBIDictionary('nucleotide', 'genbank',
                                     parser = record_parser)
>>
  
  Now retrieving a record will give you a SeqRecord object instead of
the raw record:
<<
  >>> gb_seqrecord = ncbi_dict[gi_list[0]]
  >>> print gb_seqrecord
  <Bio.SeqRecord.SeqRecord instance at 0x102f9404>
>>
  
  For more information of formats you can parse GenBank records into,
please see section 3.4.2.
  Using these automated query retrieval functionality is a big plus over
doing things by hand. Additionally, the retrieval has nice built in
features like a time-delay, which will prevent NCBI from getting mad at
you and blocking your access.
  

3.4.2  Parsing GenBank records
==============================
   
  While GenBank files are nice and have lots of information, at the same
time you probably only want to extract a small amount of that
information at a time. The key to doing this is parsing out the
information. Biopython provides GenBank parsers which help you
accomplish this task. Right now the GenBank module provides the
following parsers:
  
   
 1. RecordParser -- This parses the raw record into a GenBank specific
   Record object. This object models the information in a raw record
   very closely, so this is good to use if you are just interested in
   GenBank records themselves.
 
 2. FeatureParser -- This parses the raw record in a SeqRecord object
   with all of the feature table information represented in SeqFeatures
   (see section 3.7 for more info on these objects). This is best to use
   if you are interested in getting things in a more standard format. 
  
  Either way you chose to go, the most common usage of these will be
creating an iterator and parsing through a file on GenBank records.
Doing this is very similar to how things are done in other formats, as
the following code demonstrates:
<<
  from Bio import GenBank
  
  gb_file = "my_file.gb"
  gb_handle = open(gb_file, 'r')
  
  feature_parser = GenBank.FeatureParser()
  
  gb_iterator = GenBank.Iterator(gb_handle, feature_parser)
  
  while 1:
     cur_record = gb_iterator.next()
  
     if cur_record is None:
         break
  
     # now do something with the record
     print cur_record.seq
>>
  
  This just iterates over a GenBank file, parsing it into SeqRecord and
SeqFeature objects, and prints out the Seq objects representing the
sequences in the record.
  As with other formats, you have lots of tools for dealing with GenBank
records. This should make it possible to do whatever you need to with
GenBank.
  

3.4.3  Making your very own GenBank database
============================================
  
  One very cool thing that you can do is set up your own personal
GenBank database and access it like a dictionary (this can be extra cool
because you can also allow access to these local databases over a
network using BioCorba -- see the BioCorba documentation for more
information).
  Making a local database first involves creating an index file, which
will allow quick access to any record in the file. To do this, we use
the index file function:
<<
  >>> from Bio import GenBank
  >>> dict_file = 'cor6_6.gb'
  >>> index_file = 'cor6_6.idx'
  >>> GenBank.index_file(dict_file, index_file)
>>
  
  This will create the file `my_index_file.idx'. Now, we can use this
index to create a dictionary object that allows individual access to
every record. Like the Iterator and NCBIDictionary interfaces, we can
either get back raw records, or we can pass the dictionary a parser that
will parse the records before returning them. In this case, we pass a
`FeatureParser' so that when we get a record, then we retrieve a
SeqRecord object. 
  Setting up the dictionary is as easy as one line:
<<
  >>> gb_dict = GenBank.Dictionary(index_file, GenBank.FeatureParser())
>>
  
  Now we can deal with this like a dictionary. For instance:
<<
  >>> len(gb_dict)
  7
  >>> gb_dict.keys()
  ['L31939', 'AJ237582', 'X62281', 'AF297471', 'M81224', 'X55053']
>>
  
  Finally, we retrieve objects using subscripting:
<<
  >>> gb_dict['AJ237582']
  <Bio.SeqRecord.SeqRecord instance at 0x102fdd8c>
>>
  
  

3.5  Dealing with alignments
*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  It is often very useful to be able to align particular sequences. I do
this quite often to get a quick and dirty idea of relationships between
sequences. Consequently, it is very nice to be able to quickly write up
a python script that does an alignment and gives you back objects that
are easy to work with. The alignment related code in Biopython is meant
to allow python-level access to alignment programs so that you can run
alignments quickly from within scripts.
  

3.5.1  Clustalw
===============
   
  Clustalx (http://www-igbmc.u-strasbg.fr/BioInfo/ClustalX/Top.html) is
a very nice program for doing multiple alignments. Biopython offers
access to alignments in clustal format (these normally have a `*.aln'
extension) that are produced by Clustalx. It also offers access to
clustalw, which the is command line version of clustalx.
  The first step in interacting with clustalw is to set up a command
line you want to pass to the program. Clustalw has a ton of command line
options, and if you set a lot of parameters, you can end up typing in a
huge ol' command line quite a bit. This command line class models the
command line by making all of the options be attributes of the class
that can be set. A few convenience functions also exist to set certain
parameters, so that some error checking on the parameters can be done.
  To create a command line object to do a clustalw multiple alignment we
do the following:
<<
  import os
  from Bio.Clustalw import MultipleAlignCL
  
  cline = MultipleAlignCL(os.path.join(os.curdir, 'opuntia.fasta'))
  cline.set_output('test.aln')
>>
  
  First we import the `MultipleAlignCL' object, which models running a
multiple alignment from clustalw. We then initialize the command line,
with a single argument of the fasta file that we are going to be using
for the alignment. The initialization function also takes an optional
second argument which specifies the location of the `clustalw'
executable. By default, the commandline will just be invoked with
'clustalw,' assuming that you've got it somewhere on your `PATH'.
  The second argument sets the output to go to the file `test.aln'. The
`MultipleAlignCL' object also has numerous other parameters to specify
things like output format, gap costs, etc. 
  We can look at the command line we have generated by invoking the
`__str__' member attribute of the `MultipleAlignCL' class. This is done
by calling `str(cline)' or simple by printing out the command line with
`print cline'. In this case, doing this would give the following output:
<<
  clustalw ./opuntia.fasta -OUTFILE=test.aln
>>
  
  Now that we've set up a simple command line, we now want to run the
commandline and collect the results so we can deal with them. This can
be done using the `do_alignment' function of `Clustalw' as follows:
<<
  from Bio import Clustalw
  
  alignment = Clustalw.do_alignment(cline)
>>
  
  What happens when you run this if that Biopython executes your command
line and runs clustalw with the given parameters. It then grabs the
output, and if it is in a format that Biopython can parse (currently
only clustal format), then it will parse the results and return them as
an alignment object of the appropriate type. So in this case since we
are getting results in the default clustal format, the returned
`alignment' object will be a `ClustalAlignment' type.
  Once we've got this alignment, we can do some interesting things with
it such as get `seq_record' objects for all of the sequences involved in
the alignment:
<<
  all_records = alignment.get_all_seqs()
  
  print 'description:', all_records[0].description
  print 'sequence:', all_records[0].seq
>>
  
  This prints out the description and sequence object for the first
sequence in the alignment:
<<
  description: gi|6273285|gb|AF191659.1|AF191
  sequence:
Seq('TATACATTAAAGAAGGGGGATGCGGATAAATGGAAAGGCGAAAGAAAGAAAAAAATGAAT 
  ...', IUPACAmbiguousDNA())
>>
  
  You can also calculate the maximum length of the alignment with:
<<
  length = alignment.get_alignment_length()
>>
  
  Finally, to write out the alignment object in the original format, we
just need to access the `__str__' function. So doing a `print alignment'
gives:
<<
  CLUSTAL X (1.81) multiple sequence alignment
  
  
  gi|6273285|gb|AF191659.1|AF191     
TATACATTAAAGAAGGGGGATGCGGATAAATGGAAAGGCGAAAGAAAGAA
  gi|6273284|gb|AF191658.1|AF191     
TATACATTAAAGAAGGGGGATGCGGATAAATGGAAAGGCGAAAGAAAGAA
  ...
>>
  
  This makes it easy to write your alignment back into a file with all
of the original info intact.
  If you want to do more interesting things with an alignment, the best
thing to do is to pass the alignment to an alignment information
generating object, such as the SummaryInfo object, described in section
3.5.2.
  

3.5.2  Calculating summary information
======================================
   
  Once you have an alignment, you are very likely going to want to find
out information about it. Instead of trying to have all of the functions
that can generate information about an alignment in the alignment object
itself, we've tried to separate out the functionality into separate
classes, which act on the alignment. 
  Getting ready to calculate summary information about an object is
quick to do. Let's say we've got an alignment object called `alignment'.
All we need to do to get an object that will calculate summary
information is:
<<
  from Bio.Align import AlignInfo
  summary_align = AlignInfo.SummaryInfo(alignment)
>>
  
  The `summary_align' object is very useful, and will do the following
neat things for you:
  
   
 1. Calculate a quick consensus sequence -- see section 3.5.3  
 2. Get a position specific score matrix for the alignment -- see
   section 3.5.4  
 3. Calculate the information content for the alignment -- see section
   3.5.5  
 4. Generate information on substitutions in the alignment -- section
   3.6 details using this to generate a substitution matrix. 
  
  

3.5.3  Calculating a quick consensus sequence
=============================================
   
  The `SummaryInfo' object, described in section 3.5.2, provides
functionality to calculate a quick consensus of an alignment. Assuming
we've got a `SummaryInfo' object called `summary_align' we can calculate
a consensus by doing:
<<
  consensus = summary_align.dumb_consensus()
>>
  
  As the name suggests, this is a really simple consensus calculator,
and will just add up all of the residues at each point in the consensus,
and if the most common value is higher than some threshold value (the
default is .3) will add the common residue to the consensus. If it
doesn't reach the threshold, it adds an ambiguity character to the
consensus. The returned consensus object is Seq object whose alphabet is
inferred from the alphabets of the sequences making up the consensus. So
doing a `print consensus' would give:
<<
  consensus
Seq('TATACATNAAAGNAGGGGGATGCGGATAAATGGAAAGGCGAAAGAAAGAAAAAAATGAAT 
  ...', IUPACAmbiguousDNA())
>>
  
  You can adjust how `dumb_consensus' works by passing optional
parameters:
  
  
 the threshold  This is the threshold specifying how common a particular
   residue has to be at a position before it is added. The default is
   .7.
 
 the ambiguous character  This is the ambiguity character to use. The
   default is 'N'.
 
 the consensus alphabet  This is the alphabet to use for the consensus
   sequence. If an alphabet is not specified than we will try to guess
   the alphabet based on the alphabets of the sequences in the
   alignment. 
  
  

3.5.4  Position Specific Score Matrices
=======================================
   
  Position specific score matrices (PSSMs) summarize the alignment
information in a different way than a consensus, and may be useful for
different tasks. Basically, a PSSM is a count matrix. For each column in
the alignment, the number of each alphabet letters is counted and
totaled. The totals are displayed relative to some representative
sequence along the left axis. This sequence may be the consesus
sequence, but can also be any sequence in the alignment. For instance
for the alignment:
<<
  GTATC
  AT--C
  CTGTC
>>
  
  the PSSM for this alignment is:
<<
        G A T C
      G 1 1 0 1
      T 0 0 3 0
      A 1 1 0 0
      T 0 0 2 0
      C 0 0 0 3
>>
  
  Let's assume we've got an alignment object called `c_align'. To get a
PSSM with the consensus sequence along the side we first get a summary
object and calculate the consensus sequence:
<<
  summary_align = AlignInfo.SummaryInfo(c_align)
  consensus = summary_align.dumb_consensus()
>>
  
  Now, we want to make the PSSM, but ignore any `N' ambiguity residues
when calculating this:
<<
  my_pssm = summary_align.pos_specific_score_matrix(consensus,
                                                    chars_to_ignore =
['N'])
>>
  
  Two notes should be made about this:
  
   
 1. To maintain strictness with the alphabets, you can only include
   characters along the top of the PSSM that are in the alphabet of the
   alignment object. Gaps are not included along the top axis of the
   PSSM.
 
 2. The sequence passed to be displayed along the left side of the axis
   does not need to be the consensus. For instance, if you wanted to
   display the second sequence in the alignment along this axis, you
   would need to do:
   <<
     second_seq = alignment.get_seq_by_num(1)
     my_pssm = summary_align.pos_specific_score_matrix(second_seq
                                                       chars_to_ignore =
   ['N'])
   >>
  
  The command above returns a `PSSM' object. To print out the PSSM as we
showed above, we simply need to do a `print my_pssm', which gives:
<<
      A   C   G   T
  T  0.0 0.0 0.0 7.0
  A  7.0 0.0 0.0 0.0
  T  0.0 0.0 0.0 7.0
  A  7.0 0.0 0.0 0.0
  C  0.0 7.0 0.0 0.0
  A  7.0 0.0 0.0 0.0
  T  0.0 0.0 0.0 7.0
  T  1.0 0.0 0.0 6.0
  ...
>>
  
  You can access any element of the PSSM by subscripting like
`your_pssm[sequence_number][residue_count_name]'. For instance, to get
the counts for the 'A' residue in the second element of the above PSSM
you would do:
<<
  >>> print my_pssm[1]['A']
  7.0
>>
  
  The structure of the PSSM class hopefully makes it easy both to access
elements and to pretty print the matrix.
  

3.5.5  Information Content
==========================
   
  A potentially useful measure of evolutionary conservation is the
information ceontent of a sequence.
  A useful introduction to information theory targetted towards
molecular biologists can be found at
http://www.lecb.ncifcrf.gov/~toms/paper/primer/. For our purposes, we
will be looking at the information content of a consesus sequence, or a
portion of a consensus sequence. We calculate information content at a
particular column in a multiple sequence alignment using the following
formula:
                             N                   
                                           P     
                              a                  
                       IC    --  P          ij   
                           = \       * log(---)  
                         j   /    ij       Q     
                             --                  
                             i=1            i    
  
  where:
  
   
 - IC_j -- The information content for the jth column in an alignment.  
 - N_a -- The number of letters in the alphabet.  
 - P_ij -- The frequency of a particular letter in the column (i. e. if
   G occured 3 out of 6 times in an aligment column, this would be 0.5) 
   
 - Q_i -- The expected frequency of a letter. This is an  optional
   argument, usage of which is left at the user's  discretion. By
   default, it is automatically assigned to 0.05 for a  protein
   alphabet, and 0.25 for a nucleic acid alphabet. This is for  geting
   the information content without any assumption of prior 
   distribtions. When assuming priors, or when using a non-standard 
   alphabet, user should supply the values for Q_i.  
  
  Well, now that we have an idea what information content is being
calculated in Biopython, let's look at how to get it for a particular
region of the alignment.
  First, we need to use our alignment to get a alignment summary object,
which we'll assume is called `summary_align' (see section 3.5.2) for
instructions on how to get this. Once we've got this object, calculating
the information content for a region is as easy as:
<<
  info_content = summary_align.information_content(5, 30, 
                                                   chars_to_ignore =
['N'])
>>
  
  Wow, that was much easier then the formula above made it look! The
variable `info_content' now contains a float value specifying the
information content over the specified region (from 5 to 30 of the
alignment). We specifically ignore the ambiguity residue 'N' when
calculating the information content, since this value is not included in
our alphabet (so we shouldn't be interested in looking at it!).
  As mentioned above, we can also calculate relative information content
by supplying the expected frequencies:
<<
  expect_freq = {
      'A' : .3,
      'G' : .2,
      'T' : .3,
      'C' : .2}
>>
  
  The expected should not be passed as a raw dictionary, but instead by
passed as a `SubsMat.FreqTable' object (see section 4.4.2 for more
information about FreqTables). The FreqTable object provides a standard
for associating the dictionary with an Alphabet, similar to how the
Biopython Seq class works. 
  To create a FreqTable object, from the frequency dictionary you just
need to do:
<<
  from Bio.Alphabet import IUPAC
  from Bio.SubsMat import FreqTable
  
  e_freq_table = FreqTable.FreqTable(expect_freq, FreqTable.FREQ,
                                     IUPAC.unambigous_dna)
>>
  
  Now that we've got that, calculating the relative information content
for our region of the alignment is as simple as:
<<
  info_content = summary_align.information_content(5, 30,
                                                   e_freq_table =
e_freq_table,
                                                   chars_to_ignore =
['N'])
>>
  
  Now, `info_content' will contain the relative information content over
the region in relation to the expected frequencies.
  The value return is calculated using base 2 as the logarithm base in
the formula above. You can modify this by passing the parameter
`log_base' as the base you want:
<<
  info_content = summary_align.information_content(5, 30, log_base = 10
                                                   chars_to_ignore =
['N'])
>>
  
  Well, now you are ready to calculate information content. If you want
to try applying this to some real life problems, it would probably be
best to dig into the literature on information content to get an idea of
how it is used. Hopefully your digging won't reveal any mistakes made in
coding this function!
  

3.5.6  Translating between Alignment formats
============================================
   
  One thing that you always end up having to do is convert between
different formats. Biopython does this using a FormatConverter class for
alignment objects. First, let's say we have just parsed an alignment
from clustal format into a `ClustalAlignment' object:
<<
  import os
  from Bio import Clustalw
  
  alignment = Clustalw.parse_file(os.path.join(os.curdir, 'test.aln'))
>>
  
  Now, let's convert this alignment into FASTA format. First, we create
a converter object:
<<
  from Bio.Align.FormatConvert import FormatConverter
  
  converter = FormatConverter(alignment)
>>
  
  We pass the converter the alignment that we want to convert. Now, to
get this in FASTA alignment format, we simply do the following:
<<
  fasta_align = converter.to_fasta()
>>
  
  Looking at the newly created `fasta_align' object using `print
fasta_align' gives:
<<
  >gi|6273285|gb|AF191659.1|AF191
  TATACATTAAAGAAGGGGGATGCGGATAAATGGAAAGGCGAAAGAAAGAATATATA----
  ------ATATATTTCAAATTTCCTTATATACCCAAATATAAAAATATCTAATAAATTAGA
  ...
>>
  
  The conversion process will, of course, lose information specific to a
particular alignment format. Howerver, most of the basic information
about the alignment will be retained.
  As more formats are added the converter will be beefed up to read and
write all of these different formats.
  

3.6  Substitution Matrices
*=*=*=*=*=*=*=*=*=*=*=*=*=

   
  Substitution matrices are an extremely important part of everyday
bioinformatics work. They provide the scoring terms for classifying how
likely two different residues are to substitute for each other. This is
essential in doing sequence comparisons. The book ``Biological Sequence
Analysis'' by Durbin et al. provides a really nice introduction to
Substitution Matrices and their uses. Some famous substitution matrices
are the PAM and BLOSUM series of matrices.
  Biopython provides a ton of common substitution matrices, and also
provides functionality for creating your own substitution matrices.
  

3.6.1  Using common substitution matrices
=========================================
  
  

3.6.2  Creating your own substitution matrix from an alignment
==============================================================
   
  A very cool thing that you can do easily with the substitution matrix
classes is to create your own substitution matrix from an alignment. In
practice, this is normally done with protein alignments. In this
example, we'll first get a biopython alignment object and then get a
summary object to calculate info about the alignment:
<<
  from Bio import Clustalw
  from Bio.Alphabet import IUPAC
  from Bio.Align import AlignInfo
  
  # get an alignment object from a Clustalw alignment output
  c_align = Clustalw.parse_file('protein.aln', IUPAC.protein)
  summary_align = AlignInfo.SummaryInfo(c_align)
>>
  
  Sections 3.5.1 and 3.5.2 contain more information on doing this.
  Now that we've got our `summary_align' object, we want to use it to
find out the number of times different residues substitute for each
other. To make the example more readable, we'll focus on only amino
acids with polar charged side chains. Luckily, this can be done easily 
when generating a replacement dictionary, by passing in all of the
characters that should be ignored. Thus we'll create a dictionary of
replacements for only charged polar amino acids using:
<<
  replace_info = summary_align.replacement_dictionary(["G", "A", "V",
"L", "I",
                                                       "M", "P", "F",
"W", "S",
                                                       "T", "N", "Q",
"Y", "C"])
>>
  
  This information about amino acid replacements is represented as a
python dictionary which will look something like:
<<
  {('R', 'R'): 2079.0, ('R', 'H'): 17.0, ('R', 'K'): 103.0, ('R', 'E'):
2.0, 
  ('R', 'D'): 2.0, ('H', 'R'): 0, ('D', 'H'): 15.0, ('K', 'K'): 3218.0, 
  ('K', 'H'): 24.0, ('H', 'K'): 8.0, ('E', 'H'): 15.0, ('H', 'H'):
1235.0, 
  ('H', 'E'): 18.0, ('H', 'D'): 0, ('K', 'D'): 0, ('K', 'E'): 9.0, 
  ('D', 'R'): 48.0, ('E', 'R'): 2.0, ('D', 'K'): 1.0, ('E', 'K'): 45.0, 
  ('K', 'R'): 130.0, ('E', 'D'): 241.0, ('E', 'E'): 3305.0, 
  ('D', 'E'): 270.0, ('D', 'D'): 2360.0}
>>
  
  This information gives us our accepted number of replacements, or how
often we expect different things to substitute for each other. It turns
out, amazingly enough, that this is all of the information we need to go
ahead and create a substitution matrix. First, we use the replacement
dictionary information to create an Accepted Replacement Matrix (ARM):
<<
  from Bio import SubsMat
  my_arm = SubsMat.SeqMat(replace_info)
>>
  
  With this accepted replacement matrix, we can go right ahead and
create our log odds matrix (i. e. a standard type Substitution Matrix):
<<
  my_lom = SubsMat.make_log_odds_matrix(my_arm)
>>
  
  The log odds matrix you create is customizable with the following
optional arguments:
  
   
 - `exp_freq_table' -- You can pass a table of expected  frequencies for
   each alphabet. If supplied, this will be used  instead of the passed
   accepted replacement matrix when calculate  expected replacments.
 
 - `logbase' - The base of the logarithm taken to create the  log odd
   matrix. Defaults to base 10.
 
 - `factor' - The factor to multiply each matrix entry  by. This
   defaults to 10, which normally makes the matrix numbers  easy to work
   with.
 
 - `round_digit' - The digit to round to in the matrix. This  defaults
   to 0 (i. e. no digits).
  
  Once you've got your log odds matrix, you can display it prettily
using the function `print_mat'. Doing this on our created matrix gives:
<<
  >>> my_lom.print_mat()
  D   6
  E  -5   5
  H -15 -13  10
  K -31 -15 -13   6
  R -13 -25 -14  -7   7
     D   E   H   K   R
>>
  
  Very nice. Now we've got our very own substitution matrix to play
with!
  

3.7  More Advanced Sequence Classes -- Sequence IDs and Features
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

   
  You read all about the basic Biopython sequence class in section 2.2,
which described how to do many useful things with just the sequence.
Howerver, many times sequences have important additional properties
associated with them. This section described how Biopython handles these
higher level descriptions of a sequence.
  

3.7.1  Sequence ids and Descriptions -- dealing with SeqRecords
===============================================================
  
  Immediately above the Sequence class is the SeqRecord class, defined
in the `Bio.SeqRecord' module. This class allows higher level features
such as ids and features to be associated with the sequence. The class
itself is very simple, and offers the following information as
attributes:
  
   
 seq  -- The sequence itself -- A Bio.Seq object
 
 id  -- The primary id used to identify the sequence. In most cases this
   is something like an accession number.
 
 name  -- A ``common'' name/id for the sequence. In some cases this will
   be the same as the accession number, but it could also be a clone
   name. I think of this as being analagous to the LOCUS id in a GenBank
   record.
 
 description  -- A human readible description or expressive name for the
   sequence. This is similar to what follows the id information in a
   FASTA formatted entry.
 
 annotations  -- A dictionary of additional information about the
   sequence. The keys are the name of the information, and the
   information is contained in the value. This allows the addition of
   more ``unstructed'' information to the sequence.
 
 features  -- A list of SeqFeature objects with more structured
   information about the features on a sequence. The structure of
   SeqFeatures is described below in section 3.7.2. 
  
  Using a SeqRecord class is not very complicated, since all of the
information is stored as attributes of the class. Initializing the class
just involves passing a Seq object to the SeqRecord:
<<
  >>> from Bio.Seq import Seq
  >>> simple_seq = Seq("GATC")
  >>> from Bio.SeqRecord import SeqRecord
  >>> simple_seq_r = SeqRecord(simple_seq)
>>
  
  Additionally, you can also pass the id, name and description to the
initialization function, but if not they will be set as strings
indicating they are unknown, and can be modified subsequently:
<<
  >>> simple_seq_r.id
  '<unknown id>'
  >>> simple_seq_r.id = 'AC12345'
  >>> simple_seq_r.description = 'My little made up sequence I wish I
could 
  write a paper about and submit to GenBank'
  >>> print simple_seq_r.description
  My little made up sequence I wish I could write a paper about and
submit 
  to GenBank
  >>> simple_seq_r.seq
  Seq('GATC', Alphabet())
>>
  
  Adding annotations is almost as easy, and just involves dealing
directly with the annotation dictionary:
<<
  >>> simple_seq_r.annotations['evidence'] = 'None. I just made it up.'
  >>> print simple_seq_r.annotations
  {'evidence': 'None. I just made it up.'}
>>
  
  That's just about all there is to it! Next, you may want to learn
about SeqFeatures, which offer an additional structured way to represent
information about a sequence.
  

3.7.2  Features and Annotations -- SeqFeatures
==============================================
   
  Sequence features are an essential part of describing a sequence. Once
you get beyond the sequence itself, you need some way to organize and
easily get at the more ``abstract'' information that is known about the
sequence. While it is probably impossible to develop a general sequence
feature class that will cover everything, the Biopython SeqFeature class
attempts to encapsulate as much of the information about the sequence as
possible. The design is heavily based on the GenBank/EMBL feature
tables, so if you understand how they look, you'll probably have an
easier time grasping the structure of the Biopython classes.
  

3.7.2.1  SeqFeatures themselves
-------------------------------
  
  The first level of dealing with Sequence features is the SeqFeature
class itself. This class has a number of attributes, so first we'll list
them and there general features, and then work through an example to
show how this applies to a real life example, a GenBank feature table.
The attributes of a SeqFeature are:
  
   
 location  -- The location of the SeqFeature on the sequence that you
   are dealing with. The locations end-points may be fuzzy -- section
   3.7.2.2 has a lot more description on how to deal with descriptions.
 
 type  -- This is a textual description of the type of feature (for
   instance, this will be something like 'CDS' or 'gene').
 
 ref  -- A reference to a different sequence. Some times features may be
   ``on'' a particular sequence, but may need to refer to a different
   sequence, and this provides the reference (normally an accession
   number). A good example of this is a genomic sequence that has most
   of a coding sequence, but one of the exons is on a different
   accession. In this case, the feature would need to refer to this
   different accession for this missing exon.
 
 ref_db  -- This works along with `ref' to provide a cross sequence
   reference. If there is a reference, `ref_db' will be set as None if
   the reference is in the same database, and will be set to the name of
   the database otherwise.
 
 strand  -- The strand on the sequence that the feature is located on.
   This may either be '1' for the top strand, '-1' for the bottom
   strand, or '0' for both strands (or if it doesn't matter). Keep in
   mind that this only really makes sense for double stranded DNA, and
   not for proteins or RNA. 
 
 qualifiers  -- This is a python dictionary of additional information
   about the feature. The key is some kind of terse one-word description
   of what the information contained in the value is about, and the
   value is the actual information. For example, a common key for a
   qualifier might be ``evidence'' and the value might be
   ``computational (non-experimental).'' This is just a way to let the
   person who is looking at the feature know that it has not be
   experimentally (i. e. in a wet lab) confirmed.
 
 sub_features  -- A very important feature of a feature is that it can
   have additional `sub_features' underneath it. This allows nesting of
   features, and helps us to deal with things such as the GenBank/EMBL
   feature lines in a (we hope) intuitive way. 
  
  To show an example of SeqFeatures in action, let's take a look at the
following feature from a GenBank feature table:
<<
       mRNA            complement(join(<49223..49300,49780..>50208))
                       /gene="F28B23.12"
>>
  
  To look at the easiest attributes of the SeqFeature first, if you got
a SeqFeature object for this it would have it `type' of 'mRNA', a
`strand' of -1 (due to the 'complement'), and would have None for the
`ref' and `ref_db' since there are no references to external databases.
The `qualifiers' for this SeqFeature would be a python dictionarary that
looked like `{'gene' : 'F28B23.12'}'.
  Now lets, look at the more tricky part, how the 'join' in the location
 line is handled. First, the location for the top level SeqFeature (the 
one we are dealing with right now) is set as going from  `'<49223' to
'>50208'' (see section 3.7.2.2 for  the nitty gritty on how fuzzy
locations like this are handled).  So the location of the top level
object is the entire span of the  feature. So, how do you get at the
information in the 'join?'  Well, that's where the `sub_features' go in.
  The `sub_features' attribute will have a list with two SeqFeature 
objects in it, and these contain the information in the join. Let's 
look at `top_level_feature.sub_features[0]'; the first  `sub_feature').
This object is a SeqFeature object with a  `type' of '`mRNA_join',' a
`strand' of -1 (inherited  from the parent SeqFeature) and a location
going from  `'<49223' to '49300''. 
  So, the `sub_features' allow you to get at the internal information if
you want it (i. e. if you were trying to get only the exons out of a
genomic sequence), or just to deal with the broad picture (i. e. you
just want to know that the coding sequence for a gene lies in a region).
Hopefully this structuring makes it easy and intuitive to get at the
sometimes complex information that can be contained in a SeqFeature.
  

3.7.2.2  Locations
------------------
   
  In the section on SeqFeatures above, we skipped over one of the more
difficult parts of Features, dealing with the locations. The reason this
can be difficult is because of fuzziness of the positions in locations.
Before we get into all of this, let's just define the vocabulary we'll
use to talk about this. Basically there are two terms we'll use:
  
   
 position  -- This refers to a single position on a sequence,   which
   may be fuzzy or not. For instance, 5, 20, `<100' and   `3^5' are all
   positions.
 
 location  -- A location is two positions that defines a region of a
   sequence. For instance 5..20 (i. e. 5 to 20) is a location. 
  
  I just mention this because sometimes I get confused between the two.
  The complication in dealing with locations comes in the positions
themselves. In biology many times things aren't entirely certain (as
much as us wet lab biologists try to make them certain!). For instance,
you might do a dinucleotide priming experiment and discover that the
start of mRNA transcript starts at one of two sites. This is very useful
information, but the complication comes in how to represent this as a
position. To help us deal with this, we have the concept of fuzzy
positions. Basically there are five types of fuzzy positions, so we have
five classes do deal with them:
  
   
 ExactPosition  -- As its name suggests, this class represents a
   position which is specified as exact along the sequence. This is
   represented as just a a number, and you can get the position by
   looking at the `position' attribute of the object.
 
 BeforePosition  -- This class represents a fuzzy position   that occurs
   prior to some specified site. In GenBank/EMBL notation,   this is
   represented as something like `'<13'', signifying that   the real
   position is located somewhere less then 13. To get   the specified
   upper boundary, look at the `position'   attribute of the object.
 
 AfterPosition  -- Contrary to `BeforePosition', this   class represents
   a position that occurs after some specified site.   This is
   represented in GenBank as `'>13'', and like   `BeforePosition', you
   get the boundary number by looking   at the `position' attribute of
   the object.
 
 WithinPosition  -- This class models a position which occurs somewhere
   between two specified nucleotides. In GenBank/EMBL notation, this
   would be represented as '(1.5)', to represent that the position is
   somewhere within the range 1 to 5. To get the information in this
   class you have to look at two attributes. The `position' attribute
   specifies the lower boundary of the range we are looking at, so in
   our example case this would be one. The `extension' attribute
   specifies the range to the higher boundary, so in this case it would
   be 4. So `object.position' is the lower boundary and `object.position
   + object.extension' is the upper boundary.
 
 BetweenPosition  -- This class deals with a position that   occurs
   between two coordinates. For instance, you might have a   protein
   binding site that occurs between two nucleotides on a   sequence.
   This is represented as `'2^3'', which indicates that   the real
   position happens between position 2 and 3. Getting   this information
   from the object is very similar to   `WithinPosition', the `position'
   attribute specifies   the lower boundary (2, in this case) and the
   `extension'   indicates the range to the higher boundary (1 in this
   case). 
  
  Now that we've got all of the types of fuzzy positions we can have
taken care of, we are ready to actually specify a location on a
sequence. This is handled by the `FeatureLocation' class. An object of
this type basically just holds the potentially fuzzy start and end
positions of a feature. You can create a `FeatureLocation' object by
creating the positions and passing them in:
<<
  >>> from Bio import SeqFeature
  >>> start_pos = SeqFeature.AfterPosition(5)
  >>> end_pos = SeqFeature.BetweenPosition(8, 9)
  >>> my_location = SeqFeature.FeatureLocation(start_pos, end_pos)
>>
  
  If you print out a `FeatureLocation' object, you can get a nice
representation of the information:
<<
  >>> print my_location
  (>5..(8^9))
>>
  
  We can access the fuzzy start and end positions using the start and
end attributes of the location:
<<
  >>> my_location.start
  <Bio.SeqFeature.AfterPosition instance at 0x101d7164>
  >>> print my_location.start
  >5
  >>> print my_location.end
  (8^9)
>>
  
  If you don't want to deal with fuzzy positions and just want numbers,
you just need to ask for the `nofuzzy_start' and `nofuzzy_end'
attributes of the location:
<<
  >>> my_location.nofuzzy_start 
  5
  >>> my_location.nofuzzy_end
  8
>>
  
  Notice that this just gives you back the position attributes of the
fuzzy locations.
  Similary, to make it easy to create a position without worrying about
fuzzy positions, you can just pass in numbers to the `FeaturePosition'
constructors, and you'll get back out `ExactPosition' objects:
<<
  >>> exact_location = SeqFeature.FeatureLocation(5, 8)
  >>> print exact_location
  (5..8)
  >>> exact_location.start
  <Bio.SeqFeature.ExactPosition instance at 0x101dcab4>
>>
  
  That is all of the nitty gritty about dealing with fuzzy positions in
Biopython. It has been designed so that dealing with fuzziness is not
that much more complicated than dealing with exact positions, and
hopefully you find that true!
  

3.7.2.3  References
-------------------
  
  Another common annotation related to a sequence is a reference to a
journal or other published work dealing with the sequence. We have a
fairly simple way of representing a Reference in Biopython -- we have a
`Bio.SeqFeature.Reference' class that stores the relevant information
about a reference as attributes of an object.
  The attributes include things that you would expect to see in a
reference like `journal', `title' and `authors'. Additionally, it also
can hold the `medline_id' and `pubmed_id' and a `comment' about the
reference. These are all accessed simply as attributes of the object.
  A reference also has a `location' object so that it can specify a
particular location on the sequence that the reference refers to. For
instance, you might have a journal that is dealing with a particular
gene located on a BAC, and want to specify that it only refers to this
position exactly. The `location' is a potentially fuzzy location, as
described in section 3.7.2.2.
  That's all there is too it. References are meant to be easy to deal
with, and hopefully general enough to cover lots of usage cases.
  

3.8  BioRegistry -- automatically finding sequence sources
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  A consistently annoying problem in bioinformatics is easily finding a
sequence and making it available to your program. Sequences are
available from a ton of standard locations like NCBI and EMBL. as well
as from non-standard locations such as local databases or web servers.
To make this problem easier, Biopython (as well as the other open-bio
projects) is working towards a standard mechanism to allow specification
of the locations of resources. Once locations are specified, your code
using Biopython can readily retrieve sequences without having to worry
about the specifics of where the sequence came from.
  This transparency of retrieval has a number of advantages for your
code. If a single web service is down (ie. NCBI is too busy and is
refusing connections), backup locations can be tried without having any
effect on the code that you wrote. Similary, you can have local
repositories of sequences that you use often, and then if these
repositories are off-line, switch to a web based service. Third, it
keeps the details of retrieval out of your code, allowing you to focus
on your biological problem, instead of focusing on boring retrieval
details. Finally, it's just a very cool idea.
  This section deals with the specifics of setting up and using this
system of automatically retrieving sequences. The first section deals
with the interoperable configuration file method, while the second talks
about a similar Biopython-specific method. The configuration file method
is definately the way to go, unless you have specific needs it won't
give you.
  

3.8.1  Finding resources using a configuration file
===================================================
  
  

3.8.1.1  Writing a configuration file
-------------------------------------
  
  

3.8.1.2  Sequence retrieval using the configuration file
--------------------------------------------------------
  
  

3.8.2  Finding resources through a biopython specific interface
===============================================================
  
  Biopython has also developed a proprietary mechanism for retrieval
that is Biopython only. This is only a good choice to use if the
standard configuration file system doesn't give you everything you want,
since this method is not compatible with other open-bio projects.
  

3.8.2.1  Retrieving sequences
-----------------------------
  
  By default, Biopython is configured to allow retrieval of sequences
from a number of standard locations. This makes it useable immediately
without knowing much about the system itself. To retrieve a Registry of
databases, all you need to do is:
<<
  >>> from Bio import db
>>
  
  You can readily view all of the different databases that retrieval is
possible be either printing the object and examining them, or
programmatically through the keys() function of object:
<<
  >>> print db
  DBRegistry, exporting 'embl', 'embl-dbfetch-cgi', 'embl-ebi-cgi',
  'embl-fast', 'embl-xembl-cgi', 'interpro-ebi-cgi',
  'nucleotide-dbfetch-cgi', 'nucleotide-genbank-cgi', 'pdb',
  'pdb-ebi-cgi', 'pdb-rcsb-cgi', 'prodoc-expasy-cgi',
  'prosite-expasy-cgi', 'protein-genbank-cgi', 'swissprot',
  'swissprot-expasy-cgi'
  >>> db.keys()
  ['embl-dbfetch-cgi', 'embl-fast', 'embl', 'prosite-expasy-cgi',
  'swissprot-expasy-cgi', 'nucleotide-genbank-cgi', 'pdb-ebi-cgi',
  'interpro-ebi-cgi', 'embl-ebi-cgi', 'embl-xembl-cgi',
  'protein-genbank-cgi', 'pdb', 'prodoc-expasy-cgi',
  'nucleotide-dbfetch-cgi', 'swissprot', 'pdb-rcsb-cgi']
>>
  
  Now, let's say we want to retrieve a swissprot record for one of our
orchid chalcone synthases. First, we get the swissprot connection, then
we retrieve an record of interest:
<<
  >>> sp = db["swissprot"]
  >>> sp
  <Bio.DBRegistry.DBGroup instance at 0x82fdb2c>
  record_handle = sp['O23729']
  >>> print record_handle.read()[:200]
  ID   CHS3_BROFI     STANDARD;      PRT;   394 AA.
  AC   O23729;
  DT   15-JUL-1999 (Rel. 38, Created)
  DT   15-JUL-1999 (Rel. 38, Last sequence update)
  DT   15-JUL-1999 (Rel. 38, Last annotation update)
>>
  
  This retrieval method is nice for a number of reasons. First, we
didn't have to worry about where exactly swissprot records were being
retrieved from -- we only ask for an object that will give us any
swissprot record we can get. Secondly, once we get the swissprot object,
we don't need to worry about how we are getting our sequence -- we just
ask for it by id and don't worry about the implementation details.
  The default biopython database registry object can be used similarly
to retrieve sequences from EMBL, prosite, PDB, interpro, GenBank and
XEMBL.
  

3.8.2.2  Registering and Grouping databases
-------------------------------------------
  
  The basic registry objects are nice in that they provide basic
functionality, but if you have a more advanced system it is nice to be
able to specify new databases. This is a more advanced topic, but is
very possible with the current system. 
  This example describes adding a local CGI script serving out GenBank
(ie. if you had something like a local mirror of GenBank), and then
registering this and the normal NCBI GenBank as a single group to
retrieve from. This would allow you to normally get things from a local
mirror and then switch over to the main GenBank server if your server
goes down, all without adjusting your retrieval code.
  First, we need to describe the CGI script to retrieve from. This
example uses a CGI script, but we eventually hope to handle other
sources such as Applications, databases, or CORBA servers (XXX, should
have an example once this is in place). We describe the CGI script as
follows:
<<
  from Bio.sources import CGI
  local_cgi = CGI(name = "local_cgi",
                  delay = 0.0,
                  cgi = "http://www.myserver.org/cgi-bin/my_local.cgi",
                  url =
"http://www.myserver.org/cgi_documentation.html",
                  doc = "Query a local databases",
                  failure_cases = [])
>>
  
  Now that we have specified the details for connecting to the CGI
script, we are ready to register this CGI script. We just need one more
detail -- specifying what the script returns upon failure to find a
sequence. We do this using Martel regular expressions:
<<
  import Martel
  my_failures = [
       (Martel.Str("Sequence not available"), "No sequence found")]
>>
  
  Now we've got everything we need, and can register the database:
<<
  from Bio import register_db
  register_db(name = "nucleotide-genbank-local",
              key = "uid",
              source = local_cgi,
              failure = my_failures)
>>
  
  This makes the database available as before, so if we print the keys
of the database, we'll see "nucleotide-genbank-local" available. Now
that we've got it registered, we'd like to link all of the genbank
databases together. We do this, using a `group_db' command. First, we
need to create a group named "genbank" to retrieve things from the
database:
<<
  register_db(name = "genbank", behavior = "concurrent")
>>
  
  The `behavior' argument specifies how the group will try to retrieve
things from the various databases registered with it. `concurrent' tells
it to try to retrieve from all databases at once, and then just take
whatever sequence record comes back first. You can also specify `serial'
behavior, in which the retriever will connect to one database at a time
until something gets retrieved.
  Now that we've got the group, we want to register our local GenBank
and the NCBI GenBank with this command:
<<
  group_db("genbank", "nucleotide-genbank-local")
  group_db("genbank", "nucleotide-genbank-cgi")
>>
  
  Now we've got our database access set up, and the database registry
contains our genbank and nucleotide-genbank-local entries:
<<
  ['embl-dbfetch-cgi', 'embl-fast', 'embl', 'prosite-expasy-cgi',
  'swissprot-expasy-cgi', 'nucleotide-genbank-cgi', 'pdb-ebi-cgi',
  'genbank', 'nucleotide-genbank-local', 'interpro-ebi-cgi',
  'embl-ebi-cgi', 'embl-xembl-cgi', 'protein-genbank-cgi', 'pdb',
  'prodoc-expasy-cgi', 'nucleotide-dbfetch-cgi', 'swissprot',
  'pdb-rcsb-cgi']
>>
  
  Cool, now we can add our own databases to the registry and make use of
the simplified retrieval scheme!
  

3.9  BioSQL -- storing sequences in a relational database
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  

3.10  BioCorba
*=*=*=*=*=*=*=

  
  Biocorba does some cool stuff with CORBA. Basically, it allows you to
easily interact with code written in other languages, including Perl and
Java. This is all done through an interface which is very similar to the
standard biopython interface. Much work has been done to make it easy to
use knowing only very little about CORBA. You should check out the
biocorba specific documentation, which describes in detail how to use
it.
  

3.11  Going 3D: The PDB module
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  Biopython also allows you to explore the extensive realm of
macromolecular structure.  Biopython comes with a PDBParser class that
produces a Structure object. The Structure object  can be used to access
the atomic data in the file in a convenient manner. 
  

3.11.1  Structure representation
================================
  
  A macromolecular structure is represented using a structure, model
chain, residue, atom (or SMCRA) hierarchy. Fig. 3.11.1 shows a UML class
diagram of the SMCRA data structure. Such a data structure is not
necessarily best suited for the representation of the macromolecular
content of a structure, but it is absolutely necessary for a good
interpretation of the data present in a file that describes the
structure (typically a PDB or MMCIF file). If this hierarchy cannot
represent the contents of a structure file, it is fairly certain that
the file contains an error or at least does not describe the structure
unambiguously. If a SMCRA data structure cannot be generated, there is
reason to suspect a problem. Parsing a PDB file can thus be used to
detect likely problems. We will give several examples of this in section
3.11.5.1. 
    *images/smcra.png* 
  
  Structure, Model, Chain and Residue are all subclasses of the Entity
base class. The Atom class only (partly) implements the Entity interface
(because an Atom does not have children). 
  For each Entity subclass, you can extract a child by using a unique id
for that child as a key (e.g. you can extract an Atom object from a
Residue object by using an atom name string as a key, you can extract a
Chain object from a Model object by using its chain identifier as a
key). 
  Disordered atoms and residues are represented by DisorderedAtom and
DisorderedResidue classes, which are both subclasses of the
DisorderedEntityWrapper base class. They hide the complexity associated
with disorder and behave exactly as Atom and Residue objects. 
  In general, a child Entity object (i.e. Atom, Residue, Chain, Model)
can be extracted from its parent (i.e. Residue, Chain, Model, Structure,
respectively) by using an id as a key.
<<
  child_entity=parent_entity[child_id]
>>
  
  You can also get a list of all child Entities of a parent Entity
object. Note that this list is sorted in a specific way (e.g. according
to chain identifier for Chain objects in a Model object). 
<<
  child_list=parent_entity.get_list()
>>
  
  You can also get the parent from a child.
<<
  parent_entity=child_entity.get_parent()
>>
  
  At all levels of the SMCRA hierarchy, you can also extract a full id.
The full id is a tuple containing all id's starting from the top object
(Structure) down to the current object. A full id for a Residue object
e.g. is something like: 
<<
  full_id=residue.get_full_id()
  
  print full_id
  
  ("1abc", 0, "A", ("", 10, "A"))
>>
  
  This corresponds to: 
  
  
 - The Structure with id "1abc" 
 - The Model with id 0  
 - The Chain with id "A" 
 - The Residue with id (" ", 10, "A").  
   The Residue id indicates that the residue is not a hetero-residue
(nor a water) because it has a blanc hetero field, that its sequence
identifier is 10 and that its insertion code is "A".
  Some other useful methods:
<<
  # get the entity's id
  
  entity.get_id()
  
  # check if there is a child with a given id
  
  entity.has_id(entity_id)
  
  # get number of children
  
  nr_children=len(entity)
>>
  
  It is possible to delete, rename, add, etc. child entities from a
parent entity, but this does not include any sanity checks (e.g. it is
possible to add two residues with the same id to one chain). This really
should be done via a nice Decorator class that includes integrity
checking, but you can take a look at the code (Entity.py) if you want to
use the raw interface. 
  

3.11.1.1  Structure
-------------------
  
  The Structure object is at the top of the hierarchy. Its id is a user
given string. The Structure contains a number of Model children. Most
crystal structures (but not all) contain a single model, while NMR
structures typically consist of several models. Disorder in crystal
structures of large parts of molecules can also result in several
models. 
3.11.1.1.1  Constructing a Structure object
  
  A Structure object is produced by a PDBParser object:
<<
  from Bio.PDB.PDBParser import PDBParser
  
  p=PDBParser(PERMISSIVE=1)
  
  structure_id="1fat"
  
  filename="pdb1fat.ent"
  
  s=p.get_structure(structure_id, filename)
>>
  
  The PERMISSIVE flag indicates that a number of common problems (see
3.11.5.1) associated with PDB files will be ignored (but note that some
atoms and/or residues will be missing). If the flag is not present a
PDBConstructionException will be generated during the parse operation.
3.11.1.1.2  Header and trailer
  
  You can extract the header and trailer (simple lists of strings) of
the PDB file from the PDBParser object with the get_header and
get_trailer methods.
  

3.11.1.2  Model
---------------
  
  The id of the Model object is an integer, which is derived from the
position of the model in the parsed file (they are automatically
numbered starting from 0). The Model object stores a list of Chain
children. 
3.11.1.2.1  Example
  
  Get the first model from a Structure object.
<<
  first_model=structure[0]
>>
  
  

3.11.1.3  Chain
---------------
  
  The id of a Chain object is derived from the chain identifier in the
structure file, and can be any string. Each Chain in a Model object has
a unique id. The Chain object stores a list of Residue children. 
3.11.1.3.1  Example
  
  Get the Chain object with identifier ``A'' from a Model object.
<<
  chain_A=model["A"]
>>
  
  

3.11.1.4  Residue
-----------------
  
  Unsurprisingly, a Residue object stores a set of Atom children. In
addition, it also contains a string that specifies the residue name
(e.g. ``ASN'') and the segment identifier of the residue (well known to
X-PLOR users, but not used in the construction of the SMCRA data
structure). 
  The id of a Residue object is composed of three parts: the hetero
field (hetfield), the sequence identifier (resseq) and the insertion
code (icode). 
  The hetero field is a string : it is ``W'' for waters, ``H_'' followed
by the residue name (e.g. ``H_FUC'') for other hetero residues and blank
for standard amino and nucleic acids. This scheme is adopted for reasons
described in section 3.11.3.1.
  The second field in the Residue id is the sequence identifier, an
integer describing the position of the residue in the chain.
  The third field is a string, consisting of the insertion code. The
insertion code is sometimes used to preserve a certain desirable residue
numbering scheme. A Ser 80 insertion mutant (inserted e.g. between a Thr
80 and an Asn 81 residue) could e.g. have sequence identifiers and
insertion codes as followed: Thr 80 A, Ser 80 B, Asn 81. In this way the
residue numbering scheme stays in tune with that of the wild type
structure. 
  Let's give some examples. Asn 10 with a blank insertion code would
have residue id ('' '', 10, '' ''). Water 10 would have residue id
(``W``, 10, `` ``). A glucose molecule (a hetero residue with residue
name GLC) with sequence identifier 10 would have residue id (''H_GLC'',
10, '' ''). In this way, the three residues (with the same insertion
code and sequence identifier) can be part of the same chain because
their residue id's are distinct.
  In most cases, the hetflag and insertion code fields will be blank,
e.g. ('' '', 10, '' ''). In these cases, the sequence identifier can be
used as a shortcut for the full id:
<<
  # use full id
  
  res10=chain[("", 10, "")]
  
  # use shortcut 
  
  res10=chain[10]
>>
  
  Each Residue object in a Chain object should have a unique id.
However, disordered residues are dealt with in a special way, as
described in section 3.11.2.3.2.
  A Residue object has a number of additional methods:
<<
  r.get_resname()  # return residue name, e.g. "ASN"
  r.get_segid()  # return the SEGID, e.g. "CHN1"
>>
  
  

3.11.1.5  Atom
--------------
  
  The Atom object stores the data associated with an atom, and has no
children. The id of an atom is its atom name (e.g. ``OG'' for the side
chain oxygen of a Ser residue). An Atom id needs to be unique in a
Residue. Again, an exception is made for disordered atoms, as described
in section 3.11.2.2.
  In a PDB file, an atom name consists of 4 chars, typically with
leading and trailing spaces. Often these spaces can be removed for ease
of use (e.g. an amino acid C alpha  atom is labeled ``.CA.'' in a PDB
file, where the dots represent spaces). To generate an atom name (and
thus an atom id) the spaces are removed, unless this would result in a
name collision in a Residue (i.e. two Atom objects with the same atom
name and id). In the latter case, the atom name including spaces is
tried. This situation can e.g. happen when one residue contains atoms
with names ``.CA.'' and ``CA..'', although this is not very likely. 
  The atomic data stored includes the atom name, the atomic coordinates
(including standard deviation if present), the B factor (including
anisotropic B factors and standard deviation if present), the altloc
specifier and the full atom name including spaces. Less used items like
the atom element number or the atomic charge sometimes specified in a
PDB file are not stored. 
  An Atom object has the following additional methods: 
<<
  a.get_name()       # atom name (spaces stripped, e.g. "CA")
  
  a.get_id()         # id (equals atom name)
  
  a.get_coord()      # atomic coordinates
  
  a.get_bfactor()    # B factor
  
  a.get_occupancy()  # occupancy
  
  a.get_altloc()     # alternative location specifie
  
  a.get_sigatm()     # std. dev. of atomic parameters
  
  a.get_siguij()     # std. dev. of anisotropic B factor
  
  a.get_anisou()     # anisotropic B factor
  
  a.get_fullname()   # atom name (with spaces, e.g. ".CA.")
>>
  
  To represent the atom coordinates, siguij, anisotropic B factor and
sigatm Numpy arrays are used.
  

3.11.2  Disorder
================
  
  

3.11.2.1  General approach
--------------------------
  
  Disorder should be dealt with from two points of view: the atom and
the residue points of view. In general, we have tried to encapsulate all
the complexity that arises from disorder. If you just want to loop over
all C alpha  atoms, you do not care that some residues have a disordered
side chain. On the other hand it should also be possible to represent
disorder completely in the data structure. Therefore, disordered atoms
or residues are stored in special objects that behave as if there is no
disorder. This is done by only representing a subset of the disordered
atoms or residues. Which subset is picked (e.g. which of the two
disordered OG side chain atom positions of a Ser residue is used) can be
specified by the user.
  

3.11.2.2  Disordered atoms
--------------------------
  
  Disordered atoms are represented by ordinary Atom objects, but all
Atom objects that represent the same physical atom are stored in a
DisorderedAtom object. Each Atom object in a DisorderedAtom object can
be uniquely indexed using its altloc specifier. The DisorderedAtom
object forwards all uncaught method calls to the selected Atom object,
by default the one that represents the atom with with the highest
occupancy. The user can of course change the selected Atom object,
making use of its altloc specifier. In this way atom disorder is
represented correctly without much additional complexity. In other
words, if you are not interested in atom disorder, you will not be
bothered by it.
  Each disordered atom has a characteristic altloc identifier. You can
specify that a DisorderedAtom object should behave like the Atom object
associated with a specific altloc identifier:
<<
  atom.disordered\_select("A")  # select altloc A atom
  
  print atom.get_altloc()
  "A"
  
  atom.disordered_select("B")     # select altloc B atom
  print atom.get_altloc()
  "B"
>>
  
  

3.11.2.3  Disordered residues
-----------------------------
  
3.11.2.3.1  Common case
  
  The most common case is a residue that contains one or more disordered
atoms. This is evidently solved by using DisorderedAtom objects to
represent the disordered atoms, and storing the DisorderedAtom object in
a Residue object just like ordinary Atom objects. The DisorderedAtom
will behave exactly like an ordinary atom (in fact the atom with the
highest occupancy) by forwarding all uncaught method calls to one of the
Atom objects (the selected Atom object) it contains. 
3.11.2.3.2  Point mutations
  
  A special case arises when disorder is due to a point mutation, i.e.
when two or more point mutants of a polypeptide are present in the
crystal. An example of this can be found in PDB structure 1EN2. 
  Since these residues belong to a different residue type (e.g. let's
say Ser 60 and Cys 60) they should not be stored in a single Residue
object as in the common case. In this case, each residue is represented
by one Residue object, and both Residue objects are stored in a
DisorderedResidue object. 
  The DisorderedResidue object forwards all uncaught methods to the
selected Residue object (by default the last Residue object added), and
thus behaves like an ordinary residue. Each Residue object in a
DisorderedResidue object can be uniquely identified by its residue name.
In the above example, residue Ser 60 would have id ``SER'' in the
DisorderedResidue object, while residue Cys 60 would have id ``CYS''.
The user can select the active Residue object in a DisorderedResidue
object via this id.
  

3.11.3  Hetero residues
=======================
  
  

3.11.3.1  Associated problems
-----------------------------
  
  A common problem with hetero residues is that several hetero and
non-hetero residues present in the same chain share the same sequence
identifier (and insertion code). Therefore, to generate a unique id for
each hetero residue, waters and other hetero residues are treated in a
different way. 
  Remember that Residue object have the tuple (hetfield, resseq, icode)
as id. The hetfield is blank (`` ``) for amino and nucleic acids, and a
string for waters and other hetero residues. The content of the hetfield
is explained below.
  

3.11.3.2  Water residues
------------------------
  
  The hetfield string of a water residue consists of the letter ``W''.
So a typical residue id for a water is (``W'', 1, `` ``).
  

3.11.3.3  Other hetero residues
-------------------------------
  
  The hetfield string for other hetero residues starts with ``H_''
followed by the residue name. A glucose molecule e.g. with residue name
``GLC'' would have hetfield ``H_GLC''. It's residue id could e.g. be
(``H_GLC'', 1, `` ``).
  

3.11.4  Some random usage examples
==================================
  
  Parse a PDB file, and extract some Model, Chain, Residue and Atom
objects.
<<
  from PDBParser import PDBParser 
  
  parser=PDBParser()
  
  structure=parser.get_structure("test", "1fat.pdb")
  model=structure[0]
  chain=model["A"]
  residue=chain[1]
  atom=residue["CA"]
>>
  
  Extract a hetero residue from a chain (e.g. a glucose (GLC) moiety
with resseq 10).
<<
  residue_id=("H_GLC", 10, " ")
  residue=chain[residue_id]
>>
  
  Print all hetero residues in chain.
<<
  for residue in chain.get_list():
   residue_id=residue.get_id()
   hetfield=residue_id[0]
   if hetfield[0]=="H":
    print residue_id
>>
  
  Print out the coordinates of all CA atoms in a structure with B factor
greater than 50. 
<<
  for model in structure.get_list():
    for chain in model.get_list():
      for residue in chain.get_list():
        if residue.has_id("CA"):
          ca=residue["CA"]
          if ca.get_bfactor()>50.0:
            print ca.get_coord()
>>
  
  Print out all the residues that contain disordered atoms.
<<
  for model in structure.get_list()
    for chain in model.get_list():
      for residue in chain.get_list():
        if residue.is_disordered():
          resseq=residue.get_id()[1]
          resname=residue.get_resname()
          model_id=model.get_id()
          chain_id=chain.get_id()
          print model_id, chain_id, resname, resseq
>>
  
  Loop over all disordered atoms, and select all atoms with altloc A (if
present). This will make sure that the SMCRA data structure will behave
as if only the atoms with altloc A are present. 
<<
  for model in structure.get_list()
    for chain in model.get_list():
      for residue in chain.get_list():
        if residue.is_disordered():
          for atom in residue.get_list():
            if atom.is_disordered():
              if atom.disordered_has_id("A"):
                atom.disordered_select("A")
>>
  
  Suppose that a chain has a point mutation at position 10, consisting
of a Ser and a Cys residue. Make sure that residue 10 of this chain
behaves as the Cys residue.
<<
  residue=chain[10]
  residue.disordered_select("CYS")
>>
  
  

3.11.5  Common problems in PDB files
====================================
  
  

3.11.5.1  Examples
------------------
  
  The PDBParser/Structure class was tested on about 800 structures (each
belonging to a unique SCOP superfamily). This takes about 20 minutes, or
on average 1.5 seconds per structure. Parsing the structure of the large
ribosomal subunit (1FKK), which contains about 64000 atoms, takes 10
seconds on a 1000 MHz PC.
  Three exceptions were generated in cases where an unambiguous data
structure could not be built. In all three cases, the likely cause is an
error in the PDB file that should be corrected. Generating an exception
in these cases  is much better than running the chance of incorrectly
describing the structure in a data structure. 
3.11.5.1.1  Duplicate residues
  
  One structure contains two amino acid residues in one chain with the
same sequence identifier (resseq 3) and icode. Upon inspection it was
found that this chain contains the residues Thr A3, ..., Gly A202, Leu
A3, Glu A204. Clearly, Leu A3 should be Leu A203. A couple of similar
situations exist for structure 1FFK (which e.g. contains Gly B64, Met
B65, Glu B65, Thr B67, i.e. residue Glu B65 should be Glu B66). 
3.11.5.1.2  Duplicate atoms
  
  Structure 1EJG contains a Ser/Pro point mutation in chain A at
position 22. In turn, Ser 22 contains some disordered atoms. As
expected, all atoms belonging to Ser 22 have a non-blank altloc
specifier (B or C). All atoms of Pro 22 have altloc A, except the N atom
which has a blank altloc. This generates an exception, because all atoms
belonging to two residues at a point mutation should have non-blank
altloc. It turns out that this atom is probably shared by Ser and Pro
22, as Ser 22 misses the N atom. Again, this points to a problem in the
file: the N atom should be present in both the Ser and the Pro residue,
in both cases associated with a suitable altloc identifier.
  

3.11.5.2  Automatic correction
------------------------------
  
  Some errors are quite common and can be easily corrected without much
risk of making a wrong interpretation. These cases are listed below.
3.11.5.2.1  A blank altloc for a disordered atom
  
  Normally each disordered atom should have a non-blanc altloc
identifier. However, there are many structures that do not follow this
convention, and have a blank and a non-blank identifier for two
disordered positions of the same atom. This is automatically interpreted
in the right way. 
3.11.5.2.2  Broken chains
  
  Sometimes a structure contains a list of residues belonging to chain
A, followed by residues belonging to chain B, and again followed by
residues belonging to chain A, i.e. the chains are ``broken''. This is
correctly interpreted.
  

3.11.5.3  Fatal errors
----------------------
  
  Sometimes a PDB file cannot be unambiguously interpreted. Rather than
guessing and risking a mistake, an exception is generated, and the user
is expected to correct the PDB file. These cases are listed below.
3.11.5.3.1  Duplicate residues
  
  All residues in a chain should have a unique id. This id is generated
based on:
  
  
 - The sequence identifier (resseq). 
 - The insertion code (icode). 
 - The hetfield string (``W'' for waters and ``H_'' followed by the
   residue name for other hetero residues)  
 - The residue names of the residues in the case of point mutations (to
   store the Residue objects in a DisorderedResidue object). 
   If this does not lead to a unique id something is quite likely wrong,
and an exception is generated.
3.11.5.3.2  Duplicate atoms
  
  All atoms in a residue should have a unique id. This id is generated
based on:
  
  
 - The atom name (without spaces, or with spaces if a problem arises). 
 - The altloc specifier. 
   If this does not lead to a unique id something is quite likely wrong,
and an exception is generated.
  

3.11.6  Other features
======================
  
  There are also some tools to analyze a crystal structure. Tools exist
to superimpose two coordinate sets (SVDSuperimposer), to extract 
polypeptides from a structure (Polypeptide), to perform neighbor lookup
(NeighborSearch) and to write out PDB files (PDBIO). The neighbor lookup
is done using a KD tree module written in C++. It is very fast and also
includes a fast method to find all point pairs within a certain distance
 of each other.
  A Polypeptide object is simply a UserList of Residue objects. You can 
construct a list of Polypeptide objects from a Structure object as
follows:
<<
  model_nr=1
  polypeptide_list=build_peptides(structure, model_nr)
  
  for polypeptide in polypeptide_list:
      print polypeptide
>>
  
  The Polypeptide objects are always created from a single  Model (in
this case model 1).
  

3.12  Miscellaneous
*=*=*=*=*=*=*=*=*=*

  
  

3.12.1  Translating a DNA sequence to Protein
=============================================
  
  

Chapter 4    Advanced
*********************
  
  

4.1  Sequence Class
*=*=*=*=*=*=*=*=*=*

  
  

4.2  Regression Testing Framework
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

   
  Biopython has a regression testing framework written Andrew Dalke and
ported to PyUnit by Brad Chapman which helps us make sure the code is as
bug-free as possible before going out.
  

4.2.1  Writing a Regression Test
================================
  
  Every module that goes into Biopython should have a test (and should
also have documentation!). Let's say you've written a new module called
Biospam -- here is what you should do to make a regression test:
  
   
 1. Write a script called `test_Biospam.py'
 
    
    - This script should live in the Tests directory
    
    - The script should test all of the important functionality of the
      module (the more you test the better your test is, of course!).  
 
 
 2. If the script requires files to do the testing, these should go in 
   the directory Tests/Biospam.
 
 3. Write out the test output and verify the output to be correct.  
   There are two ways to do this:
 
      
    1. The long way:
    
       
       - Run the script and write its output to a file. On UNIX
         machines,  you would do something like: `python test_Biospam.py
         > test_Biospam' which would write the output to the file
         `test_Biospam'.
       
       - Manually look at the file `test_Biospam' to make sure the
         output is correct. When you are sure it is all right and there
         are no bugs, you need to quickly edit the `test_Biospam' file
         so that the first line is: '`test_Biospam'' (no quotes).
       
       - copy the `test_Biospam' file to the directory Tests/output
    
    
    2. The quick way:
    
         
       - Run `python run_tests.py -g test_Biospam.py'. The  regression
         testing framework is nifty enough that it'll put  the output in
         the right place in just the way it likes it. 
       
       - Go to the output (which should be in
         `Tests/output/test_Biospam') and double check the output to
         make sure it is all correct. 
 
 
 4. Now change to the Tests directory and run the regression tests  with
   `python run_tests.py'. This will run all of the tests, and  you
   should see your test run (and pass!).
 
 5. That's it! Now you've got a nice test for your module. 
   Congratulations! 
  
  

4.3  Parser Design
*=*=*=*=*=*=*=*=*=

  
  

4.3.1  Design Overview
======================
  
  Parsers are built around an event-oriented design that includes
Scanner and Consumer objects.
  Scanners take input from a data source and analyze it line by line,
sending off an event whenever it recognizes some information in the
data. For example, if the data includes information about an organism
name, the scanner may generate an `organism_name' event whenever it
encounters a line containing the name.
  Consumers are objects that receive the events generated by Scanners.
Following the previous example, the consumer receives the
`organism_name' event, and the processes it in whatever manner necessary
in the current application.
  

4.3.2  Events
=============
  
  There are two types of events: info events that tag the location of
information within a data stream, and section events that mark sections
within a stream. Info events are associated with specific lines within
the data, while section events are not.
  Section event names must be in the format `start_EVENTNAME' and
`end_EVENTNAME' where `EVENTNAME' is the name of the event.
  For example, a FASTA-formatted sequence scanner may generate the
following events: 
<<
  EVENT NAME      ORIGINAL INPUT
  begin_sequence  
  title           >gi|132871|sp|P19947|RL30_BACSU 50S RIBOSOMAL PROTEIN
L30 (BL27
  sequence       
MAKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRGMINKVSHLVSVKEQ
  end_sequence
  begin_sequence
  title           >gi|132679|sp|P19946|RL15_BACSU 50S RIBOSOMAL PROTEIN
L15
  sequence       
MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGGVRPGFEGGQMPLFQRLPK
  sequence       
RKEYAVVNLDKLNGFAEGTEVTPELLLETGVISKLNAGVKILGNGKLEKKLTVKANKFSASAK
  sequence        GTAEVI
  end_sequence
  [...]
>>
  
  (I cut the lines shorter so they'd look nicer in my editor).
  The FASTA scanner generated the following events: `title', `sequence',
`begin_sequence', and `end_sequence'. Note that the `begin_sequence' and
`end_sequence' events are not associated with any line in the original
input. They are used to delineate separate sequences within the file.
  The events a scanner can send must be specifically defined for each
data format.
  

4.3.3  'noevent' EVENT
======================
  
  A data file can contain lines that have no meaningful information,
such as blank lines. By convention, a scanner should generate the
"noevent" event for these lines.
  

4.3.4  Scanners
===============
  
<<
  class Scanner:
      def feed(self, handle, consumer):
          # Implementation
>>
  
  Scanners should implement a method named 'feed' that takes a file
handle and a consumer. The scanner should read data from the file handle
and generate appropriate events for the consumer.
  

4.3.5  Consumers
================
  
<<
  class Consumer:
      # event handlers
>>
  
  Consumers contain methods that handle events. The name of the method
is the event that it handles. Info events are passed the line of the
data containing the information, and section events are passed nothing.
  You are free to ignore events that are not interesting for your
application. You should just not implement methods for those events.
  All consumers should be derived from the base Consumer class.
  An example:
<<
  class FASTAConsumer(Consumer):
      def title(self, line):
          # do something with the title
      def sequence(self, line):
          # do something with the sequence
      def begin_sequence(self):
          # a new sequence starts
      def end_sequence(self):
          # a sequence ends
>>
  
  

4.3.6  BLAST
============
  
  BLAST Scanners produce the following events:
<<
  header
      version
      reference
      query_info
      database_info
  
  descriptions
      description_header
      round                         psi blast
      model_sequences               psi blast
      nonmodel_sequences            psi blast
      converged                     psi blast
      description
      no_hits
  
  alignment
      multalign                     master-slave
      title                         pairwise
      length                        pairwise
    hsp
      score                         pairwise
      identities                    pairwise
      strand                        pairwise, blastn
      frame                         pairwise, blastx, tblastn, tblastx
      query                         pairwise
      align                         pairwise
      sbjct                         pairwise
  
  database_report
      database
      posted_date
      num_letters_in_database
      num_sequences_in_database
      num_letters_searched          RESERVED.  Currently unused.  I've
never
      num_sequences_searched        RESERVED.  seen it, but it's in
blastool.c..
      ka_params
      gapped                        not blastp
      ka_params_gap                 gapped mode (not tblastx)
  
  parameters
      matrix
      gap_penalties                 gapped mode (not tblastx)
      num_hits                      
      num_sequences                 
      num_extends                   
      num_good_extends              
      num_seqs_better_e
      hsps_no_gap                   gapped (not tblastx) and not blastn
      hsps_prelim_gapped            gapped (not tblastx) and not blastn
      hsps_prelim_gap_attempted     gapped (not tblastx) and not blastn
      hsps_gapped                   gapped (not tblastx) and not blastn
      query_length
      database_length
      effective_hsp_length
      effective_query_length
      effective_database_length
      effective_search_space
      effective_search_space_used
      frameshift                    blastx or tblastn or tblastx
      threshold
      window_size
      dropoff_1st_pass
      gap_x_dropoff
      gap_x_dropoff_final           gapped (not tblastx) and not blastn
      gap_trigger
      blast_cutoff
>>
  
  

4.3.7  Enzyme
=============
   The Enzyme Scanner produces the following events: 
<<
  record
      identification
      description
      alternate_name
      catalytic_activity
      cofactor
      comment
      disease
      prosite_reference
      databank_reference
      terminator
>>
  
  

4.3.8  Fasta
============
   The Fasta Scanner produces the following events: 
<<
  sequence
      title
      sequence
>>
  
  

4.3.9  Medline
==============
   The Online Services Reference Manual documents the MEDLINE format at:
http://www.nlm.nih.gov/pubs/osrm_nlm.html
  The Medline scanner produces the following events: 
<<
  record
      undefined
      abstract_author
      abstract
      address
      author
      call_number
      comments
      class_update_date
      country
      entry_date
      publication_date
      english_abstract
      entry_month
      gene_symbol
      identification
      issue_part_supplement
      issn
      journal_title_code
      language
      special_list
      last_revision_date
      mesh_heading
      mesh_tree_number
      major_revision_date
      no_author
      substance_name
      pagination
      personal_name_as_subject
      publication_type
      number_of_references
      cas_registry_number
      record_originator
      journal_subset
      subheadings
      secondary_source_id
      source
      title_abbreviation
      title
      transliterated_title
      unique_identifier
      volume_issue
      year
      pubmed_id
>>
  
  undefined is a special event that is called for every line with a
qualifier not defined in the specification.
  

4.3.10  Prosite
===============
   The Prosite scanner produces the following events: 
<<
  copyrights
      copyright
  record
      identification
      accession
      date
      description
      pattern
      matrix
      rule
      numerical_results
      comment
      database_reference
      pdb_reference
      documentation
      terminator
>>
  
  The PRODOC scanner produces the following events: 
<<
  record
      accession
      prosite_reference
      text
      reference
>>
  
  

4.3.11  SWISS-PROT
==================
   The SProt Scanner produces the following events: 
<<
  record
      identification
      accession
      date
      description
      gene_name
      organism_species
      organelle
      organism_classification
      reference_number
      reference_position
      reference_comment
      reference_cross_reference
      reference_author
      reference_title
      reference_location
      comment
      database_cross_reference
      keyword
      feature_table
      sequence_header
      sequence_data
      terminator
>>
  
  The KeyWList scanner produces the following events: 
<<
  header
  keywords
      keyword
  footer
      copyright
>>
  
  

4.4  Substitution Matrices
*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  

4.4.1  SubsMat
==============
  
  This module provides a class and a few routines for generating
substitution matrices, similar to BLOSUM or PAM matrices, but based on
user-provided data.
  Additionally, you may select a matrix from MatrixInfo.py, a collection
of established substitution matrices.
<<
  class SeqMat(UserDict.UserDict)
>>
  
  
   
 1. Attributes
 
      
    1. `self.data': a dictionary in the form of `{(i1,j1):n1,
      (i1,j2):n2,...,(ik,jk):nk}' where i, j are alphabet letters, and n
      is a value.
    
    2. `self.alphabet': a class as defined in Bio.Alphabet
    
    3. `self.ab_list': a list of the alphabet's letters, sorted. Needed
      mainly for internal purposes
    
    4. `self.sum_letters': a dictionary. `{i1: s1, i2: s2,...,in:sn}'
      where:  
         
       1. i: an alphabet letter;   
       2. s: sum of all values in a half-matrix for that letter;   
       3. n: number of letters in alphabet.  
      
 
 
 2. Methods
 
    
    1. 
      << 
        __init__(self,data=None,alphabet=None,
                 mat_type=NOTYPE,mat_name='',build_later=0):
      >>
    
     
       
       1. `data': can be either a dictionary, or another SeqMat
         instance.  
       2. `alphabet': a Bio.Alphabet instance. If not provided,
         construct an alphabet from data.
       
       3. `mat_type': type of matrix generated. One of the following:
       
            
          NOTYPE  No type defined  
          ACCREP  Accepted Replacements Matrix  
          OBSFREQ  Observed Frequency Matrix   
          EXPFREQ  Expsected Frequency Matrix  
          SUBS  Substitution Matrix   
          LO  Log Odds Matrix  
       
       `mat_type' is provided automatically by some of SubsMat's
         functions.
       
       4. `mat_name': matrix name, such as "BLOSUM62" or "PAM250"
       
       5. `build_later': default false. If true, user may supply only
         alphabet and empty dictionary, if intending to build the matrix
         later. this skips the sanity check of alphabet size vs. matrix
         size. 
    
    
    2. 
      <<
        entropy(self,obs_freq_mat)
      >>
    
     
         
       1. `obs_freq_mat': an observed frequency matrix. Returns the
         matrix's entropy, based on the frequency in `obs_freq_mat'. The
         matrix instance should be LO or SUBS.  
    
    
    3. 
      <<
        letter_sum(self,letter)
      >>
    
     Returns the sum of all values in the matrix, for the provided
      `letter'
    
    4. 
      <<
        all_letters_sum(self)
      >>
    Fills the dictionary attribute `self.sum_letters' with the sum of
      values for each letter in the matrix's alphabet.
    
    5. 
      <<
        print_mat(self,f,format="%4d",bottomformat="%4s",alphabet=None)
      >>
    
     prints the matrix to file handle f. `format' is the format field
      for the matrix values; `bottomformat' is the format field for the
      bottom row, containing matrix letters. Example output for a
      3-letter alphabet matrix:
      <<
        A 23
        B 12 34
        C 7  22  27
          A   B   C
      >>
    
     The `alphabet' optional argument is a string of all characters in
      the alphabet. If supplied, the order of letters along the axes is
      taken from the string, rather than by alphabetical order.
 
 
 3. Usage
 The following section is layed out in the order by which most people
   wish to generate a log-odds matrix. Of course, interim matrices can
   be generated and  investigated. Most people just want a log-odds
   matrix, that's all. 
 
    
    1. Generating an Accepted Replacement Matrix
    Initially, you should generate an accepted replacement matrix (ARM)
      from your data. The values in ARM are the counted number of
      replacements according to your data. The data could be a set of
      pairs or multiple alignments. So for instance if Alanine was
      replaced by Cysteine 10 times, and Cysteine by Alanine 12 times,
      the corresponding ARM entries would be: 
      <<
        ('A','C'): 10, ('C','A'): 12 
      >>
    
    as order doesn't matter, user can already provide only one entry: 
      <<
        ('A','C'): 22 
      >>
    
     A SeqMat instance may be initialized with either a full (first
      method of counting: 10, 12) or half (the latter method, 22)
      matrices. A full protein  alphabet matrix would be of the size
      20x20 = 400. A half matrix of that alphabet would be 20x20/2 +
      20/2 = 210. That is because same-letter entries don't  change.
      (The matrix diagonal). Given an alphabet size of N: 
    
         
       1. Full matrix size:N*N 
       
       2. Half matrix size: N(N+1)/2   
    
    The SeqMat constructor automatically generates a half-matrix, if a
      full matrix is passed. If a half matrix is passed, letters in the
      key should be provided in alphabetical order: ('A','C') and not
      ('C',A'). 
    At this point, if all you wish to do is generate a log-odds matrix,
      please go to the section titled Example of Use. The following text
      describes the nitty-gritty of internal functions, to be used by
      people who wish to investigate their nucleotide/amino-acid
      frequency data more thoroughly. 
    
    2. Generating the observed frequency matrix (OFM)
    Use: 
      <<
        OFM = SubsMat._build_obs_freq_mat(ARM)
      >>
    
     The OFM is generated from the ARM, only instead of replacement
      counts, it contains replacement frequencies. 
    
    3. Generating an expected frequency matrix (EFM)
    Use:
      <<
        EFM = SubsMat._build_exp_freq_mat(OFM,exp_freq_table)
      >>
    
     
         
       1. `exp_freq_table': should be a FreqTable instance. See section
         4.4.2 for detailed information on FreqTable. Briefly, the
         expected frequency table has the frequencies of appearance for
         each member of the alphabet. It is  implemented as a dictionary
         with the alphabet letters as keys, and each letter's frequency
         as a value. Values sum to 1.  
    
    The expected frequency table can (and generally should) be generated
      from the observed frequency matrix. So in most cases you will
      generate `exp_freq_table' using:
      <<
        >>> exp_freq_table = SubsMat._exp_freq_table_from_obs_freq(OFM)
        >>> EFM = SubsMat._build_exp_freq_mat(OFM,exp_freq_table)
      >>
    
    But you can supply your own `exp_freq_table', if you wish
    
    4. Generating a substitution frequency matrix (SFM)
    Use:
      <<
        SFM = SubsMat._build_subs_mat(OFM,EFM)
      >>
    
     Accepts an OFM, EFM. Provides the division product of the
      corresponding values. 
    
    5. Generating a log-odds matrix (LOM)
    Use:  
      <<
        LOM=SubsMat._build_log_odds_mat(SFM[,logbase=10,factor=10.0,roun
      d_digit=1])
      >>
    
     
         
       1. Accepts an SFM. 
       
       2. `logbase': base of the logarithm used to generate the log-odds
         values. 
       
       3. `factor': factor used to multiply the log-odds values. Each
         entry is generated by log(LOM[key])*factor And rounded to the
         `round_digit' place after the decimal point, if required.
 
 
 4. Example of use
 As most people would want to generate a log-odds matrix, with minimum
   hassle, SubsMat provides one function which does it all:
   << 
     make_log_odds_matrix(acc_rep_mat,exp_freq_table=None,logbase=10,
                           factor=10.0,round_digit=0):
   >>
 
 
      
    1. `acc_rep_mat': user provided accepted replacements matrix  
    2. `exp_freq_table': expected frequencies table. Used if provided,
      if not, generated from the `acc_rep_mat'.  
    3. `logbase': base of logarithm for the log-odds matrix. Default
      base 10.  
    4. `round_digit': number after decimal digit to which result should
      be rounded. Default zero. 
  
  

4.4.2  FreqTable
================
   
<<
  FreqTable.FreqTable(UserDict.UserDict)
>>
  
  
 
 1. Attributes:
 
      
    1. `alphabet': A Bio.Alphabet instance.
    
    2. `data': frequency dictionary
    
    3. `count': count dictionary (in case counts are provided).  
 
 
 2. Functions:
 
      
    1. `read_count(f)': read a count file from stream f. Then convert to
      frequencies
    
    2. `read_freq(f)': read a frequency data file from stream f. Of
      course, we then don't have the counts, but it is usually the
      letter frquencies which are interesting.
 
 
 3. Example of use:
 The expected count of the residues in the database is sitting in a
   file, whitespace delimited, in the following format (example given
   for a 3-letter alphabet):
   <<
     A   35
     B   65
     C   100
   >>
 
 And will be read using the `FreqTable.read_count(file_handle)'
   function. 
 An equivalent frequency file:
   <<
     A  0.175
     B  0.325
     C  0.5 
   >>
 
 Conversely, the residue frequencies or counts can be passed as a
   dictionary.  Example of a count dictionary (3-letter alphabet):
   <<
     {'A': 35, 'B': 65, 'C': 100}
   >>
 
 Which means that an expected data count would give a 0.5 frequency  for
   'C', a 0.325 probability of 'B' and a 0.175 probability of 'A'  out
   of 200 total, sum of A, B and C)
 A frequency dictionary for the same data would be:
   <<
     {'A': 0.175, 'B': 0.325, 'C': 0.5}
   >>
 
 Summing up to 1.
 When passing a dictionary as an argument, you should indicate whether
   it is a count or a frequency dictionary. Therefore the FreqTable
   class constructor requires two arguments: the dictionary itself, and
   FreqTable.COUNT or FreqTable.FREQ indicating counts or frequencies,
   respectively.
 Read expected counts. readCount will already generate the frequencies
   Any one of the following may be done to geerate the frequency table
   (ftab):
   <<
     >>> from SubsMat import *
     >>> ftab =
   FreqTable.FreqTable(my_frequency_dictionary,FreqTable.FREQ)
     >>> ftab = FreqTable.FreqTable(my_count_dictionary,FreqTable.COUNT)
     >>> ftab = FreqTable.read_count(open('myCountFile'))
     >>> ftab = FreqTable.read_frequency(open('myFrequencyFile'))
   >>
  
  

Chapter 5    Where to go from here -- contributing to Biopython
***************************************************************
  
  

5.1  Maintaining a distribution for a platform
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

   
  We try to release Biopython to make it as easy to install as possible
for users. Thus, we try to provide the Biopython libraries in as many
install formats as we can. Doing this from release to release can be a
lot of work for developers, and sometimes requires them to maintain
packages they are not all that familiar with. This section is meant to
provide tips to encourage other people besides developers to maintain
platform builds.
  In general, this is fairly easy -- all you would need to do is produce
the system specific package whenever we make a release. You should then
check the package (of course!) to make sure it installs everything
properly. Then you just send it to one of the main developers, they
stick the package on the web site and just like that, you've contributed
to Biopython! Snazzy.
  Below are some tips for certain platforms to maybe get people started
with helping out:
  
   
 RPMs  -- RPMs are pretty popular package systems on some platforms.
   There is lots of documentation on RPMs available at
   http://www.rpm.org to help you get started with them. To create an
   RPM for your platform is really easy. You just need to be able to
   build the package from source (having a C compiler that works is thus
   essential) -- see the Biopython installation instructions for more
   info on this.
 To make the RPM, you just need to do:
   <<
     python setup.py bdist_rpm
   >>
 
 This will create an RPM for your specific platform and a source RPM in
   the directory `dist'. This RPM should be good and ready to go, so
   this is all you need to do! Nice and easy.
 
 Windows  -- Windows products typically have a nice graphical installer
   that installs all of the essential components in the right place. We
   can use Disttutils to create a installer of this type fairly easily.
 You must first make sure you have a C compiler on your Windows
   computer, and that you can compile and install things (see the
   Biopython installation instructions for info on how to do this).
 Once you are setup with a C compiler, making the installer just
   requires doing:
   <<
     python setup.py bdist_wininst
   >>
 
 Now you've got a Windows installer. Congrats!
 
 Macintosh  -- We would love to find someone who wants to maintain a
   Macintosh distribution, and make it available in a Macintosh friendly
   format like bin-hex. This would basically include finding a way to
   compile everything on the Mac, making sure all of the code written by
   us UNIX-based developers works well on the Mac, and providing any
   Mac-friendly hints for us.
  
  Once you've got a package, please test it on your system to make sure
it installs everything in a good way and seems to work properly. Once
you feel good about it, send it off to one of the biopython developers
(write to our main list serve at biopython@biopython.org if you're not
sure who to send it to) and you've done it. Thanks!
  

5.2  Bug Reports + Feature Requests
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  Getting feedback on the Biopython modules is very important to us.
Open-source projects like this benefit greatly from feedback,
bug-reports (and patches!) from a wide variety of contributors.
  The main forums for discussing feature requests and potential bugs are
the biopython development lists:
  
   
 - biopython@biopython.org -- An unmoderated list for discussion of
   anything to do with biopython.
 
 - biopython-dev@biopython.org -- A more development oriented list that
   is mainly used by developers (but anyone is free to contribute!). 
  
  Additionally, if you think you've found a bug, you can submit it to
our bug-tracking page at http://bugzilla.open-bio.org/. This  way, it
won't get buried in anyone's Inbox and forgotten about.
  

5.3  Contributing Code
*=*=*=*=*=*=*=*=*=*=*=

  
  There are no barriers to joining biopython code development other than
an interest in creating biology-related code in python. The best place
to express an interest is on the biopython mailing lists -- just let us
know you are interested in coding and what kind of stuff you want to
work on. Normally, we try to have some discussion on modules before
coding them, since that helps generate good ideas -- then just feel free
to jump right in and start coding!
  The main biopython release tries to be fairly uniform and
interworkable, to make it easier for users. You can read about some of
(fairly informal) coding style guidelines we try to use in biopython in
the contributing documentation at 
http://www.biopython.org/docs/developer/contrib.html. We also try to add
code to the distribution along with tests (see section 4.2 for more info
on the regression testing framework) and documentation, so that
everything can stay as workable and well documented as possible. This
is, of course, the most ideal situation, under many situations you'll be
able to find other people on the list who will be willing to help add
documentation or more tests for your code once you make it available.
So, to end this paragraph like the last, feel free to start working!
  Additionally, if you have code that you don't think fits in the
distribution, but that you want to make available, we maintain Script
Central (http://www.biopython.org/scriptcentral/)  which has pointers to
freely available code in python for bioinformatics.
  Hopefully this documentation has got you excited enough about
biopython to try it out (and most importantly, contribute!). Thanks for
reading all the way through!
  

Chapter 6    Appendix: Useful stuff about Python
************************************************
   
  If you haven't spent a lot of time programming in python, many
questions and problems that come up in using Biopython are often related
to python itself. This section tries to present some ideas and  code
that come up often (at least for us!) while using the Biopython
libraries. If you have any suggestions for useful pointers that could go
here, please contribute!
  

6.1  What the heck in a handle?
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

   
  Handles are mentioned quite frequently throughout this documentation,
and are also fairly confusing (at least to me!). Basically, you can
think of a handle as being a ``wrapper'' around text information.
  Handles provide (at least) two benefits over plain text information:
  
   
 1. They provide a standard way to deal with information stored in  
   different ways. The text information can be in a file, or in a 
   string stored in memory, or at some remote website, but the handle 
   provides a common way of dealing with information in all of these 
   formats. 
 
 2. They allow text information to be read incrementally, instead  of
   all at once. This is really important when you are dealing with  huge
   text files which would use up all of your memory if you had to  load
   them all. 
  
  Handles can deal with text information that is being read (i. e.
reading  from a file) or written (i. e. writing information to a file).
In the case of a ``read'' handle, commonly used functions are `read()',
which reads the entire text information from the handle, and
`readline()', which reads information one line at a time. For ``write''
handles, the function `write()' is regularly used.
  The most common usage for handles is reading information from a file,
which is done using the built-in python function `open':
<<
  >>> handle = open("m_cold.fasta", "r")
  >>> handle.readline()
  ">gi|8332116|gb|BE037100.1|BE037100 MP14H09 MP Mesembryanthemum
crystallinum cDNA 5' similar to cold acclimation protein, mRNA
sequence\n"
>>
  
  Handles are regularly used in Biopython for passing information to
parsers.
  

6.1.1  Creating a handle from a string
======================================
  
  One useful thing is to be able to turn information contained in a
string into a handle. The following example shows how to do this using 
`cStringIO' from the Python standard library:
<<
  >>> my_info = 'A string\n with multiple lines.'
  >>> print my_info
  A string
   with multiple lines.
  >>> import cStringIO
  >>> my_info_handle = cStringIO.StringIO(my_info)
  >>> first_line = my_info_handle.readline()
  >>> print first_line
  A string
  
  >>> second_line = my_info_handle.readline()
  >>> print second_line
   with multiple lines.
>>
  
-----------------------------------------------------------------------
  
   
              This document was translated from LaTeX by HeVeA
              (http://pauillac.inria.fr/~maranget/hevea/index.html). 
