
                                  twofeat 



Function

   Finds neighbouring pairs of features in sequences

Description

   twofeat reads in the feature tables of sequences and reports
   occurances of pairs of specified features.

   This is intended for use as a simple data-mining tool to enable you to
   look for instances of pairs of features that occur near to each other
   in the same sequence entry.

   For each of the pair of features, you can specify its type name, its
   sense, its score and any tag/value pairs, amongst other things.

   You can then specify the type of relationship that the two features
   should have. You can specify the minimum and maximum distance between
   them. You can specify the type of overlap allowed: Any type of overlap
   or no overlap is allowed, Overlap required, No overlaps are allowed,
   Overlap required but one feature must not be completely within the
   other, Feature A must be completely enclosed within feature B, Feature
   B must be completely enclosed within feature A. You can specify that
   the distance should be measured from the nearest ends of the two
   features, From the left ends, From right ends, From the furthest ends.
   You can specify that the features should be in any sense, in the same
   sense or in opposite senses. You can specify that the features should
   be in any order, Feature A then feature B, Feature B then feature A.

   By default the resulting pairs of features found are then written to a
   report file as a single feature from the first postion of the
   left-most feature to the last position of the right-most feature. You
   can modify the output to report the pairs of features with no changes
   made to them.

Algorithm

For each sequence:
        identify the features that match the criteria for Feature A
        identify the features that match the criteria for Feature B
        compare all pairs of features
        if they satisfy the requirements output them to the report file

Usage

   Here is a sample session with twofeat

   Without the -twoout option the output report contains just one feature
   for every pair of features found.


% twofeat tembl:hsfau 
Finds neighbouring pairs of features in sequences
Type of first feature [*]: polyA_signal
Type of second feature [*]: polyA_site
The minimum distance between the features [0]: 10
The maximum distance between the features [0]: 50
Output report [hsfau.twofeat]: 

   Go to the input files for this example
   Go to the output files for this example

   Example 2

   The -twoout option makes the output report give the pairs of features
   found. The ouput report format type has been changed to display the
   full original pairs of faetures in GFF format.


% twofeat -twoout -rformat gff tembl:hsfau 
Finds neighbouring pairs of features in sequences
Type of first feature [*]: polyA_signal
Type of second feature [*]: polyA_site
The minimum distance between the features [0]: 10
The maximum distance between the features [0]: 50
Output report [hsfau.twofeat]: 

   Go to the output files for this example

Command line arguments

   Standard (Mandatory) qualifiers:
  [-sequence]          seqall     Sequence(s) filename and optional format, or
                                  reference (input USA)
   -atype              string     [*] By default every feature in the feature
                                  table is allowed. You can set this to be any
                                  feature type you wish to allow.
                                  See http://www3.ebi.ac.uk/Services/WebFeat/
                                  for a list of the EMBL feature types and see
                                  Appendix A of the Swissprot user manual in
                                  http://www.expasy.ch/txt/userman.txt for a
                                  list of the Swissprot feature types.
                                  The type may be wildcarded by using '*'.
                                  If you wish to allow more than one type,
                                  separate their names with the character '|',
                                  eg:
                                  *UTR | intron (Any string is accepted)
   -btype              string     [*] By default every feature in the feature
                                  table is allowed. You can set this to be any
                                  feature type you wish to allow.
                                  See http://www3.ebi.ac.uk/Services/WebFeat/
                                  for a list of the EMBL feature types and see
                                  Appendix A of the Swissprot user manual in
                                  http://www.expasy.ch/txt/userman.txt for a
                                  list of the Swissprot feature types.
                                  The type may be wildcarded by using '*'.
                                  If you wish to allow more than one type,
                                  separate their names with the character '|',
                                  eg:
                                  *UTR | intron (Any string is accepted)
   -minrange           integer    [0] If this is greater or equal to
                                  'maxrange', then no min or max range is
                                  specified (Any integer value)
   -maxrange           integer    [0] If this is less than or equal to
                                  'minrange', then no min or max range is
                                  specified (Any integer value)
  [-outfile]           report     Output report file name

   Additional (Optional) qualifiers (* if not always prompted):
   -asource            string     [*] By default any feature source in the
                                  feature table is allowed. You can set this
                                  to match any feature source you wish to
                                  allow.
                                  The source name is usually either the name
                                  of the program that detected the feature or
                                  it is the feature table (eg: EMBL) that the
                                  feature came from.
                                  The source may be wildcarded by using '*'.
                                  If you wish to allow more than one source,
                                  separate their names with the character '|',
                                  eg:
                                  gene* | embl (Any string is accepted)
   -asense             menu       [0] By default any feature sense is allowed.
                                  You can set this to match the required
                                  sense. (Values: 0 (Any sense); + (Forward
                                  sense); - (Reverse sense))
   -aminscore          float      [0.0] If this is greater than or equal to
                                  the maximum score, then any score is
                                  allowed. (Any numeric value)
   -amaxscore          float      [0.0] If this is less than or equal to the
                                  maximum score, then any score is permitted.
                                  (Any numeric value)
   -atag               string     [*] Tags are the types of extra values that
                                  a feature may have. For example in the EMBL
                                  feature table, a 'CDS' type of feature may
                                  have the tags '/codon', '/codon_start',
                                  '/db_xref', '/EC_number', '/evidence',
                                  '/exception', '/function', '/gene',
                                  '/label', '/map', '/note', '/number',
                                  '/partial', '/product', '/protein_id',
                                  '/pseudo', '/standard_name', '/translation',
                                  '/transl_except', '/transl_table', or
                                  '/usedin'. Some of these tags also have
                                  values, for example '/gene' can have the
                                  value of the gene name.
                                  By default any feature tag in the feature
                                  table is allowed. You can set this to match
                                  any feature tag you wish to allow.
                                  The tag may be wildcarded by using '*'.
                                  If you wish to allow more than one tag,
                                  separate their names with the character '|',
                                  eg:
                                  gene | label (Any string is accepted)
   -avalue             string     [*] Tag values are the values associated
                                  with a feature tag. Tags are the types of
                                  extra values that a feature may have. For
                                  example in the EMBL feature table, a 'CDS'
                                  type of feature may have the tags '/codon',
                                  '/codon_start', '/db_xref', '/EC_number',
                                  '/evidence', '/exception', '/function',
                                  '/gene', '/label', '/map', '/note',
                                  '/number', '/partial', '/product',
                                  '/protein_id', '/pseudo', '/standard_name',
                                  '/translation', '/transl_except',
                                  '/transl_table', or '/usedin'. Only some of
                                  these tags can have values, for example
                                  '/gene' can have the value of the gene name.
                                  By default any feature tag value in the
                                  feature table is allowed. You can set this
                                  to match any feature tag value you wish to
                                  allow.
                                  The tag value may be wildcarded by using
                                  '*'.
                                  If you wish to allow more than one tag
                                  value, separate their names with the
                                  character '|', eg:
                                  pax* | 10 (Any string is accepted)
   -bsource            string     [*] By default any feature source in the
                                  feature table is allowed. You can set this
                                  to match any feature source you wish to
                                  allow.
                                  The source name is usually either the name
                                  of the program that detected the feature or
                                  it is the feature table (eg: EMBL) that the
                                  feature came from.
                                  The source may be wildcarded by using '*'.
                                  If you wish to allow more than one source,
                                  separate their names with the character '|',
                                  eg:
                                  gene* | embl (Any string is accepted)
   -bsense             menu       [0] By default any feature sense is allowed.
                                  You can set this to match the required
                                  sense. (Values: 0 (Any sense); + (Forward
                                  sense); - (Reverse sense))
   -bminscore          float      [0.0] If this is greater than or equal to
                                  the maximum score, then any score is
                                  allowed. (Any numeric value)
   -bmaxscore          float      [0.0] If this is less than or equal to the
                                  maximum score, then any score is permitted.
                                  (Any numeric value)
   -btag               string     [*] Tags are the types of extra values that
                                  a feature may have. For example in the EMBL
                                  feature table, a 'CDS' type of feature may
                                  have the tags '/codon', '/codon_start',
                                  '/db_xref', '/EC_number', '/evidence',
                                  '/exception', '/function', '/gene',
                                  '/label', '/map', '/note', '/number',
                                  '/partial', '/product', '/protein_id',
                                  '/pseudo', '/standard_name', '/translation',
                                  '/transl_except', '/transl_table', or
                                  '/usedin'. Some of these tags also have
                                  values, for example '/gene' can have the
                                  value of the gene name.
                                  By default any feature tag in the feature
                                  table is allowed. You can set this to match
                                  any feature tag you wish to allow.
                                  The tag may be wildcarded by using '*'.
                                  If you wish to allow more than one tag,
                                  separate their names with the character '|',
                                  eg:
                                  gene | label (Any string is accepted)
   -bvalue             string     [*] Tag values are the values associated
                                  with a feature tag. Tags are the types of
                                  extra values that a feature may have. For
                                  example in the EMBL feature table, a 'CDS'
                                  type of feature may have the tags '/codon',
                                  '/codon_start', '/db_xref', '/EC_number',
                                  '/evidence', '/exception', '/function',
                                  '/gene', '/label', '/map', '/note',
                                  '/number', '/partial', '/product',
                                  '/protein_id', '/pseudo', '/standard_name',
                                  '/translation', '/transl_except',
                                  '/transl_table', or '/usedin'. Only some of
                                  these tags can have values, for example
                                  '/gene' can have the value of the gene name.
                                  By default any feature tag value in the
                                  feature table is allowed. You can set this
                                  to match any feature tag value you wish to
                                  allow.
                                  The tag value may be wildcarded by using
                                  '*'.
                                  If you wish to allow more than one tag
                                  value, separate their names with the
                                  character '|', eg:
                                  pax* | 10 (Any string is accepted)
   -overlap            menu       [A] This allows you to specify the allowed
                                  overlaps of the features A and B.
                                  You can allow any or no overlaps, specify
                                  that they must or must not overlap, that one
                                  must or must not be wholly enclosed within
                                  another feature. (Values: A (Any); O
                                  (Overlap required); NO (No overlaps are
                                  allowed); NW (Overlap required but not
                                  within); AW (A must be all within B); BW (B
                                  must be all within A))
   -rangetype          menu       [N] This allows you to specify the positions
                                  from which the allowed minimum or maximum
                                  distance between the features is measured
                                  (Values: N (From nearest ends); L (From left
                                  ends); R (From right ends); F (From
                                  furthest ends))
   -sense              menu       [A] This allows you to specify the required
                                  sense that the two features must be on. This
                                  is ignored (always 'Any') when looking at
                                  protein sequence features. (Values: A (Any
                                  sense); S (Same sense); O (Opposite sense))
   -order              menu       [A] This allows you to specify the required
                                  order of the two features. The order is
                                  measured from the start positions of the
                                  features. This criterion is always applied
                                  despite the specified overlap type required.
                                  (Values: A (Any); AB (Feature A then
                                  feature B); BA (Feature B then feature A))
   -twoout             toggle     [N] If you set this to be true, then the two
                                  features themselves will be written out. If
                                  it is left as false, then a single feature
                                  will be written out covering the two
                                  features you found.
*  -typeout            string     [misc_feature] If you have specified that
                                  the pairs of features that are found should
                                  be reported as one feature in the ouput,
                                  then you can specify the 'type' name of the
                                  new feature here. By default every feature
                                  in the feature table is allowed. See
                                  http://www3.ebi.ac.uk/Services/WebFeat/ for
                                  a list of the EMBL feature types and see
                                  Appendix A of the Swissprot user manual in
                                  http://www.expasy.ch/txt/userman.txt for a
                                  list of the Swissprot feature types. If you
                                  specify an invalid feature type name, then
                                  the default name 'misc_feature' is used.
                                  (Any string is accepted)

   Advanced (Unprompted) qualifiers: (none)
   Associated qualifiers:

   "-sequence" associated qualifiers
   -sbegin1            integer    Start of each sequence to be used
   -send1              integer    End of each sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -sformat1           string     Input sequence format
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name

   "-outfile" associated qualifiers
   -rformat2           string     Report format
   -rname2             string     Base file name
   -rextension2        string     File name extension
   -rdirectory2        string     Output directory
   -raccshow2          boolean    Show accession number in the report
   -rdesshow2          boolean    Show description in the report
   -rscoreshow2        boolean    Show the score in the report
   -rusashow2          boolean    Show the full USA in the report

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write standard output
   -filter             boolean    Read standard input, write standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages

Input file format

   twofeat reads any normal sequence USAs.

  Input files for usage example

   'tembl:hsfau' is a sequence entry in the example nucleic acid database
   'tembl'

  Database entry: tembl:hsfau

ID   HSFAU      standard; RNA; HUM; 518 BP.
XX
AC   X65923;
XX
SV   X65923.1
XX
DT   13-MAY-1992 (Rel. 31, Created)
DT   23-SEP-1993 (Rel. 37, Last updated, Version 10)
XX
DE   H.sapiens fau mRNA
XX
KW   fau gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia
;
OC   Eutheria; Primates; Catarrhini; Hominidae; Homo.
XX
RN   [1]
RP   1-518
RA   Michiels L.M.R.;
RT   ;
RL   Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.
RL   L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,
RL   Universiteisplein 1, 2610 Wilrijk, BELGIUM
XX
RN   [2]
RP   1-518
RX   MEDLINE; 93368957.
RA   Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;
RT   " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed as
RT   an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";
RL   Oncogene 8:2537-2546(1993).
XX
DR   SWISS-PROT; P35544; UBIM_HUMAN.
DR   SWISS-PROT; Q05472; RS30_HUMAN.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..518
FT                   /chromosome="11q"
FT                   /db_xref="taxon:9606"
FT                   /organism="Homo sapiens"
FT                   /tissue_type="placenta"
FT                   /clone_lib="cDNA"
FT                   /clone="pUIA 631"
FT                   /map="13"
FT   misc_feature    57..278
FT                   /note="ubiquitin like part"
FT   CDS             57..458
FT                   /db_xref="SWISS-PROT:P35544"
FT                   /db_xref="SWISS-PROT:Q05472"
FT                   /gene="fau"
FT                   /protein_id="CAA46716.1"
FT                   /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLA
G
FT                   APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKT
G
FT                   RAKRRMQYNRRFVNVVPTFGKKKGPNANS"
FT   misc_feature    98..102
FT                   /note="nucleolar localization signal"
FT   misc_feature    279..458
FT                   /note="S30 part"
FT   polyA_signal    484..489
FT   polyA_site      509
XX
SQ   Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;
     ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc        6
0
     agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg       12
0
     cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc       18
0
     tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc       24
0
     tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc       30
0
     gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga       36
0
     agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca       42
0
     cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc       48
0
     tctaataaaa aagccactta gttcagtcaa aaaaaaaa                               51
8
//

Output file format

   The output is a standard EMBOSS report file.

   The results can be output in one of several styles by using the
   command-line qualifier -rformat xxx, where 'xxx' is replaced by the
   name of the required format. The available format names are: embl,
   genbank, gff, pir, swiss, trace, listfile, dbmotif, diffseq, excel,
   feattable, motif, regions, seqtable, simple, srs, table, tagseq

   See: http://emboss.sf.net/docs/themes/ReportFormats.html for further
   information on report formats.

   twofeat outputs a report format file. The default format is table

  Output files for usage example

  File: hsfau.twofeat

########################################
# Program: twofeat
# Rundate: Sat Jul 15 2006 12:00:00
# Commandline: twofeat
#    [-sequence] tembl:hsfau
#    -atype polyA_signal
#    -btype polyA_site
#    -minrange 10
#    -maxrange 50
# Report_format: table
# Report_file: hsfau.twofeat
########################################

#=======================================
#
# Sequence: HSFAU     from: 1   to: 518
# HitCount: 1
#=======================================

  Start     End   Score starta   enda startb   endb
    484     509   0.000    484    489    509    509

#---------------------------------------
#---------------------------------------

  Output files for usage example 2

  File: hsfau.twofeat

##gff-version 2.0
##date 2006-07-15
##Type DNA HSFAU
HSFAU   EMBL    polyA_signal    484     489     0.000   +       .       Sequenc
e "HSFAU.6"
HSFAU   EMBL    polyA_site      509     509     0.000   +       .       Sequenc
e "HSFAU.7" ; FeatFlags "0x40"

Data files

   None.

Notes

   It can't find features that are not in the input sequences. It has no
   way of checking whether the input features are correct or not.
   Remember this when you are searching public databases.

References

   None.

Warnings

   None.

Diagnostic Error Messages

   None.

Exit status

   It always exits with status 0.

Known bugs

   There is a slight memory leak that must be fixed at some time. This
   does no affect the results.

See also

   Program name                      Description
   coderet      Extract CDS, mRNA and translations from feature tables
   extractfeat  Extract features from a sequence
   maskfeat     Mask off features of a sequence
   showfeat     Show features of a sequence

Author(s)

   Gary Williams (gwilliam  rfcgr.mrc.ac.uk)
   MRC Rosalind Franklin Centre for Genomics Research Wellcome Trust
   Genome Campus, Hinxton, Cambridge, CB10 1SB, UK

History

   Written (2002) - Gary Williams

Target users

   This program is intended to be used by everyone and everything, from
   naive users to embedded scripts.

Comments

   None
